data_7NY0 # _entry.id 7NY0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.358 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7NY0 pdb_00007ny0 10.2210/pdb7ny0/pdb WWPDB D_1292114738 ? ? BMRB 34613 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of Boskar4; a de novo designed G-CSF agonist' _pdbx_database_related.db_id 34613 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7NY0 _pdbx_database_status.recvd_initial_deposition_date 2021-03-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'ElGamacy, M.' 1 0000-0002-3446-8774 'Coles, M.' 2 0000-0001-6716-6150 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? UK ? ? primary 'Nat Commun' ? ? 2041-1723 ? ? 13 ? 2948 2948 'A topological refactoring design strategy yields highly stable granulopoietic proteins.' 2022 ? 10.1038/s41467-022-30157-2 35618709 ? ? ? ? ? ? ? ? ? UK ? ? 1 Structure STRUE6 2005 0969-2126 ? ? 27 ? 853 865 'Mapping Local Conformational Landscapes of Proteins in Solution' 2019 ? 10.1016/j.str.2019.03.005 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Skokowa, J.' 1 0000-0002-4399-2324 primary 'Hernandez Alvarez, B.' 2 0000-0003-0635-8698 primary 'Coles, M.' 3 0000-0001-6716-6150 primary 'Ritter, M.' 4 ? primary 'Nasri, M.' 5 ? primary 'Haaf, J.' 6 ? primary 'Aghaallaei, N.' 7 ? primary 'Xu, Y.' 8 ? primary 'Mir, P.' 9 ? primary 'Krahl, A.C.' 10 ? primary 'Rogers, K.W.' 11 0000-0001-5700-2662 primary 'Maksymenko, K.' 12 ? primary 'Bajoghli, B.' 13 0000-0002-7368-7523 primary 'Welte, K.' 14 ? primary 'Lupas, A.N.' 15 0000-0002-1959-4836 primary 'Muller, P.' 16 0000-0002-0702-6209 primary 'ElGamacy, M.' 17 0000-0002-3446-8774 1 'ElGamacy, M.' 18 ? 1 'Riss, M.' 19 ? 1 'Zhu, H.' 20 ? 1 'Truffaut, V.' 21 ? 1 'Coles, M.' 22 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Boskar4 _entity.formula_weight 13014.956 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;LAAALAEIYKGLAEYQARLKSLEGISPELGPALDALRLDMADFATTMAQAMEEGLDSLPQSFLLKALEQIRKIQADAAAL REKLAATYKGNDRAAAAVEIAAQLEAFLEKAYQILRHLAAA ; _entity_poly.pdbx_seq_one_letter_code_can ;LAAALAEIYKGLAEYQARLKSLEGISPELGPALDALRLDMADFATTMAQAMEEGLDSLPQSFLLKALEQIRKIQADAAAL REKLAATYKGNDRAAAAVEIAAQLEAFLEKAYQILRHLAAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 ALA n 1 3 ALA n 1 4 ALA n 1 5 LEU n 1 6 ALA n 1 7 GLU n 1 8 ILE n 1 9 TYR n 1 10 LYS n 1 11 GLY n 1 12 LEU n 1 13 ALA n 1 14 GLU n 1 15 TYR n 1 16 GLN n 1 17 ALA n 1 18 ARG n 1 19 LEU n 1 20 LYS n 1 21 SER n 1 22 LEU n 1 23 GLU n 1 24 GLY n 1 25 ILE n 1 26 SER n 1 27 PRO n 1 28 GLU n 1 29 LEU n 1 30 GLY n 1 31 PRO n 1 32 ALA n 1 33 LEU n 1 34 ASP n 1 35 ALA n 1 36 LEU n 1 37 ARG n 1 38 LEU n 1 39 ASP n 1 40 MET n 1 41 ALA n 1 42 ASP n 1 43 PHE n 1 44 ALA n 1 45 THR n 1 46 THR n 1 47 MET n 1 48 ALA n 1 49 GLN n 1 50 ALA n 1 51 MET n 1 52 GLU n 1 53 GLU n 1 54 GLY n 1 55 LEU n 1 56 ASP n 1 57 SER n 1 58 LEU n 1 59 PRO n 1 60 GLN n 1 61 SER n 1 62 PHE n 1 63 LEU n 1 64 LEU n 1 65 LYS n 1 66 ALA n 1 67 LEU n 1 68 GLU n 1 69 GLN n 1 70 ILE n 1 71 ARG n 1 72 LYS n 1 73 ILE n 1 74 GLN n 1 75 ALA n 1 76 ASP n 1 77 ALA n 1 78 ALA n 1 79 ALA n 1 80 LEU n 1 81 ARG n 1 82 GLU n 1 83 LYS n 1 84 LEU n 1 85 ALA n 1 86 ALA n 1 87 THR n 1 88 TYR n 1 89 LYS n 1 90 GLY n 1 91 ASN n 1 92 ASP n 1 93 ARG n 1 94 ALA n 1 95 ALA n 1 96 ALA n 1 97 ALA n 1 98 VAL n 1 99 GLU n 1 100 ILE n 1 101 ALA n 1 102 ALA n 1 103 GLN n 1 104 LEU n 1 105 GLU n 1 106 ALA n 1 107 PHE n 1 108 LEU n 1 109 GLU n 1 110 LYS n 1 111 ALA n 1 112 TYR n 1 113 GLN n 1 114 ILE n 1 115 LEU n 1 116 ARG n 1 117 HIS n 1 118 LEU n 1 119 ALA n 1 120 ALA n 1 121 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 121 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7NY0 _struct_ref.pdbx_db_accession 7NY0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7NY0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 121 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7NY0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 121 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 121 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 2 '3D HNCO' 1 isotropic 2 1 2 '3D HNCA' 1 isotropic 3 1 2 '3D C(CCO)NH' 1 isotropic 4 1 2 '3D HNCACB' 1 isotropic 5 1 2 '3D CCH-TOCSY' 1 isotropic 6 1 2 3D-CNH-NOESY 2 isotropic 7 1 2 13C-HSQC-NOESY 2 isotropic 8 1 1 2D-NOESY 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 450 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label general _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '500 uM [U-100% 15N] Boskar4, 150 mM sodium phosphate, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N_sample solution ? 2 '500 uM [U-100% 13C; U-100% 15N] Boskar4, 150 mM sodium phosphate, 95% H2O/5% D2O' '95% H2O/5% D2O' 13C,15N_sample solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 800 ? # _pdbx_nmr_refine.entry_id 7NY0 _pdbx_nmr_refine.method na _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 7NY0 _pdbx_nmr_ensemble.conformers_calculated_total_number 10800 _pdbx_nmr_ensemble.conformers_submitted_total_number 17 _pdbx_nmr_ensemble.conformer_selection_criteria 'back calculated data agree with experimental NOESY spectrum' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7NY0 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 3 'chemical shift assignment' Sparky ? Goddard 2 'structure calculation' CoMAND ? 'ElGamacy, Riss, Zhu, Truffault, Murray, Coles' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7NY0 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7NY0 _struct.title 'Solution structure of Boskar4; a de novo designed G-CSF agonist' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7NY0 _struct_keywords.text 'Protein design, G-CSF agonist, four-helix bundle, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 1 ? LEU A 22 ? LEU A 1 LEU A 22 1 ? 22 HELX_P HELX_P2 AA2 SER A 26 ? GLU A 28 ? SER A 26 GLU A 28 5 ? 3 HELX_P HELX_P3 AA3 LEU A 29 ? GLY A 54 ? LEU A 29 GLY A 54 1 ? 26 HELX_P HELX_P4 AA4 PRO A 59 ? TYR A 88 ? PRO A 59 TYR A 88 1 ? 30 HELX_P HELX_P5 AA5 ASN A 91 ? ALA A 120 ? ASN A 91 ALA A 120 1 ? 30 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 7NY0 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ALA 121 121 121 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-10-06 2 'Structure model' 1 1 2022-06-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Boskar4 500 ? uM '[U-100% 15N]' 1 'sodium phosphate' 150 ? mM 'natural abundance' 2 Boskar4 500 ? uM '[U-100% 13C; U-100% 15N]' 2 'sodium phosphate' 150 ? mM 'natural abundance' # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 2 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 37 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 37 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 37 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 123.68 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation 3.38 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 29 ? ? -88.07 36.74 2 2 ALA A 2 ? ? 68.68 -69.18 3 2 GLU A 23 ? ? -66.11 0.45 4 2 ALA A 32 ? ? -63.07 -71.87 5 3 ASP A 56 ? ? -94.11 -63.61 6 4 ALA A 2 ? ? -146.65 -47.46 7 5 GLU A 23 ? ? -71.14 20.00 8 5 LEU A 29 ? ? -88.45 38.90 9 6 ALA A 2 ? ? -145.94 -47.17 10 7 GLU A 23 ? ? -66.93 5.55 11 7 LEU A 29 ? ? -89.12 44.48 12 8 ALA A 2 ? ? -153.40 -46.58 13 8 GLU A 23 ? ? -66.91 7.60 14 8 LEU A 29 ? ? -89.45 42.03 15 9 SER A 26 ? ? 59.93 73.84 16 10 ALA A 2 ? ? -156.52 42.67 17 10 ILE A 25 ? ? -94.49 -67.12 18 11 GLU A 23 ? ? -139.17 -74.51 19 12 GLU A 23 ? ? -66.68 3.60 20 12 ASP A 56 ? ? -94.19 -63.53 21 13 GLU A 23 ? ? -78.74 20.24 22 14 SER A 26 ? ? 56.94 73.74 23 15 SER A 26 ? ? 59.11 73.62 24 15 LEU A 29 ? ? -90.01 47.83 25 16 ALA A 2 ? ? -152.83 -46.70 26 16 GLU A 23 ? ? -68.72 9.94 27 16 LEU A 29 ? ? -88.09 44.27 28 17 ILE A 25 ? ? -94.40 -68.78 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #