data_7NVJ # _entry.id 7NVJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7NVJ pdb_00007nvj 10.2210/pdb7nvj/pdb WWPDB D_1292114432 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-09-29 2 'Structure model' 1 1 2022-05-11 3 'Structure model' 1 2 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' atom_type 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_atom_type.pdbx_N_electrons' 13 3 'Structure model' '_atom_type.pdbx_scat_Z' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7NVJ _pdbx_database_status.recvd_initial_deposition_date 2021-03-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Manoj Kumar, P.' 1 0000-0002-7083-5690 'Padala, P.' 2 0000-0002-6370-9805 'Isupov, M.N.' 3 0000-0001-6842-4289 'Wiener, R.' 4 0000-0002-4219-550X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 5708 _citation.page_last 5708 _citation.title 'Structural basis for UFM1 transfer from UBA5 to UFC1.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-021-25994-6 _citation.pdbx_database_id_PubMed 34588452 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kumar, M.' 1 ? primary 'Padala, P.' 2 ? primary 'Fahoum, J.' 3 ? primary 'Hassouna, F.' 4 ? primary 'Tsaban, T.' 5 ? primary 'Zoltsman, G.' 6 ? primary 'Banerjee, S.' 7 ? primary 'Cohen-Kfir, E.' 8 ? primary 'Dessau, M.' 9 0000-0002-1954-3625 primary 'Rosenzweig, R.' 10 0000-0002-4019-5135 primary 'Isupov, M.N.' 11 ? primary 'Schueler-Furman, O.' 12 0000-0002-1624-0362 primary 'Wiener, R.' 13 0000-0002-4219-550X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ubiquitin-fold modifier-conjugating enzyme 1' 19375.254 1 ? 'Y110A, F121A' ? ? 2 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 3 water nat water 18.015 47 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ufm1-conjugating enzyme 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GMADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYE FDIEFDIPITYPTTAPEIAVPELDGKTAKMARGGKICLTDHAKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVI QHKEKCNQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GMADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYE FDIEFDIPITYPTTAPEIAVPELDGKTAKMARGGKICLTDHAKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVI QHKEKCNQ ; _entity_poly.pdbx_strand_id AAA _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 ALA n 1 4 ASP n 1 5 GLU n 1 6 ALA n 1 7 THR n 1 8 ARG n 1 9 ARG n 1 10 VAL n 1 11 VAL n 1 12 SER n 1 13 GLU n 1 14 ILE n 1 15 PRO n 1 16 VAL n 1 17 LEU n 1 18 LYS n 1 19 THR n 1 20 ASN n 1 21 ALA n 1 22 GLY n 1 23 PRO n 1 24 ARG n 1 25 ASP n 1 26 ARG n 1 27 GLU n 1 28 LEU n 1 29 TRP n 1 30 VAL n 1 31 GLN n 1 32 ARG n 1 33 LEU n 1 34 LYS n 1 35 GLU n 1 36 GLU n 1 37 TYR n 1 38 GLN n 1 39 SER n 1 40 LEU n 1 41 ILE n 1 42 ARG n 1 43 TYR n 1 44 VAL n 1 45 GLU n 1 46 ASN n 1 47 ASN n 1 48 LYS n 1 49 ASN n 1 50 ALA n 1 51 ASP n 1 52 ASN n 1 53 ASP n 1 54 TRP n 1 55 PHE n 1 56 ARG n 1 57 LEU n 1 58 GLU n 1 59 SER n 1 60 ASN n 1 61 LYS n 1 62 GLU n 1 63 GLY n 1 64 THR n 1 65 ARG n 1 66 TRP n 1 67 PHE n 1 68 GLY n 1 69 LYS n 1 70 CYS n 1 71 TRP n 1 72 TYR n 1 73 ILE n 1 74 HIS n 1 75 ASP n 1 76 LEU n 1 77 LEU n 1 78 LYS n 1 79 TYR n 1 80 GLU n 1 81 PHE n 1 82 ASP n 1 83 ILE n 1 84 GLU n 1 85 PHE n 1 86 ASP n 1 87 ILE n 1 88 PRO n 1 89 ILE n 1 90 THR n 1 91 TYR n 1 92 PRO n 1 93 THR n 1 94 THR n 1 95 ALA n 1 96 PRO n 1 97 GLU n 1 98 ILE n 1 99 ALA n 1 100 VAL n 1 101 PRO n 1 102 GLU n 1 103 LEU n 1 104 ASP n 1 105 GLY n 1 106 LYS n 1 107 THR n 1 108 ALA n 1 109 LYS n 1 110 MET n 1 111 ALA n 1 112 ARG n 1 113 GLY n 1 114 GLY n 1 115 LYS n 1 116 ILE n 1 117 CYS n 1 118 LEU n 1 119 THR n 1 120 ASP n 1 121 HIS n 1 122 ALA n 1 123 LYS n 1 124 PRO n 1 125 LEU n 1 126 TRP n 1 127 ALA n 1 128 ARG n 1 129 ASN n 1 130 VAL n 1 131 PRO n 1 132 LYS n 1 133 PHE n 1 134 GLY n 1 135 LEU n 1 136 ALA n 1 137 HIS n 1 138 LEU n 1 139 MET n 1 140 ALA n 1 141 LEU n 1 142 GLY n 1 143 LEU n 1 144 GLY n 1 145 PRO n 1 146 TRP n 1 147 LEU n 1 148 ALA n 1 149 VAL n 1 150 GLU n 1 151 ILE n 1 152 PRO n 1 153 ASP n 1 154 LEU n 1 155 ILE n 1 156 GLN n 1 157 LYS n 1 158 GLY n 1 159 VAL n 1 160 ILE n 1 161 GLN n 1 162 HIS n 1 163 LYS n 1 164 GLU n 1 165 LYS n 1 166 CYS n 1 167 ASN n 1 168 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 168 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'UFC1, CGI-126, HSPC155' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'T7 Express' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET32A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 0 GLY GLY AAA . n A 1 2 MET 2 1 1 MET MET AAA . n A 1 3 ALA 3 2 2 ALA ALA AAA . n A 1 4 ASP 4 3 3 ASP ASP AAA . n A 1 5 GLU 5 4 4 GLU GLU AAA . n A 1 6 ALA 6 5 5 ALA ALA AAA . n A 1 7 THR 7 6 6 THR THR AAA . n A 1 8 ARG 8 7 7 ARG ARG AAA . n A 1 9 ARG 9 8 8 ARG ARG AAA . n A 1 10 VAL 10 9 9 VAL VAL AAA . n A 1 11 VAL 11 10 10 VAL VAL AAA . n A 1 12 SER 12 11 11 SER SER AAA . n A 1 13 GLU 13 12 12 GLU GLU AAA . n A 1 14 ILE 14 13 13 ILE ILE AAA . n A 1 15 PRO 15 14 14 PRO PRO AAA . n A 1 16 VAL 16 15 15 VAL VAL AAA . n A 1 17 LEU 17 16 16 LEU LEU AAA . n A 1 18 LYS 18 17 17 LYS LYS AAA . n A 1 19 THR 19 18 18 THR THR AAA . n A 1 20 ASN 20 19 19 ASN ASN AAA . n A 1 21 ALA 21 20 20 ALA ALA AAA . n A 1 22 GLY 22 21 21 GLY GLY AAA . n A 1 23 PRO 23 22 22 PRO PRO AAA . n A 1 24 ARG 24 23 23 ARG ARG AAA . n A 1 25 ASP 25 24 24 ASP ASP AAA . n A 1 26 ARG 26 25 25 ARG ARG AAA . n A 1 27 GLU 27 26 26 GLU GLU AAA . n A 1 28 LEU 28 27 27 LEU LEU AAA . n A 1 29 TRP 29 28 28 TRP TRP AAA . n A 1 30 VAL 30 29 29 VAL VAL AAA . n A 1 31 GLN 31 30 30 GLN GLN AAA . n A 1 32 ARG 32 31 31 ARG ARG AAA . n A 1 33 LEU 33 32 32 LEU LEU AAA . n A 1 34 LYS 34 33 33 LYS LYS AAA . n A 1 35 GLU 35 34 34 GLU GLU AAA . n A 1 36 GLU 36 35 35 GLU GLU AAA . n A 1 37 TYR 37 36 36 TYR TYR AAA . n A 1 38 GLN 38 37 37 GLN GLN AAA . n A 1 39 SER 39 38 38 SER SER AAA . n A 1 40 LEU 40 39 39 LEU LEU AAA . n A 1 41 ILE 41 40 40 ILE ILE AAA . n A 1 42 ARG 42 41 41 ARG ARG AAA . n A 1 43 TYR 43 42 42 TYR TYR AAA . n A 1 44 VAL 44 43 43 VAL VAL AAA . n A 1 45 GLU 45 44 44 GLU GLU AAA . n A 1 46 ASN 46 45 45 ASN ASN AAA . n A 1 47 ASN 47 46 46 ASN ASN AAA . n A 1 48 LYS 48 47 47 LYS LYS AAA . n A 1 49 ASN 49 48 48 ASN ASN AAA . n A 1 50 ALA 50 49 49 ALA ALA AAA . n A 1 51 ASP 51 50 50 ASP ASP AAA . n A 1 52 ASN 52 51 51 ASN ASN AAA . n A 1 53 ASP 53 52 52 ASP ASP AAA . n A 1 54 TRP 54 53 53 TRP TRP AAA . n A 1 55 PHE 55 54 54 PHE PHE AAA . n A 1 56 ARG 56 55 55 ARG ARG AAA . n A 1 57 LEU 57 56 56 LEU LEU AAA . n A 1 58 GLU 58 57 57 GLU GLU AAA . n A 1 59 SER 59 58 58 SER SER AAA . n A 1 60 ASN 60 59 59 ASN ASN AAA . n A 1 61 LYS 61 60 60 LYS LYS AAA . n A 1 62 GLU 62 61 61 GLU GLU AAA . n A 1 63 GLY 63 62 62 GLY GLY AAA . n A 1 64 THR 64 63 63 THR THR AAA . n A 1 65 ARG 65 64 64 ARG ARG AAA . n A 1 66 TRP 66 65 65 TRP TRP AAA . n A 1 67 PHE 67 66 66 PHE PHE AAA . n A 1 68 GLY 68 67 67 GLY GLY AAA . n A 1 69 LYS 69 68 68 LYS LYS AAA . n A 1 70 CYS 70 69 69 CYS CYS AAA . n A 1 71 TRP 71 70 70 TRP TRP AAA . n A 1 72 TYR 72 71 71 TYR TYR AAA . n A 1 73 ILE 73 72 72 ILE ILE AAA . n A 1 74 HIS 74 73 73 HIS HIS AAA . n A 1 75 ASP 75 74 74 ASP ASP AAA . n A 1 76 LEU 76 75 75 LEU LEU AAA . n A 1 77 LEU 77 76 76 LEU LEU AAA . n A 1 78 LYS 78 77 77 LYS LYS AAA . n A 1 79 TYR 79 78 78 TYR TYR AAA . n A 1 80 GLU 80 79 79 GLU GLU AAA . n A 1 81 PHE 81 80 80 PHE PHE AAA . n A 1 82 ASP 82 81 81 ASP ASP AAA . n A 1 83 ILE 83 82 82 ILE ILE AAA . n A 1 84 GLU 84 83 83 GLU GLU AAA . n A 1 85 PHE 85 84 84 PHE PHE AAA . n A 1 86 ASP 86 85 85 ASP ASP AAA . n A 1 87 ILE 87 86 86 ILE ILE AAA . n A 1 88 PRO 88 87 87 PRO PRO AAA . n A 1 89 ILE 89 88 88 ILE ILE AAA . n A 1 90 THR 90 89 89 THR THR AAA . n A 1 91 TYR 91 90 90 TYR TYR AAA . n A 1 92 PRO 92 91 91 PRO PRO AAA . n A 1 93 THR 93 92 92 THR THR AAA . n A 1 94 THR 94 93 93 THR THR AAA . n A 1 95 ALA 95 94 94 ALA ALA AAA . n A 1 96 PRO 96 95 95 PRO PRO AAA . n A 1 97 GLU 97 96 96 GLU GLU AAA . n A 1 98 ILE 98 97 97 ILE ILE AAA . n A 1 99 ALA 99 98 98 ALA ALA AAA . n A 1 100 VAL 100 99 99 VAL VAL AAA . n A 1 101 PRO 101 100 100 PRO PRO AAA . n A 1 102 GLU 102 101 101 GLU GLU AAA . n A 1 103 LEU 103 102 102 LEU LEU AAA . n A 1 104 ASP 104 103 103 ASP ASP AAA . n A 1 105 GLY 105 104 104 GLY GLY AAA . n A 1 106 LYS 106 105 105 LYS LYS AAA . n A 1 107 THR 107 106 106 THR THR AAA . n A 1 108 ALA 108 107 107 ALA ALA AAA . n A 1 109 LYS 109 108 108 LYS LYS AAA . n A 1 110 MET 110 109 109 MET MET AAA . n A 1 111 ALA 111 110 110 ALA ALA AAA . n A 1 112 ARG 112 111 111 ARG ARG AAA . n A 1 113 GLY 113 112 112 GLY GLY AAA . n A 1 114 GLY 114 113 113 GLY GLY AAA . n A 1 115 LYS 115 114 114 LYS LYS AAA . n A 1 116 ILE 116 115 115 ILE ILE AAA . n A 1 117 CYS 117 116 116 CYS CYS AAA . n A 1 118 LEU 118 117 117 LEU LEU AAA . n A 1 119 THR 119 118 118 THR THR AAA . n A 1 120 ASP 120 119 119 ASP ASP AAA . n A 1 121 HIS 121 120 120 HIS HIS AAA . n A 1 122 ALA 122 121 121 ALA ALA AAA . n A 1 123 LYS 123 122 122 LYS LYS AAA . n A 1 124 PRO 124 123 123 PRO PRO AAA . n A 1 125 LEU 125 124 124 LEU LEU AAA . n A 1 126 TRP 126 125 125 TRP TRP AAA . n A 1 127 ALA 127 126 126 ALA ALA AAA . n A 1 128 ARG 128 127 127 ARG ARG AAA . n A 1 129 ASN 129 128 128 ASN ASN AAA . n A 1 130 VAL 130 129 129 VAL VAL AAA . n A 1 131 PRO 131 130 130 PRO PRO AAA . n A 1 132 LYS 132 131 131 LYS LYS AAA . n A 1 133 PHE 133 132 132 PHE PHE AAA . n A 1 134 GLY 134 133 133 GLY GLY AAA . n A 1 135 LEU 135 134 134 LEU LEU AAA . n A 1 136 ALA 136 135 135 ALA ALA AAA . n A 1 137 HIS 137 136 136 HIS HIS AAA . n A 1 138 LEU 138 137 137 LEU LEU AAA . n A 1 139 MET 139 138 138 MET MET AAA . n A 1 140 ALA 140 139 139 ALA ALA AAA . n A 1 141 LEU 141 140 140 LEU LEU AAA . n A 1 142 GLY 142 141 141 GLY GLY AAA . n A 1 143 LEU 143 142 142 LEU LEU AAA . n A 1 144 GLY 144 143 143 GLY GLY AAA . n A 1 145 PRO 145 144 144 PRO PRO AAA . n A 1 146 TRP 146 145 145 TRP TRP AAA . n A 1 147 LEU 147 146 146 LEU LEU AAA . n A 1 148 ALA 148 147 147 ALA ALA AAA . n A 1 149 VAL 149 148 148 VAL VAL AAA . n A 1 150 GLU 150 149 149 GLU GLU AAA . n A 1 151 ILE 151 150 150 ILE ILE AAA . n A 1 152 PRO 152 151 151 PRO PRO AAA . n A 1 153 ASP 153 152 152 ASP ASP AAA . n A 1 154 LEU 154 153 153 LEU LEU AAA . n A 1 155 ILE 155 154 154 ILE ILE AAA . n A 1 156 GLN 156 155 155 GLN GLN AAA . n A 1 157 LYS 157 156 156 LYS LYS AAA . n A 1 158 GLY 158 157 157 GLY GLY AAA . n A 1 159 VAL 159 158 158 VAL VAL AAA . n A 1 160 ILE 160 159 159 ILE ILE AAA . n A 1 161 GLN 161 160 160 GLN GLN AAA . n A 1 162 HIS 162 161 161 HIS HIS AAA . n A 1 163 LYS 163 162 162 LYS LYS AAA . n A 1 164 GLU 164 163 163 GLU GLU AAA . n A 1 165 LYS 165 164 ? ? ? AAA . n A 1 166 CYS 166 165 ? ? ? AAA . n A 1 167 ASN 167 166 ? ? ? AAA . n A 1 168 GLN 168 167 ? ? ? AAA . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 201 201 GOL GOL AAA . C 2 GOL 1 202 202 GOL GOL AAA . D 3 HOH 1 401 401 HOH HOH AAA . D 3 HOH 2 402 332 HOH HOH AAA . D 3 HOH 3 403 307 HOH HOH AAA . D 3 HOH 4 404 331 HOH HOH AAA . D 3 HOH 5 405 344 HOH HOH AAA . D 3 HOH 6 406 342 HOH HOH AAA . D 3 HOH 7 407 327 HOH HOH AAA . D 3 HOH 8 408 313 HOH HOH AAA . D 3 HOH 9 409 310 HOH HOH AAA . D 3 HOH 10 410 336 HOH HOH AAA . D 3 HOH 11 411 333 HOH HOH AAA . D 3 HOH 12 412 309 HOH HOH AAA . D 3 HOH 13 413 315 HOH HOH AAA . D 3 HOH 14 414 314 HOH HOH AAA . D 3 HOH 15 415 346 HOH HOH AAA . D 3 HOH 16 416 328 HOH HOH AAA . D 3 HOH 17 417 317 HOH HOH AAA . D 3 HOH 18 418 329 HOH HOH AAA . D 3 HOH 19 419 312 HOH HOH AAA . D 3 HOH 20 420 316 HOH HOH AAA . D 3 HOH 21 421 337 HOH HOH AAA . D 3 HOH 22 422 341 HOH HOH AAA . D 3 HOH 23 423 308 HOH HOH AAA . D 3 HOH 24 424 320 HOH HOH AAA . D 3 HOH 25 425 319 HOH HOH AAA . D 3 HOH 26 426 323 HOH HOH AAA . D 3 HOH 27 427 345 HOH HOH AAA . D 3 HOH 28 428 324 HOH HOH AAA . D 3 HOH 29 429 304 HOH HOH AAA . D 3 HOH 30 430 305 HOH HOH AAA . D 3 HOH 31 431 330 HOH HOH AAA . D 3 HOH 32 432 340 HOH HOH AAA . D 3 HOH 33 433 311 HOH HOH AAA . D 3 HOH 34 434 306 HOH HOH AAA . D 3 HOH 35 435 326 HOH HOH AAA . D 3 HOH 36 436 302 HOH HOH AAA . D 3 HOH 37 437 334 HOH HOH AAA . D 3 HOH 38 438 335 HOH HOH AAA . D 3 HOH 39 439 318 HOH HOH AAA . D 3 HOH 40 440 321 HOH HOH AAA . D 3 HOH 41 441 322 HOH HOH AAA . D 3 HOH 42 442 301 HOH HOH AAA . D 3 HOH 43 443 303 HOH HOH AAA . D 3 HOH 44 444 325 HOH HOH AAA . D 3 HOH 45 445 343 HOH HOH AAA . D 3 HOH 46 446 338 HOH HOH AAA . D 3 HOH 47 447 339 HOH HOH AAA . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 AAA ARG 25 ? NE ? A ARG 26 NE 2 1 Y 1 AAA ARG 25 ? CZ ? A ARG 26 CZ 3 1 Y 1 AAA ARG 25 ? NH1 ? A ARG 26 NH1 4 1 Y 1 AAA ARG 25 ? NH2 ? A ARG 26 NH2 5 1 Y 1 AAA LYS 60 ? NZ ? A LYS 61 NZ 6 1 Y 1 AAA ARG 64 ? NH2 ? A ARG 65 NH2 7 1 Y 1 AAA GLU 101 ? CD ? A GLU 102 CD 8 1 Y 1 AAA GLU 101 ? OE1 ? A GLU 102 OE1 9 1 Y 1 AAA GLU 101 ? OE2 ? A GLU 102 OE2 10 1 Y 1 AAA LYS 108 ? CD ? A LYS 109 CD 11 1 Y 1 AAA LYS 108 ? CE ? A LYS 109 CE 12 1 Y 1 AAA LYS 108 ? NZ ? A LYS 109 NZ 13 1 Y 1 AAA LYS 162 ? CG ? A LYS 163 CG 14 1 Y 1 AAA LYS 162 ? CD ? A LYS 163 CD 15 1 Y 1 AAA LYS 162 ? CE ? A LYS 163 CE 16 1 Y 1 AAA LYS 162 ? NZ ? A LYS 163 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7NVJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 46.161 _cell.length_a_esd ? _cell.length_b 46.161 _cell.length_b_esd ? _cell.length_c 143.755 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7NVJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7NVJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.01 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.95 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M HEPES pH 7.5, 2M Ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 298 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 200K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-02-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type RIGAKU _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 25.44 _reflns.entry_id 7NVJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.2 _reflns.d_resolution_low 33.24 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8491 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.33 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.153 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.2 _reflns_shell.d_res_low 2.279 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 804 _reflns_shell.percent_possible_all 99.14 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.71 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.47 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.088 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] 0.088 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -0.175 _refine.B_iso_max ? _refine.B_iso_mean 26.854 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.951 _refine.correlation_coeff_Fo_to_Fc_free 0.914 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7NVJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.200 _refine.ls_d_res_low 33.24 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8491 _refine.ls_number_reflns_R_free 444 _refine.ls_number_reflns_R_work 8047 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.824 _refine.ls_percent_reflns_R_free 5.229 _refine.ls_R_factor_all 0.196 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2460 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1928 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2Z6P _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.317 _refine.pdbx_overall_ESU_R_Free 0.228 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 8.200 _refine.overall_SU_ML 0.197 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.200 _refine_hist.d_res_low 33.24 _refine_hist.number_atoms_solvent 47 _refine_hist.number_atoms_total 1375 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1316 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.013 1361 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1268 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.468 1.645 1845 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.258 1.578 2939 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.440 5.000 163 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.469 22.394 71 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.763 15.000 228 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 11.327 15.000 9 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.072 0.200 172 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1498 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 285 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.221 0.200 293 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.191 0.200 1206 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.169 0.200 643 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.078 0.200 617 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.219 0.200 32 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.250 0.200 15 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.175 0.200 57 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.213 0.200 8 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 2.239 2.693 655 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.238 2.685 654 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.538 4.024 817 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.536 4.034 818 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.648 2.987 706 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.646 2.988 707 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 4.126 4.330 1028 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.124 4.332 1029 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.385 50.357 5929 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 7.382 50.345 5921 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.200 2.257 591 . 34 551 98.9848 . 0.272 . 0.347 . 0.268 . . . . . 0.251 . 20 . 0.826 0.788 'X-RAY DIFFRACTION' 2.257 2.319 609 . 37 570 99.6716 . 0.274 . 0.327 . 0.270 . . . . . 0.250 . 20 . 0.840 0.794 'X-RAY DIFFRACTION' 2.319 2.386 565 . 23 540 99.6460 . 0.248 . 0.275 . 0.246 . . . . . 0.224 . 20 . 0.859 0.840 'X-RAY DIFFRACTION' 2.386 2.459 566 . 31 534 99.8233 . 0.240 . 0.278 . 0.237 . . . . . 0.213 . 20 . 0.867 0.842 'X-RAY DIFFRACTION' 2.459 2.539 540 . 28 512 100.0000 . 0.231 . 0.332 . 0.226 . . . . . 0.202 . 20 . 0.885 0.833 'X-RAY DIFFRACTION' 2.539 2.628 529 . 20 509 100.0000 . 0.230 . 0.323 . 0.227 . . . . . 0.193 . 20 . 0.894 0.859 'X-RAY DIFFRACTION' 2.628 2.727 527 . 31 496 100.0000 . 0.207 . 0.199 . 0.208 . . . . . 0.179 . 20 . 0.911 0.931 'X-RAY DIFFRACTION' 2.727 2.838 483 . 18 465 100.0000 . 0.199 . 0.254 . 0.196 . . . . . 0.165 . 20 . 0.930 0.898 'X-RAY DIFFRACTION' 2.838 2.963 476 . 22 454 100.0000 . 0.217 . 0.305 . 0.214 . . . . . 0.176 . 20 . 0.920 0.877 'X-RAY DIFFRACTION' 2.963 3.107 466 . 28 438 100.0000 . 0.188 . 0.290 . 0.182 . . . . . 0.155 . 20 . 0.936 0.902 'X-RAY DIFFRACTION' 3.107 3.275 440 . 25 415 100.0000 . 0.187 . 0.268 . 0.183 . . . . . 0.153 . 20 . 0.941 0.886 'X-RAY DIFFRACTION' 3.275 3.472 406 . 24 382 100.0000 . 0.172 . 0.302 . 0.165 . . . . . 0.139 . 20 . 0.954 0.890 'X-RAY DIFFRACTION' 3.472 3.710 388 . 20 367 99.7423 . 0.161 . 0.309 . 0.153 . . . . . 0.136 . 20 . 0.963 0.917 'X-RAY DIFFRACTION' 3.710 4.005 376 . 20 356 100.0000 . 0.147 . 0.177 . 0.145 . . . . . 0.134 . 20 . 0.974 0.964 'X-RAY DIFFRACTION' 4.005 4.384 344 . 24 320 100.0000 . 0.143 . 0.197 . 0.139 . . . . . 0.129 . 20 . 0.975 0.960 'X-RAY DIFFRACTION' 4.384 4.895 321 . 11 310 100.0000 . 0.154 . 0.150 . 0.155 . . . . . 0.138 . 20 . 0.972 0.973 'X-RAY DIFFRACTION' 4.895 5.640 285 . 21 264 100.0000 . 0.193 . 0.165 . 0.196 . . . . . 0.179 . 20 . 0.962 0.963 'X-RAY DIFFRACTION' 5.640 6.880 253 . 14 239 100.0000 . 0.205 . 0.245 . 0.203 . . . . . 0.177 . 20 . 0.954 0.945 'X-RAY DIFFRACTION' 6.880 9.613 201 . 10 191 100.0000 . 0.190 . 0.186 . 0.191 . . . . . 0.178 . 20 . 0.959 0.973 'X-RAY DIFFRACTION' 9.613 43.951 136 . 3 131 98.5294 . 0.220 . 0.227 . 0.219 . . . . . 0.230 . 20 . 0.958 0.983 # _struct.entry_id 7NVJ _struct.title 'Crystal structure of UFC1 Y110A & F121A' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7NVJ _struct_keywords.text 'Ubiquitin fold conjugating enzyme 1 (UFC1), Ufmylation, Y110A, F121A, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UFC1_HUMAN _struct_ref.pdbx_db_accession Q9Y3C8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEF DIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQ HKEKCNQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7NVJ _struct_ref_seq.pdbx_strand_id AAA _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 168 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y3C8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 167 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 167 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7NVJ GLY AAA 1 ? UNP Q9Y3C8 ? ? 'expression tag' 0 1 1 7NVJ ALA AAA 111 ? UNP Q9Y3C8 TYR 110 'engineered mutation' 110 2 1 7NVJ ALA AAA 122 ? UNP Q9Y3C8 PHE 121 'engineered mutation' 121 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 480 ? 1 MORE -0 ? 1 'SSA (A^2)' 9610 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 1 ? SER A 12 ? GLY AAA 0 SER AAA 11 1 ? 12 HELX_P HELX_P2 AA2 ARG A 26 ? ALA A 50 ? ARG AAA 25 ALA AAA 49 1 ? 25 HELX_P HELX_P3 AA3 VAL A 100 ? ASP A 104 ? VAL AAA 99 ASP AAA 103 5 ? 5 HELX_P HELX_P4 AA4 HIS A 121 ? VAL A 130 ? HIS AAA 120 VAL AAA 129 1 ? 10 HELX_P HELX_P5 AA5 GLY A 134 ? GLY A 142 ? GLY AAA 133 GLY AAA 141 1 ? 9 HELX_P HELX_P6 AA6 GLY A 142 ? LYS A 157 ? GLY AAA 141 LYS AAA 156 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 91 A . ? TYR 90 AAA PRO 92 A ? PRO 91 AAA 1 1.35 2 VAL 130 A . ? VAL 129 AAA PRO 131 A ? PRO 130 AAA 1 -1.31 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 55 ? SER A 59 ? PHE AAA 54 SER AAA 58 AA1 2 ARG A 65 ? HIS A 74 ? ARG AAA 64 HIS AAA 73 AA1 3 LEU A 77 ? ASP A 86 ? LEU AAA 76 ASP AAA 85 AA2 1 MET A 110 ? ALA A 111 ? MET AAA 109 ALA AAA 110 AA2 2 LYS A 115 ? ILE A 116 ? LYS AAA 114 ILE AAA 115 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 56 ? N ARG AAA 55 O LYS A 69 ? O LYS AAA 68 AA1 2 3 N TYR A 72 ? N TYR AAA 71 O TYR A 79 ? O TYR AAA 78 AA2 1 2 N ALA A 111 ? N ALA AAA 110 O LYS A 115 ? O LYS AAA 114 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OH _pdbx_validate_close_contact.auth_asym_id_1 AAA _pdbx_validate_close_contact.auth_comp_id_1 TYR _pdbx_validate_close_contact.auth_seq_id_1 42 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O1 _pdbx_validate_close_contact.auth_asym_id_2 AAA _pdbx_validate_close_contact.auth_comp_id_2 GOL _pdbx_validate_close_contact.auth_seq_id_2 202 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG AAA 25 ? ? 56.87 -123.89 2 1 VAL AAA 99 ? ? -112.38 79.15 3 1 MET AAA 109 ? ? -174.51 132.77 # _pdbx_entry_details.entry_id 7NVJ _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AAA LYS 164 ? A LYS 165 2 1 Y 1 AAA CYS 165 ? A CYS 166 3 1 Y 1 AAA ASN 166 ? A ASN 167 4 1 Y 1 AAA GLN 167 ? A GLN 168 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MET N N N N 244 MET CA C N S 245 MET C C N N 246 MET O O N N 247 MET CB C N N 248 MET CG C N N 249 MET SD S N N 250 MET CE C N N 251 MET OXT O N N 252 MET H H N N 253 MET H2 H N N 254 MET HA H N N 255 MET HB2 H N N 256 MET HB3 H N N 257 MET HG2 H N N 258 MET HG3 H N N 259 MET HE1 H N N 260 MET HE2 H N N 261 MET HE3 H N N 262 MET HXT H N N 263 PHE N N N N 264 PHE CA C N S 265 PHE C C N N 266 PHE O O N N 267 PHE CB C N N 268 PHE CG C Y N 269 PHE CD1 C Y N 270 PHE CD2 C Y N 271 PHE CE1 C Y N 272 PHE CE2 C Y N 273 PHE CZ C Y N 274 PHE OXT O N N 275 PHE H H N N 276 PHE H2 H N N 277 PHE HA H N N 278 PHE HB2 H N N 279 PHE HB3 H N N 280 PHE HD1 H N N 281 PHE HD2 H N N 282 PHE HE1 H N N 283 PHE HE2 H N N 284 PHE HZ H N N 285 PHE HXT H N N 286 PRO N N N N 287 PRO CA C N S 288 PRO C C N N 289 PRO O O N N 290 PRO CB C N N 291 PRO CG C N N 292 PRO CD C N N 293 PRO OXT O N N 294 PRO H H N N 295 PRO HA H N N 296 PRO HB2 H N N 297 PRO HB3 H N N 298 PRO HG2 H N N 299 PRO HG3 H N N 300 PRO HD2 H N N 301 PRO HD3 H N N 302 PRO HXT H N N 303 SER N N N N 304 SER CA C N S 305 SER C C N N 306 SER O O N N 307 SER CB C N N 308 SER OG O N N 309 SER OXT O N N 310 SER H H N N 311 SER H2 H N N 312 SER HA H N N 313 SER HB2 H N N 314 SER HB3 H N N 315 SER HG H N N 316 SER HXT H N N 317 THR N N N N 318 THR CA C N S 319 THR C C N N 320 THR O O N N 321 THR CB C N R 322 THR OG1 O N N 323 THR CG2 C N N 324 THR OXT O N N 325 THR H H N N 326 THR H2 H N N 327 THR HA H N N 328 THR HB H N N 329 THR HG1 H N N 330 THR HG21 H N N 331 THR HG22 H N N 332 THR HG23 H N N 333 THR HXT H N N 334 TRP N N N N 335 TRP CA C N S 336 TRP C C N N 337 TRP O O N N 338 TRP CB C N N 339 TRP CG C Y N 340 TRP CD1 C Y N 341 TRP CD2 C Y N 342 TRP NE1 N Y N 343 TRP CE2 C Y N 344 TRP CE3 C Y N 345 TRP CZ2 C Y N 346 TRP CZ3 C Y N 347 TRP CH2 C Y N 348 TRP OXT O N N 349 TRP H H N N 350 TRP H2 H N N 351 TRP HA H N N 352 TRP HB2 H N N 353 TRP HB3 H N N 354 TRP HD1 H N N 355 TRP HE1 H N N 356 TRP HE3 H N N 357 TRP HZ2 H N N 358 TRP HZ3 H N N 359 TRP HH2 H N N 360 TRP HXT H N N 361 TYR N N N N 362 TYR CA C N S 363 TYR C C N N 364 TYR O O N N 365 TYR CB C N N 366 TYR CG C Y N 367 TYR CD1 C Y N 368 TYR CD2 C Y N 369 TYR CE1 C Y N 370 TYR CE2 C Y N 371 TYR CZ C Y N 372 TYR OH O N N 373 TYR OXT O N N 374 TYR H H N N 375 TYR H2 H N N 376 TYR HA H N N 377 TYR HB2 H N N 378 TYR HB3 H N N 379 TYR HD1 H N N 380 TYR HD2 H N N 381 TYR HE1 H N N 382 TYR HE2 H N N 383 TYR HH H N N 384 TYR HXT H N N 385 VAL N N N N 386 VAL CA C N S 387 VAL C C N N 388 VAL O O N N 389 VAL CB C N N 390 VAL CG1 C N N 391 VAL CG2 C N N 392 VAL OXT O N N 393 VAL H H N N 394 VAL H2 H N N 395 VAL HA H N N 396 VAL HB H N N 397 VAL HG11 H N N 398 VAL HG12 H N N 399 VAL HG13 H N N 400 VAL HG21 H N N 401 VAL HG22 H N N 402 VAL HG23 H N N 403 VAL HXT H N N 404 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 PHE N CA sing N N 250 PHE N H sing N N 251 PHE N H2 sing N N 252 PHE CA C sing N N 253 PHE CA CB sing N N 254 PHE CA HA sing N N 255 PHE C O doub N N 256 PHE C OXT sing N N 257 PHE CB CG sing N N 258 PHE CB HB2 sing N N 259 PHE CB HB3 sing N N 260 PHE CG CD1 doub Y N 261 PHE CG CD2 sing Y N 262 PHE CD1 CE1 sing Y N 263 PHE CD1 HD1 sing N N 264 PHE CD2 CE2 doub Y N 265 PHE CD2 HD2 sing N N 266 PHE CE1 CZ doub Y N 267 PHE CE1 HE1 sing N N 268 PHE CE2 CZ sing Y N 269 PHE CE2 HE2 sing N N 270 PHE CZ HZ sing N N 271 PHE OXT HXT sing N N 272 PRO N CA sing N N 273 PRO N CD sing N N 274 PRO N H sing N N 275 PRO CA C sing N N 276 PRO CA CB sing N N 277 PRO CA HA sing N N 278 PRO C O doub N N 279 PRO C OXT sing N N 280 PRO CB CG sing N N 281 PRO CB HB2 sing N N 282 PRO CB HB3 sing N N 283 PRO CG CD sing N N 284 PRO CG HG2 sing N N 285 PRO CG HG3 sing N N 286 PRO CD HD2 sing N N 287 PRO CD HD3 sing N N 288 PRO OXT HXT sing N N 289 SER N CA sing N N 290 SER N H sing N N 291 SER N H2 sing N N 292 SER CA C sing N N 293 SER CA CB sing N N 294 SER CA HA sing N N 295 SER C O doub N N 296 SER C OXT sing N N 297 SER CB OG sing N N 298 SER CB HB2 sing N N 299 SER CB HB3 sing N N 300 SER OG HG sing N N 301 SER OXT HXT sing N N 302 THR N CA sing N N 303 THR N H sing N N 304 THR N H2 sing N N 305 THR CA C sing N N 306 THR CA CB sing N N 307 THR CA HA sing N N 308 THR C O doub N N 309 THR C OXT sing N N 310 THR CB OG1 sing N N 311 THR CB CG2 sing N N 312 THR CB HB sing N N 313 THR OG1 HG1 sing N N 314 THR CG2 HG21 sing N N 315 THR CG2 HG22 sing N N 316 THR CG2 HG23 sing N N 317 THR OXT HXT sing N N 318 TRP N CA sing N N 319 TRP N H sing N N 320 TRP N H2 sing N N 321 TRP CA C sing N N 322 TRP CA CB sing N N 323 TRP CA HA sing N N 324 TRP C O doub N N 325 TRP C OXT sing N N 326 TRP CB CG sing N N 327 TRP CB HB2 sing N N 328 TRP CB HB3 sing N N 329 TRP CG CD1 doub Y N 330 TRP CG CD2 sing Y N 331 TRP CD1 NE1 sing Y N 332 TRP CD1 HD1 sing N N 333 TRP CD2 CE2 doub Y N 334 TRP CD2 CE3 sing Y N 335 TRP NE1 CE2 sing Y N 336 TRP NE1 HE1 sing N N 337 TRP CE2 CZ2 sing Y N 338 TRP CE3 CZ3 doub Y N 339 TRP CE3 HE3 sing N N 340 TRP CZ2 CH2 doub Y N 341 TRP CZ2 HZ2 sing N N 342 TRP CZ3 CH2 sing Y N 343 TRP CZ3 HZ3 sing N N 344 TRP CH2 HH2 sing N N 345 TRP OXT HXT sing N N 346 TYR N CA sing N N 347 TYR N H sing N N 348 TYR N H2 sing N N 349 TYR CA C sing N N 350 TYR CA CB sing N N 351 TYR CA HA sing N N 352 TYR C O doub N N 353 TYR C OXT sing N N 354 TYR CB CG sing N N 355 TYR CB HB2 sing N N 356 TYR CB HB3 sing N N 357 TYR CG CD1 doub Y N 358 TYR CG CD2 sing Y N 359 TYR CD1 CE1 sing Y N 360 TYR CD1 HD1 sing N N 361 TYR CD2 CE2 doub Y N 362 TYR CD2 HD2 sing N N 363 TYR CE1 CZ doub Y N 364 TYR CE1 HE1 sing N N 365 TYR CE2 CZ sing Y N 366 TYR CE2 HE2 sing N N 367 TYR CZ OH sing N N 368 TYR OH HH sing N N 369 TYR OXT HXT sing N N 370 VAL N CA sing N N 371 VAL N H sing N N 372 VAL N H2 sing N N 373 VAL CA C sing N N 374 VAL CA CB sing N N 375 VAL CA HA sing N N 376 VAL C O doub N N 377 VAL C OXT sing N N 378 VAL CB CG1 sing N N 379 VAL CB CG2 sing N N 380 VAL CB HB sing N N 381 VAL CG1 HG11 sing N N 382 VAL CG1 HG12 sing N N 383 VAL CG1 HG13 sing N N 384 VAL CG2 HG21 sing N N 385 VAL CG2 HG22 sing N N 386 VAL CG2 HG23 sing N N 387 VAL OXT HXT sing N N 388 # _pdbx_audit_support.funding_organization 'Israel Science Foundation' _pdbx_audit_support.country Israel _pdbx_audit_support.grant_number 1383/17 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2Z6P _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7NVJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.021663 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021663 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006956 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 0.867 # loop_