data_7NS1 # _entry.id 7NS1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7NS1 pdb_00007ns1 10.2210/pdb7ns1/pdb WWPDB D_1292114093 ? ? BMRB 50764 ? 10.13018/BMR50764 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-07-21 2 'Structure model' 1 1 2021-09-29 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' database_2 3 2 'Structure model' pdbx_database_proc 4 3 'Structure model' pdbx_database_status 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_database_2.pdbx_DOI' 4 2 'Structure model' '_database_2.pdbx_database_accession' 5 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 6 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7NS1 _pdbx_database_status.recvd_initial_deposition_date 2021-03-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB . 50767 unspecified BMRB . 50764 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Nonin-Lecomte, S.' 1 0000-0001-5155-8088 'fermon, L.' 2 ? 'Felden, B.' 3 0000-0003-2803-0626 'Pinel-Marie, M.L.' 4 0000-0001-5128-0741 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Toxins _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2072-6651 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Bacterial Type I Toxins: Folding and Membrane Interactions.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/toxins13070490 _citation.pdbx_database_id_PubMed 34357962 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nonin-Lecomte, S.' 1 ? primary 'Fermon, L.' 2 ? primary 'Felden, B.' 3 ? primary 'Pinel-Marie, M.L.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Snterotoxin A' _entity.formula_weight 3465.366 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'synthetic peptide' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MITISTMLQFGLFLIALIGLVIKLIELSNKK _entity_poly.pdbx_seq_one_letter_code_can MITISTMLQFGLFLIALIGLVIKLIELSNKK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 THR n 1 4 ILE n 1 5 SER n 1 6 THR n 1 7 MET n 1 8 LEU n 1 9 GLN n 1 10 PHE n 1 11 GLY n 1 12 LEU n 1 13 PHE n 1 14 LEU n 1 15 ILE n 1 16 ALA n 1 17 LEU n 1 18 ILE n 1 19 GLY n 1 20 LEU n 1 21 VAL n 1 22 ILE n 1 23 LYS n 1 24 LEU n 1 25 ILE n 1 26 GLU n 1 27 LEU n 1 28 SER n 1 29 ASN n 1 30 LYS n 1 31 LYS n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 31 _pdbx_entity_src_syn.organism_scientific 'Staphylococcus aureus' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 1280 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 LYS 31 31 31 LYS LYS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7NS1 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7NS1 _struct.title 'S. aureus pepG1 NMR solution structure' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7NS1 _struct_keywords.text 'pepG1, sprG1 product, S. aureus, toxin, solution structure' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0U5AQ00_STAAU _struct_ref.pdbx_db_accession A0A0U5AQ00 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MITISTMLQFGLFLIALIGLVIKLIELSNKK _struct_ref.pdbx_align_begin 14 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7NS1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0U5AQ00 _struct_ref_seq.db_align_beg 14 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 44 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 31 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3220 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details 'no assembly' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 3 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 29 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 3 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 29 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ2 A LYS 23 ? ? OE1 A GLU 26 ? ? 1.21 2 1 HZ1 A LYS 30 ? ? OXT A LYS 31 ? ? 1.23 3 1 O A ASN 29 ? ? HZ1 A LYS 31 ? ? 1.24 4 1 HG1 A THR 3 ? ? OG1 A THR 6 ? ? 1.25 5 1 OD1 A ASN 29 ? ? HZ3 A LYS 31 ? ? 1.28 6 1 OG1 A THR 3 ? ? OG1 A THR 6 ? ? 2.17 7 2 HZ1 A LYS 23 ? ? OE1 A GLU 26 ? ? 1.23 8 2 OG1 A THR 3 ? ? HG1 A THR 6 ? ? 1.24 9 2 HZ3 A LYS 30 ? ? OXT A LYS 31 ? ? 1.24 10 2 O A ASN 29 ? ? HZ2 A LYS 31 ? ? 1.24 11 2 OD1 A ASN 29 ? ? HZ1 A LYS 31 ? ? 1.29 12 3 O A GLU 26 ? ? HZ2 A LYS 30 ? ? 1.22 13 3 HZ2 A LYS 23 ? ? OE1 A GLU 26 ? ? 1.22 14 3 O A SER 28 ? ? HZ3 A LYS 31 ? ? 1.27 15 3 O A LYS 30 ? ? HZ1 A LYS 31 ? ? 1.28 16 3 HG1 A THR 3 ? ? OG1 A THR 6 ? ? 1.31 17 4 HZ2 A LYS 23 ? ? OE1 A GLU 26 ? ? 1.23 18 4 HG1 A THR 3 ? ? OG1 A THR 6 ? ? 1.26 19 4 HZ2 A LYS 30 ? ? OXT A LYS 31 ? ? 1.30 20 4 OG1 A THR 3 ? ? OG1 A THR 6 ? ? 2.19 21 5 HZ2 A LYS 23 ? ? OE1 A GLU 26 ? ? 1.22 22 5 OG1 A THR 3 ? ? HG1 A THR 6 ? ? 1.24 23 5 O A ASN 29 ? ? HZ3 A LYS 31 ? ? 1.25 24 5 OD1 A ASN 29 ? ? HZ2 A LYS 31 ? ? 1.27 25 5 HZ1 A LYS 30 ? ? OXT A LYS 31 ? ? 1.30 26 5 O A LYS 30 ? ? HZ1 A LYS 31 ? ? 1.30 27 5 OG A SER 28 ? ? H A ASN 29 ? ? 1.39 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 5 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 28 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -82.50 _pdbx_validate_torsion.psi -146.30 # _pdbx_nmr_ensemble.entry_id 7NS1 _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 5 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7NS1 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.3 mM no PG1S, 50 % v/v no H2O, 50 % v/v DIMETHYL-D6, 98% isoPrOH, 0.01 mM no EDTA, 50%H2O/50%isoPrOH' _pdbx_nmr_sample_details.solvent_system 50%H2O/50%isoPrOH _pdbx_nmr_sample_details.label pepG1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 PG1S 0.3 ? mM no 1 H2O 50 ? '% v/v' no 1 isoPrOH 50 ? '% v/v' 'DIMETHYL-D6, 98%' 1 EDTA 0.01 ? mM no # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details 'no salt added' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label NMR-303 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D NOESY 300ms' 1 isotropic 6 1 1 '2D NOESY 150ms' 1 isotropic 2 1 1 '2D NOESY 80ms' 1 isotropic 3 1 1 '2D TOCSY 80ms' 1 isotropic # loop_ _pdbx_nmr_refine.entry_id _pdbx_nmr_refine.method _pdbx_nmr_refine.details _pdbx_nmr_refine.software_ordinal 7NS1 'simulated annealing' 'eefx+tDB potentials' 1 7NS1 'torsion angle dynamics' 'eefx+tDB potentials' 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement 'X-PLOR NIH' 3.1 'Schwieters, Kuszewski, Tjandra and Clore' 2 'structure calculation' 'X-PLOR NIH' 3.1 'Schwieters, Kuszewski, Tjandra and Clore' 3 'chemical shift assignment' 'CcpNmr Analysis' 2.4 ;Wim F. Vranken, Wayne Boucher, Tim J. Stevens, Rasmus H. Fogh, Anne Pajon, Miguel Llinas, Eldon L. Ulrich, John L. Markley, John Ionides and Ernest D. Laue (2005). The CCPN Data Model for NMR Spectroscopy: Development of a Software Pipeline. Proteins 59, 687 - 696. ; 4 'peak picking' 'CcpNmr Analysis' 2.4 ;Wim F. Vranken, Wayne Boucher, Tim J. Stevens, Rasmus H. Fogh, Anne Pajon, Miguel Llinas, Eldon L. Ulrich, John L. Markley, John Ionides and Ernest D. Laue (2005). The CCPN Data Model for NMR Spectroscopy: Development of a Software Pipeline. Proteins 59, 687 - 696. ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 GLN N N N N 31 GLN CA C N S 32 GLN C C N N 33 GLN O O N N 34 GLN CB C N N 35 GLN CG C N N 36 GLN CD C N N 37 GLN OE1 O N N 38 GLN NE2 N N N 39 GLN OXT O N N 40 GLN H H N N 41 GLN H2 H N N 42 GLN HA H N N 43 GLN HB2 H N N 44 GLN HB3 H N N 45 GLN HG2 H N N 46 GLN HG3 H N N 47 GLN HE21 H N N 48 GLN HE22 H N N 49 GLN HXT H N N 50 GLU N N N N 51 GLU CA C N S 52 GLU C C N N 53 GLU O O N N 54 GLU CB C N N 55 GLU CG C N N 56 GLU CD C N N 57 GLU OE1 O N N 58 GLU OE2 O N N 59 GLU OXT O N N 60 GLU H H N N 61 GLU H2 H N N 62 GLU HA H N N 63 GLU HB2 H N N 64 GLU HB3 H N N 65 GLU HG2 H N N 66 GLU HG3 H N N 67 GLU HE2 H N N 68 GLU HXT H N N 69 GLY N N N N 70 GLY CA C N N 71 GLY C C N N 72 GLY O O N N 73 GLY OXT O N N 74 GLY H H N N 75 GLY H2 H N N 76 GLY HA2 H N N 77 GLY HA3 H N N 78 GLY HXT H N N 79 ILE N N N N 80 ILE CA C N S 81 ILE C C N N 82 ILE O O N N 83 ILE CB C N S 84 ILE CG1 C N N 85 ILE CG2 C N N 86 ILE CD1 C N N 87 ILE OXT O N N 88 ILE H H N N 89 ILE H2 H N N 90 ILE HA H N N 91 ILE HB H N N 92 ILE HG12 H N N 93 ILE HG13 H N N 94 ILE HG21 H N N 95 ILE HG22 H N N 96 ILE HG23 H N N 97 ILE HD11 H N N 98 ILE HD12 H N N 99 ILE HD13 H N N 100 ILE HXT H N N 101 LEU N N N N 102 LEU CA C N S 103 LEU C C N N 104 LEU O O N N 105 LEU CB C N N 106 LEU CG C N N 107 LEU CD1 C N N 108 LEU CD2 C N N 109 LEU OXT O N N 110 LEU H H N N 111 LEU H2 H N N 112 LEU HA H N N 113 LEU HB2 H N N 114 LEU HB3 H N N 115 LEU HG H N N 116 LEU HD11 H N N 117 LEU HD12 H N N 118 LEU HD13 H N N 119 LEU HD21 H N N 120 LEU HD22 H N N 121 LEU HD23 H N N 122 LEU HXT H N N 123 LYS N N N N 124 LYS CA C N S 125 LYS C C N N 126 LYS O O N N 127 LYS CB C N N 128 LYS CG C N N 129 LYS CD C N N 130 LYS CE C N N 131 LYS NZ N N N 132 LYS OXT O N N 133 LYS H H N N 134 LYS H2 H N N 135 LYS HA H N N 136 LYS HB2 H N N 137 LYS HB3 H N N 138 LYS HG2 H N N 139 LYS HG3 H N N 140 LYS HD2 H N N 141 LYS HD3 H N N 142 LYS HE2 H N N 143 LYS HE3 H N N 144 LYS HZ1 H N N 145 LYS HZ2 H N N 146 LYS HZ3 H N N 147 LYS HXT H N N 148 MET N N N N 149 MET CA C N S 150 MET C C N N 151 MET O O N N 152 MET CB C N N 153 MET CG C N N 154 MET SD S N N 155 MET CE C N N 156 MET OXT O N N 157 MET H H N N 158 MET H2 H N N 159 MET HA H N N 160 MET HB2 H N N 161 MET HB3 H N N 162 MET HG2 H N N 163 MET HG3 H N N 164 MET HE1 H N N 165 MET HE2 H N N 166 MET HE3 H N N 167 MET HXT H N N 168 PHE N N N N 169 PHE CA C N S 170 PHE C C N N 171 PHE O O N N 172 PHE CB C N N 173 PHE CG C Y N 174 PHE CD1 C Y N 175 PHE CD2 C Y N 176 PHE CE1 C Y N 177 PHE CE2 C Y N 178 PHE CZ C Y N 179 PHE OXT O N N 180 PHE H H N N 181 PHE H2 H N N 182 PHE HA H N N 183 PHE HB2 H N N 184 PHE HB3 H N N 185 PHE HD1 H N N 186 PHE HD2 H N N 187 PHE HE1 H N N 188 PHE HE2 H N N 189 PHE HZ H N N 190 PHE HXT H N N 191 SER N N N N 192 SER CA C N S 193 SER C C N N 194 SER O O N N 195 SER CB C N N 196 SER OG O N N 197 SER OXT O N N 198 SER H H N N 199 SER H2 H N N 200 SER HA H N N 201 SER HB2 H N N 202 SER HB3 H N N 203 SER HG H N N 204 SER HXT H N N 205 THR N N N N 206 THR CA C N S 207 THR C C N N 208 THR O O N N 209 THR CB C N R 210 THR OG1 O N N 211 THR CG2 C N N 212 THR OXT O N N 213 THR H H N N 214 THR H2 H N N 215 THR HA H N N 216 THR HB H N N 217 THR HG1 H N N 218 THR HG21 H N N 219 THR HG22 H N N 220 THR HG23 H N N 221 THR HXT H N N 222 VAL N N N N 223 VAL CA C N S 224 VAL C C N N 225 VAL O O N N 226 VAL CB C N N 227 VAL CG1 C N N 228 VAL CG2 C N N 229 VAL OXT O N N 230 VAL H H N N 231 VAL H2 H N N 232 VAL HA H N N 233 VAL HB H N N 234 VAL HG11 H N N 235 VAL HG12 H N N 236 VAL HG13 H N N 237 VAL HG21 H N N 238 VAL HG22 H N N 239 VAL HG23 H N N 240 VAL HXT H N N 241 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 GLN N CA sing N N 29 GLN N H sing N N 30 GLN N H2 sing N N 31 GLN CA C sing N N 32 GLN CA CB sing N N 33 GLN CA HA sing N N 34 GLN C O doub N N 35 GLN C OXT sing N N 36 GLN CB CG sing N N 37 GLN CB HB2 sing N N 38 GLN CB HB3 sing N N 39 GLN CG CD sing N N 40 GLN CG HG2 sing N N 41 GLN CG HG3 sing N N 42 GLN CD OE1 doub N N 43 GLN CD NE2 sing N N 44 GLN NE2 HE21 sing N N 45 GLN NE2 HE22 sing N N 46 GLN OXT HXT sing N N 47 GLU N CA sing N N 48 GLU N H sing N N 49 GLU N H2 sing N N 50 GLU CA C sing N N 51 GLU CA CB sing N N 52 GLU CA HA sing N N 53 GLU C O doub N N 54 GLU C OXT sing N N 55 GLU CB CG sing N N 56 GLU CB HB2 sing N N 57 GLU CB HB3 sing N N 58 GLU CG CD sing N N 59 GLU CG HG2 sing N N 60 GLU CG HG3 sing N N 61 GLU CD OE1 doub N N 62 GLU CD OE2 sing N N 63 GLU OE2 HE2 sing N N 64 GLU OXT HXT sing N N 65 GLY N CA sing N N 66 GLY N H sing N N 67 GLY N H2 sing N N 68 GLY CA C sing N N 69 GLY CA HA2 sing N N 70 GLY CA HA3 sing N N 71 GLY C O doub N N 72 GLY C OXT sing N N 73 GLY OXT HXT sing N N 74 ILE N CA sing N N 75 ILE N H sing N N 76 ILE N H2 sing N N 77 ILE CA C sing N N 78 ILE CA CB sing N N 79 ILE CA HA sing N N 80 ILE C O doub N N 81 ILE C OXT sing N N 82 ILE CB CG1 sing N N 83 ILE CB CG2 sing N N 84 ILE CB HB sing N N 85 ILE CG1 CD1 sing N N 86 ILE CG1 HG12 sing N N 87 ILE CG1 HG13 sing N N 88 ILE CG2 HG21 sing N N 89 ILE CG2 HG22 sing N N 90 ILE CG2 HG23 sing N N 91 ILE CD1 HD11 sing N N 92 ILE CD1 HD12 sing N N 93 ILE CD1 HD13 sing N N 94 ILE OXT HXT sing N N 95 LEU N CA sing N N 96 LEU N H sing N N 97 LEU N H2 sing N N 98 LEU CA C sing N N 99 LEU CA CB sing N N 100 LEU CA HA sing N N 101 LEU C O doub N N 102 LEU C OXT sing N N 103 LEU CB CG sing N N 104 LEU CB HB2 sing N N 105 LEU CB HB3 sing N N 106 LEU CG CD1 sing N N 107 LEU CG CD2 sing N N 108 LEU CG HG sing N N 109 LEU CD1 HD11 sing N N 110 LEU CD1 HD12 sing N N 111 LEU CD1 HD13 sing N N 112 LEU CD2 HD21 sing N N 113 LEU CD2 HD22 sing N N 114 LEU CD2 HD23 sing N N 115 LEU OXT HXT sing N N 116 LYS N CA sing N N 117 LYS N H sing N N 118 LYS N H2 sing N N 119 LYS CA C sing N N 120 LYS CA CB sing N N 121 LYS CA HA sing N N 122 LYS C O doub N N 123 LYS C OXT sing N N 124 LYS CB CG sing N N 125 LYS CB HB2 sing N N 126 LYS CB HB3 sing N N 127 LYS CG CD sing N N 128 LYS CG HG2 sing N N 129 LYS CG HG3 sing N N 130 LYS CD CE sing N N 131 LYS CD HD2 sing N N 132 LYS CD HD3 sing N N 133 LYS CE NZ sing N N 134 LYS CE HE2 sing N N 135 LYS CE HE3 sing N N 136 LYS NZ HZ1 sing N N 137 LYS NZ HZ2 sing N N 138 LYS NZ HZ3 sing N N 139 LYS OXT HXT sing N N 140 MET N CA sing N N 141 MET N H sing N N 142 MET N H2 sing N N 143 MET CA C sing N N 144 MET CA CB sing N N 145 MET CA HA sing N N 146 MET C O doub N N 147 MET C OXT sing N N 148 MET CB CG sing N N 149 MET CB HB2 sing N N 150 MET CB HB3 sing N N 151 MET CG SD sing N N 152 MET CG HG2 sing N N 153 MET CG HG3 sing N N 154 MET SD CE sing N N 155 MET CE HE1 sing N N 156 MET CE HE2 sing N N 157 MET CE HE3 sing N N 158 MET OXT HXT sing N N 159 PHE N CA sing N N 160 PHE N H sing N N 161 PHE N H2 sing N N 162 PHE CA C sing N N 163 PHE CA CB sing N N 164 PHE CA HA sing N N 165 PHE C O doub N N 166 PHE C OXT sing N N 167 PHE CB CG sing N N 168 PHE CB HB2 sing N N 169 PHE CB HB3 sing N N 170 PHE CG CD1 doub Y N 171 PHE CG CD2 sing Y N 172 PHE CD1 CE1 sing Y N 173 PHE CD1 HD1 sing N N 174 PHE CD2 CE2 doub Y N 175 PHE CD2 HD2 sing N N 176 PHE CE1 CZ doub Y N 177 PHE CE1 HE1 sing N N 178 PHE CE2 CZ sing Y N 179 PHE CE2 HE2 sing N N 180 PHE CZ HZ sing N N 181 PHE OXT HXT sing N N 182 SER N CA sing N N 183 SER N H sing N N 184 SER N H2 sing N N 185 SER CA C sing N N 186 SER CA CB sing N N 187 SER CA HA sing N N 188 SER C O doub N N 189 SER C OXT sing N N 190 SER CB OG sing N N 191 SER CB HB2 sing N N 192 SER CB HB3 sing N N 193 SER OG HG sing N N 194 SER OXT HXT sing N N 195 THR N CA sing N N 196 THR N H sing N N 197 THR N H2 sing N N 198 THR CA C sing N N 199 THR CA CB sing N N 200 THR CA HA sing N N 201 THR C O doub N N 202 THR C OXT sing N N 203 THR CB OG1 sing N N 204 THR CB CG2 sing N N 205 THR CB HB sing N N 206 THR OG1 HG1 sing N N 207 THR CG2 HG21 sing N N 208 THR CG2 HG22 sing N N 209 THR CG2 HG23 sing N N 210 THR OXT HXT sing N N 211 VAL N CA sing N N 212 VAL N H sing N N 213 VAL N H2 sing N N 214 VAL CA C sing N N 215 VAL CA CB sing N N 216 VAL CA HA sing N N 217 VAL C O doub N N 218 VAL C OXT sing N N 219 VAL CB CG1 sing N N 220 VAL CB CG2 sing N N 221 VAL CB HB sing N N 222 VAL CG1 HG11 sing N N 223 VAL CG1 HG12 sing N N 224 VAL CG1 HG13 sing N N 225 VAL CG2 HG21 sing N N 226 VAL CG2 HG22 sing N N 227 VAL CG2 HG23 sing N N 228 VAL OXT HXT sing N N 229 # _pdbx_audit_support.funding_organization 'Centre National de la Recherche Scientifique (CNRS)' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details 'cryo probe TCI' # _atom_sites.entry_id 7NS1 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_