data_7O1E # _entry.id 7O1E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7O1E pdb_00007o1e 10.2210/pdb7o1e/pdb WWPDB D_1292114927 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-04-13 2 'Structure model' 1 1 2022-10-05 3 'Structure model' 1 2 2023-01-11 4 'Structure model' 1 3 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 2 'Structure model' '_citation_author.identifier_ORCID' 10 2 'Structure model' '_citation_author.name' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.page_first' 13 3 'Structure model' '_citation.page_last' 14 3 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7O1E _pdbx_database_status.recvd_initial_deposition_date 2021-03-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Alphey, M.A.' 1 0000-0002-9353-3716 'MacNeill, S.' 2 0000-0002-0555-0007 'Yang, D.' 3 0000-0002-6207-8482 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Febs J.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1742-464X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 290 _citation.language ? _citation.page_first 162 _citation.page_last 175 _citation.title ;Non-canonical binding of the Chaetomium thermophilum PolD4 N-terminal PIP motif to PCNA involves Q-pocket and compact 2-fork plug interactions but no 3 10 helix. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/febs.16590 _citation.pdbx_database_id_PubMed 35942639 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yang, D.' 1 ? primary 'Alphey, M.S.' 2 ? primary 'MacNeill, S.A.' 3 0000-0002-0555-0007 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Proliferating cell nuclear antigen' 28756.596 1 ? ? ? 'The first 3 residues are a linker to the cleaved His-Tag. Flexible loops and sidechains have been omitted or truncated' 2 water nat water 18.015 42 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AMALEARLEQASILKKVVDAIKDLVQDCNFDCNDSGIALQAMDNSHVALVSMMLKAEGFSPYRCDRNIALGVNLTSLTKV LRAAQNEDILTLKAEDAPDVLNLVFESSETDRISEYDLKLMDIDQEHLGIPETEYAATITMPSNEFKRITTDLMAMSESV TIEANKDGVKFSCQGDIGNGSVTLRQHTNVEKPNESIEIELSEPVSLTFSLKYLVNFCKASALSNTVKICLSNEVPLLVE YSLGGSSYLRFYLAPKIGDDE ; _entity_poly.pdbx_seq_one_letter_code_can ;AMALEARLEQASILKKVVDAIKDLVQDCNFDCNDSGIALQAMDNSHVALVSMMLKAEGFSPYRCDRNIALGVNLTSLTKV LRAAQNEDILTLKAEDAPDVLNLVFESSETDRISEYDLKLMDIDQEHLGIPETEYAATITMPSNEFKRITTDLMAMSESV TIEANKDGVKFSCQGDIGNGSVTLRQHTNVEKPNESIEIELSEPVSLTFSLKYLVNFCKASALSNTVKICLSNEVPLLVE YSLGGSSYLRFYLAPKIGDDE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 MET n 1 3 ALA n 1 4 LEU n 1 5 GLU n 1 6 ALA n 1 7 ARG n 1 8 LEU n 1 9 GLU n 1 10 GLN n 1 11 ALA n 1 12 SER n 1 13 ILE n 1 14 LEU n 1 15 LYS n 1 16 LYS n 1 17 VAL n 1 18 VAL n 1 19 ASP n 1 20 ALA n 1 21 ILE n 1 22 LYS n 1 23 ASP n 1 24 LEU n 1 25 VAL n 1 26 GLN n 1 27 ASP n 1 28 CYS n 1 29 ASN n 1 30 PHE n 1 31 ASP n 1 32 CYS n 1 33 ASN n 1 34 ASP n 1 35 SER n 1 36 GLY n 1 37 ILE n 1 38 ALA n 1 39 LEU n 1 40 GLN n 1 41 ALA n 1 42 MET n 1 43 ASP n 1 44 ASN n 1 45 SER n 1 46 HIS n 1 47 VAL n 1 48 ALA n 1 49 LEU n 1 50 VAL n 1 51 SER n 1 52 MET n 1 53 MET n 1 54 LEU n 1 55 LYS n 1 56 ALA n 1 57 GLU n 1 58 GLY n 1 59 PHE n 1 60 SER n 1 61 PRO n 1 62 TYR n 1 63 ARG n 1 64 CYS n 1 65 ASP n 1 66 ARG n 1 67 ASN n 1 68 ILE n 1 69 ALA n 1 70 LEU n 1 71 GLY n 1 72 VAL n 1 73 ASN n 1 74 LEU n 1 75 THR n 1 76 SER n 1 77 LEU n 1 78 THR n 1 79 LYS n 1 80 VAL n 1 81 LEU n 1 82 ARG n 1 83 ALA n 1 84 ALA n 1 85 GLN n 1 86 ASN n 1 87 GLU n 1 88 ASP n 1 89 ILE n 1 90 LEU n 1 91 THR n 1 92 LEU n 1 93 LYS n 1 94 ALA n 1 95 GLU n 1 96 ASP n 1 97 ALA n 1 98 PRO n 1 99 ASP n 1 100 VAL n 1 101 LEU n 1 102 ASN n 1 103 LEU n 1 104 VAL n 1 105 PHE n 1 106 GLU n 1 107 SER n 1 108 SER n 1 109 GLU n 1 110 THR n 1 111 ASP n 1 112 ARG n 1 113 ILE n 1 114 SER n 1 115 GLU n 1 116 TYR n 1 117 ASP n 1 118 LEU n 1 119 LYS n 1 120 LEU n 1 121 MET n 1 122 ASP n 1 123 ILE n 1 124 ASP n 1 125 GLN n 1 126 GLU n 1 127 HIS n 1 128 LEU n 1 129 GLY n 1 130 ILE n 1 131 PRO n 1 132 GLU n 1 133 THR n 1 134 GLU n 1 135 TYR n 1 136 ALA n 1 137 ALA n 1 138 THR n 1 139 ILE n 1 140 THR n 1 141 MET n 1 142 PRO n 1 143 SER n 1 144 ASN n 1 145 GLU n 1 146 PHE n 1 147 LYS n 1 148 ARG n 1 149 ILE n 1 150 THR n 1 151 THR n 1 152 ASP n 1 153 LEU n 1 154 MET n 1 155 ALA n 1 156 MET n 1 157 SER n 1 158 GLU n 1 159 SER n 1 160 VAL n 1 161 THR n 1 162 ILE n 1 163 GLU n 1 164 ALA n 1 165 ASN n 1 166 LYS n 1 167 ASP n 1 168 GLY n 1 169 VAL n 1 170 LYS n 1 171 PHE n 1 172 SER n 1 173 CYS n 1 174 GLN n 1 175 GLY n 1 176 ASP n 1 177 ILE n 1 178 GLY n 1 179 ASN n 1 180 GLY n 1 181 SER n 1 182 VAL n 1 183 THR n 1 184 LEU n 1 185 ARG n 1 186 GLN n 1 187 HIS n 1 188 THR n 1 189 ASN n 1 190 VAL n 1 191 GLU n 1 192 LYS n 1 193 PRO n 1 194 ASN n 1 195 GLU n 1 196 SER n 1 197 ILE n 1 198 GLU n 1 199 ILE n 1 200 GLU n 1 201 LEU n 1 202 SER n 1 203 GLU n 1 204 PRO n 1 205 VAL n 1 206 SER n 1 207 LEU n 1 208 THR n 1 209 PHE n 1 210 SER n 1 211 LEU n 1 212 LYS n 1 213 TYR n 1 214 LEU n 1 215 VAL n 1 216 ASN n 1 217 PHE n 1 218 CYS n 1 219 LYS n 1 220 ALA n 1 221 SER n 1 222 ALA n 1 223 LEU n 1 224 SER n 1 225 ASN n 1 226 THR n 1 227 VAL n 1 228 LYS n 1 229 ILE n 1 230 CYS n 1 231 LEU n 1 232 SER n 1 233 ASN n 1 234 GLU n 1 235 VAL n 1 236 PRO n 1 237 LEU n 1 238 LEU n 1 239 VAL n 1 240 GLU n 1 241 TYR n 1 242 SER n 1 243 LEU n 1 244 GLY n 1 245 GLY n 1 246 SER n 1 247 SER n 1 248 TYR n 1 249 LEU n 1 250 ARG n 1 251 PHE n 1 252 TYR n 1 253 LEU n 1 254 ALA n 1 255 PRO n 1 256 LYS n 1 257 ILE n 1 258 GLY n 1 259 ASP n 1 260 ASP n 1 261 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 261 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CTHT_0061010 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 1495 / CBS 144.50 / IMI 039719' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 759272 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 -1 ? ? ? A . n A 1 2 MET 2 0 ? ? ? A . n A 1 3 ALA 3 1 1 ALA ALA A . n A 1 4 LEU 4 2 2 LEU LEU A . n A 1 5 GLU 5 3 3 GLU GLU A . n A 1 6 ALA 6 4 4 ALA ALA A . n A 1 7 ARG 7 5 5 ARG ARG A . n A 1 8 LEU 8 6 6 LEU LEU A . n A 1 9 GLU 9 7 7 GLU GLU A . n A 1 10 GLN 10 8 8 GLN GLN A . n A 1 11 ALA 11 9 9 ALA ALA A . n A 1 12 SER 12 10 10 SER SER A . n A 1 13 ILE 13 11 11 ILE ILE A . n A 1 14 LEU 14 12 12 LEU LEU A . n A 1 15 LYS 15 13 13 LYS LYS A . n A 1 16 LYS 16 14 14 LYS LYS A . n A 1 17 VAL 17 15 15 VAL VAL A . n A 1 18 VAL 18 16 16 VAL VAL A . n A 1 19 ASP 19 17 17 ASP ASP A . n A 1 20 ALA 20 18 18 ALA ALA A . n A 1 21 ILE 21 19 19 ILE ILE A . n A 1 22 LYS 22 20 20 LYS LYS A . n A 1 23 ASP 23 21 21 ASP ASP A . n A 1 24 LEU 24 22 22 LEU LEU A . n A 1 25 VAL 25 23 23 VAL VAL A . n A 1 26 GLN 26 24 24 GLN GLN A . n A 1 27 ASP 27 25 25 ASP ASP A . n A 1 28 CYS 28 26 26 CYS CYS A . n A 1 29 ASN 29 27 27 ASN ASN A . n A 1 30 PHE 30 28 28 PHE PHE A . n A 1 31 ASP 31 29 29 ASP ASP A . n A 1 32 CYS 32 30 30 CYS CYS A . n A 1 33 ASN 33 31 31 ASN ASN A . n A 1 34 ASP 34 32 32 ASP ASP A . n A 1 35 SER 35 33 33 SER SER A . n A 1 36 GLY 36 34 34 GLY GLY A . n A 1 37 ILE 37 35 35 ILE ILE A . n A 1 38 ALA 38 36 36 ALA ALA A . n A 1 39 LEU 39 37 37 LEU LEU A . n A 1 40 GLN 40 38 38 GLN GLN A . n A 1 41 ALA 41 39 39 ALA ALA A . n A 1 42 MET 42 40 40 MET MET A . n A 1 43 ASP 43 41 41 ASP ASP A . n A 1 44 ASN 44 42 42 ASN ASN A . n A 1 45 SER 45 43 43 SER SER A . n A 1 46 HIS 46 44 44 HIS HIS A . n A 1 47 VAL 47 45 45 VAL VAL A . n A 1 48 ALA 48 46 46 ALA ALA A . n A 1 49 LEU 49 47 47 LEU LEU A . n A 1 50 VAL 50 48 48 VAL VAL A . n A 1 51 SER 51 49 49 SER SER A . n A 1 52 MET 52 50 50 MET MET A . n A 1 53 MET 53 51 51 MET MET A . n A 1 54 LEU 54 52 52 LEU LEU A . n A 1 55 LYS 55 53 53 LYS LYS A . n A 1 56 ALA 56 54 54 ALA ALA A . n A 1 57 GLU 57 55 55 GLU GLU A . n A 1 58 GLY 58 56 56 GLY GLY A . n A 1 59 PHE 59 57 57 PHE PHE A . n A 1 60 SER 60 58 58 SER SER A . n A 1 61 PRO 61 59 59 PRO PRO A . n A 1 62 TYR 62 60 60 TYR TYR A . n A 1 63 ARG 63 61 61 ARG ARG A . n A 1 64 CYS 64 62 62 CYS CYS A . n A 1 65 ASP 65 63 63 ASP ASP A . n A 1 66 ARG 66 64 64 ARG ARG A . n A 1 67 ASN 67 65 65 ASN ASN A . n A 1 68 ILE 68 66 66 ILE ILE A . n A 1 69 ALA 69 67 67 ALA ALA A . n A 1 70 LEU 70 68 68 LEU LEU A . n A 1 71 GLY 71 69 69 GLY GLY A . n A 1 72 VAL 72 70 70 VAL VAL A . n A 1 73 ASN 73 71 71 ASN ASN A . n A 1 74 LEU 74 72 72 LEU LEU A . n A 1 75 THR 75 73 73 THR THR A . n A 1 76 SER 76 74 74 SER SER A . n A 1 77 LEU 77 75 75 LEU LEU A . n A 1 78 THR 78 76 76 THR THR A . n A 1 79 LYS 79 77 77 LYS LYS A . n A 1 80 VAL 80 78 78 VAL VAL A . n A 1 81 LEU 81 79 79 LEU LEU A . n A 1 82 ARG 82 80 80 ARG ARG A . n A 1 83 ALA 83 81 81 ALA ALA A . n A 1 84 ALA 84 82 82 ALA ALA A . n A 1 85 GLN 85 83 83 GLN GLN A . n A 1 86 ASN 86 84 84 ASN ASN A . n A 1 87 GLU 87 85 85 GLU GLU A . n A 1 88 ASP 88 86 86 ASP ASP A . n A 1 89 ILE 89 87 87 ILE ILE A . n A 1 90 LEU 90 88 88 LEU LEU A . n A 1 91 THR 91 89 89 THR THR A . n A 1 92 LEU 92 90 90 LEU LEU A . n A 1 93 LYS 93 91 91 LYS LYS A . n A 1 94 ALA 94 92 92 ALA ALA A . n A 1 95 GLU 95 93 93 GLU GLU A . n A 1 96 ASP 96 94 94 ASP ASP A . n A 1 97 ALA 97 95 95 ALA ALA A . n A 1 98 PRO 98 96 96 PRO PRO A . n A 1 99 ASP 99 97 97 ASP ASP A . n A 1 100 VAL 100 98 98 VAL VAL A . n A 1 101 LEU 101 99 99 LEU LEU A . n A 1 102 ASN 102 100 100 ASN ASN A . n A 1 103 LEU 103 101 101 LEU LEU A . n A 1 104 VAL 104 102 102 VAL VAL A . n A 1 105 PHE 105 103 103 PHE PHE A . n A 1 106 GLU 106 104 104 GLU GLU A . n A 1 107 SER 107 105 105 SER SER A . n A 1 108 SER 108 106 ? ? ? A . n A 1 109 GLU 109 107 ? ? ? A . n A 1 110 THR 110 108 108 THR THR A . n A 1 111 ASP 111 109 109 ASP ASP A . n A 1 112 ARG 112 110 110 ARG ARG A . n A 1 113 ILE 113 111 111 ILE ILE A . n A 1 114 SER 114 112 112 SER SER A . n A 1 115 GLU 115 113 113 GLU GLU A . n A 1 116 TYR 116 114 114 TYR TYR A . n A 1 117 ASP 117 115 115 ASP ASP A . n A 1 118 LEU 118 116 116 LEU LEU A . n A 1 119 LYS 119 117 117 LYS LYS A . n A 1 120 LEU 120 118 118 LEU LEU A . n A 1 121 MET 121 119 119 MET MET A . n A 1 122 ASP 122 120 120 ASP ASP A . n A 1 123 ILE 123 121 121 ILE ILE A . n A 1 124 ASP 124 122 122 ASP ASP A . n A 1 125 GLN 125 123 123 GLN GLN A . n A 1 126 GLU 126 124 ? ? ? A . n A 1 127 HIS 127 125 ? ? ? A . n A 1 128 LEU 128 126 ? ? ? A . n A 1 129 GLY 129 127 ? ? ? A . n A 1 130 ILE 130 128 ? ? ? A . n A 1 131 PRO 131 129 ? ? ? A . n A 1 132 GLU 132 130 ? ? ? A . n A 1 133 THR 133 131 ? ? ? A . n A 1 134 GLU 134 132 ? ? ? A . n A 1 135 TYR 135 133 133 TYR TYR A . n A 1 136 ALA 136 134 134 ALA ALA A . n A 1 137 ALA 137 135 135 ALA ALA A . n A 1 138 THR 138 136 136 THR THR A . n A 1 139 ILE 139 137 137 ILE ILE A . n A 1 140 THR 140 138 138 THR THR A . n A 1 141 MET 141 139 139 MET MET A . n A 1 142 PRO 142 140 140 PRO PRO A . n A 1 143 SER 143 141 141 SER SER A . n A 1 144 ASN 144 142 142 ASN ASN A . n A 1 145 GLU 145 143 143 GLU GLU A . n A 1 146 PHE 146 144 144 PHE PHE A . n A 1 147 LYS 147 145 145 LYS LYS A . n A 1 148 ARG 148 146 146 ARG ARG A . n A 1 149 ILE 149 147 147 ILE ILE A . n A 1 150 THR 150 148 148 THR THR A . n A 1 151 THR 151 149 149 THR THR A . n A 1 152 ASP 152 150 150 ASP ASP A . n A 1 153 LEU 153 151 151 LEU LEU A . n A 1 154 MET 154 152 152 MET MET A . n A 1 155 ALA 155 153 153 ALA ALA A . n A 1 156 MET 156 154 154 MET MET A . n A 1 157 SER 157 155 155 SER SER A . n A 1 158 GLU 158 156 156 GLU GLU A . n A 1 159 SER 159 157 157 SER SER A . n A 1 160 VAL 160 158 158 VAL VAL A . n A 1 161 THR 161 159 159 THR THR A . n A 1 162 ILE 162 160 160 ILE ILE A . n A 1 163 GLU 163 161 161 GLU GLU A . n A 1 164 ALA 164 162 162 ALA ALA A . n A 1 165 ASN 165 163 163 ASN ASN A . n A 1 166 LYS 166 164 164 LYS LYS A . n A 1 167 ASP 167 165 165 ASP ASP A . n A 1 168 GLY 168 166 166 GLY GLY A . n A 1 169 VAL 169 167 167 VAL VAL A . n A 1 170 LYS 170 168 168 LYS LYS A . n A 1 171 PHE 171 169 169 PHE PHE A . n A 1 172 SER 172 170 170 SER SER A . n A 1 173 CYS 173 171 171 CYS CYS A . n A 1 174 GLN 174 172 172 GLN GLN A . n A 1 175 GLY 175 173 173 GLY GLY A . n A 1 176 ASP 176 174 174 ASP ASP A . n A 1 177 ILE 177 175 175 ILE ILE A . n A 1 178 GLY 178 176 176 GLY GLY A . n A 1 179 ASN 179 177 177 ASN ASN A . n A 1 180 GLY 180 178 178 GLY GLY A . n A 1 181 SER 181 179 179 SER SER A . n A 1 182 VAL 182 180 180 VAL VAL A . n A 1 183 THR 183 181 181 THR THR A . n A 1 184 LEU 184 182 182 LEU LEU A . n A 1 185 ARG 185 183 183 ARG ARG A . n A 1 186 GLN 186 184 184 GLN GLN A . n A 1 187 HIS 187 185 185 HIS HIS A . n A 1 188 THR 188 186 186 THR THR A . n A 1 189 ASN 189 187 187 ASN ASN A . n A 1 190 VAL 190 188 188 VAL VAL A . n A 1 191 GLU 191 189 189 GLU GLU A . n A 1 192 LYS 192 190 190 LYS LYS A . n A 1 193 PRO 193 191 191 PRO PRO A . n A 1 194 ASN 194 192 192 ASN ASN A . n A 1 195 GLU 195 193 193 GLU GLU A . n A 1 196 SER 196 194 194 SER SER A . n A 1 197 ILE 197 195 195 ILE ILE A . n A 1 198 GLU 198 196 196 GLU GLU A . n A 1 199 ILE 199 197 197 ILE ILE A . n A 1 200 GLU 200 198 198 GLU GLU A . n A 1 201 LEU 201 199 199 LEU LEU A . n A 1 202 SER 202 200 200 SER SER A . n A 1 203 GLU 203 201 201 GLU GLU A . n A 1 204 PRO 204 202 202 PRO PRO A . n A 1 205 VAL 205 203 203 VAL VAL A . n A 1 206 SER 206 204 204 SER SER A . n A 1 207 LEU 207 205 205 LEU LEU A . n A 1 208 THR 208 206 206 THR THR A . n A 1 209 PHE 209 207 207 PHE PHE A . n A 1 210 SER 210 208 208 SER SER A . n A 1 211 LEU 211 209 209 LEU LEU A . n A 1 212 LYS 212 210 210 LYS LYS A . n A 1 213 TYR 213 211 211 TYR TYR A . n A 1 214 LEU 214 212 212 LEU LEU A . n A 1 215 VAL 215 213 213 VAL VAL A . n A 1 216 ASN 216 214 214 ASN ASN A . n A 1 217 PHE 217 215 215 PHE PHE A . n A 1 218 CYS 218 216 216 CYS CYS A . n A 1 219 LYS 219 217 217 LYS LYS A . n A 1 220 ALA 220 218 218 ALA ALA A . n A 1 221 SER 221 219 219 SER SER A . n A 1 222 ALA 222 220 220 ALA ALA A . n A 1 223 LEU 223 221 221 LEU LEU A . n A 1 224 SER 224 222 222 SER SER A . n A 1 225 ASN 225 223 223 ASN ASN A . n A 1 226 THR 226 224 224 THR THR A . n A 1 227 VAL 227 225 225 VAL VAL A . n A 1 228 LYS 228 226 226 LYS LYS A . n A 1 229 ILE 229 227 227 ILE ILE A . n A 1 230 CYS 230 228 228 CYS CYS A . n A 1 231 LEU 231 229 229 LEU LEU A . n A 1 232 SER 232 230 230 SER SER A . n A 1 233 ASN 233 231 231 ASN ASN A . n A 1 234 GLU 234 232 232 GLU GLU A . n A 1 235 VAL 235 233 233 VAL VAL A . n A 1 236 PRO 236 234 234 PRO PRO A . n A 1 237 LEU 237 235 235 LEU LEU A . n A 1 238 LEU 238 236 236 LEU LEU A . n A 1 239 VAL 239 237 237 VAL VAL A . n A 1 240 GLU 240 238 238 GLU GLU A . n A 1 241 TYR 241 239 239 TYR TYR A . n A 1 242 SER 242 240 240 SER SER A . n A 1 243 LEU 243 241 241 LEU LEU A . n A 1 244 GLY 244 242 242 GLY GLY A . n A 1 245 GLY 245 243 243 GLY GLY A . n A 1 246 SER 246 244 244 SER SER A . n A 1 247 SER 247 245 245 SER SER A . n A 1 248 TYR 248 246 246 TYR TYR A . n A 1 249 LEU 249 247 247 LEU LEU A . n A 1 250 ARG 250 248 248 ARG ARG A . n A 1 251 PHE 251 249 249 PHE PHE A . n A 1 252 TYR 252 250 250 TYR TYR A . n A 1 253 LEU 253 251 251 LEU LEU A . n A 1 254 ALA 254 252 252 ALA ALA A . n A 1 255 PRO 255 253 253 PRO PRO A . n A 1 256 LYS 256 254 254 LYS LYS A . n A 1 257 ILE 257 255 255 ILE ILE A . n A 1 258 GLY 258 256 ? ? ? A . n A 1 259 ASP 259 257 ? ? ? A . n A 1 260 ASP 260 258 ? ? ? A . n A 1 261 GLU 261 259 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 6 HOH HOH A . B 2 HOH 2 302 49 HOH HOH A . B 2 HOH 3 303 47 HOH HOH A . B 2 HOH 4 304 22 HOH HOH A . B 2 HOH 5 305 3 HOH HOH A . B 2 HOH 6 306 55 HOH HOH A . B 2 HOH 7 307 19 HOH HOH A . B 2 HOH 8 308 38 HOH HOH A . B 2 HOH 9 309 26 HOH HOH A . B 2 HOH 10 310 12 HOH HOH A . B 2 HOH 11 311 46 HOH HOH A . B 2 HOH 12 312 48 HOH HOH A . B 2 HOH 13 313 25 HOH HOH A . B 2 HOH 14 314 5 HOH HOH A . B 2 HOH 15 315 32 HOH HOH A . B 2 HOH 16 316 28 HOH HOH A . B 2 HOH 17 317 20 HOH HOH A . B 2 HOH 18 318 2 HOH HOH A . B 2 HOH 19 319 9 HOH HOH A . B 2 HOH 20 320 23 HOH HOH A . B 2 HOH 21 321 56 HOH HOH A . B 2 HOH 22 322 27 HOH HOH A . B 2 HOH 23 323 35 HOH HOH A . B 2 HOH 24 324 1 HOH HOH A . B 2 HOH 25 325 54 HOH HOH A . B 2 HOH 26 326 13 HOH HOH A . B 2 HOH 27 327 41 HOH HOH A . B 2 HOH 28 328 8 HOH HOH A . B 2 HOH 29 329 58 HOH HOH A . B 2 HOH 30 330 53 HOH HOH A . B 2 HOH 31 331 29 HOH HOH A . B 2 HOH 32 332 15 HOH HOH A . B 2 HOH 33 333 4 HOH HOH A . B 2 HOH 34 334 30 HOH HOH A . B 2 HOH 35 335 40 HOH HOH A . B 2 HOH 36 336 21 HOH HOH A . B 2 HOH 37 337 59 HOH HOH A . B 2 HOH 38 338 18 HOH HOH A . B 2 HOH 39 339 16 HOH HOH A . B 2 HOH 40 340 34 HOH HOH A . B 2 HOH 41 341 24 HOH HOH A . B 2 HOH 42 342 44 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 38 ? CG ? A GLN 40 CG 2 1 Y 1 A GLN 38 ? CD ? A GLN 40 CD 3 1 Y 1 A GLN 38 ? OE1 ? A GLN 40 OE1 4 1 Y 1 A GLN 38 ? NE2 ? A GLN 40 NE2 5 1 Y 1 A ARG 64 ? CG ? A ARG 66 CG 6 1 Y 1 A ARG 64 ? CD ? A ARG 66 CD 7 1 Y 1 A ARG 64 ? NE ? A ARG 66 NE 8 1 Y 1 A ARG 64 ? CZ ? A ARG 66 CZ 9 1 Y 1 A ARG 64 ? NH1 ? A ARG 66 NH1 10 1 Y 1 A ARG 64 ? NH2 ? A ARG 66 NH2 11 1 Y 1 A GLU 193 ? CG ? A GLU 195 CG 12 1 Y 1 A GLU 193 ? CD ? A GLU 195 CD 13 1 Y 1 A GLU 193 ? OE1 ? A GLU 195 OE1 14 1 Y 1 A GLU 193 ? OE2 ? A GLU 195 OE2 15 1 Y 1 A GLU 198 ? CG ? A GLU 200 CG 16 1 Y 1 A GLU 198 ? CD ? A GLU 200 CD 17 1 Y 1 A GLU 198 ? OE1 ? A GLU 200 OE1 18 1 Y 1 A GLU 198 ? OE2 ? A GLU 200 OE2 19 1 Y 1 A LYS 217 ? CG ? A LYS 219 CG 20 1 Y 1 A LYS 217 ? CD ? A LYS 219 CD 21 1 Y 1 A LYS 217 ? CE ? A LYS 219 CE 22 1 Y 1 A LYS 217 ? NZ ? A LYS 219 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data reduction' ? ? 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk ? ? ? ? ? http://www.mrc-lmb.cam.ac.uk/harry/mosflm/ ? MOSFLM ? ? package . 2 ? 'data scaling' ? ? 'Phil Evans' ? 13/12/18 ? ? ? ? http://www.mrc-lmb.cam.ac.uk/harry/pre/aimless.html ? Aimless ? ? program 0.7.4 3 ? phasing ? ? 'Alexei Vaguine' alexei@ysbl.york.ac.uk ? ? ? ? Fortran_77 http://www.ccp4.ac.uk/dist/html/molrep.html ? MOLREP ? ? program . 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Oct. 31, 2020' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.27 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7O1E _cell.details ? _cell.formula_units_Z ? _cell.length_a 86.270 _cell.length_a_esd ? _cell.length_b 86.270 _cell.length_b_esd ? _cell.length_c 90.842 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 9 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7O1E _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7O1E _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.26 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.72 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M PTCP pH 5.0, 25% PEG 1500' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU SATURN 944+' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-10-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54178 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54178 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7O1E _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.340 _reflns.d_resolution_low 30.280 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10552 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.200 _reflns.pdbx_Rmerge_I_obs 0.097 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 1 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.108 _reflns.pdbx_Rpim_I_all 0.046 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 54849 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.340 2.420 ? ? 3563 ? ? ? 951 90.700 ? ? ? ? 0.547 ? ? ? ? ? ? ? ? 3.700 ? ? ? 2.000 0.637 0.320 ? 1 1 0.786 ? ? ? ? ? ? ? ? ? ? 9.050 30.280 ? ? 1002 ? ? ? 182 97.600 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 5.500 ? ? ? 20.400 0.055 0.023 ? 2 1 0.998 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 1.3200 _refine.aniso_B[1][2] 0.6600 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 1.3200 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -4.2800 _refine.B_iso_max 95.410 _refine.B_iso_mean 45.2450 _refine.B_iso_min 28.640 _refine.correlation_coeff_Fo_to_Fc 0.9440 _refine.correlation_coeff_Fo_to_Fc_free 0.9170 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : WITH TLS ADDED' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7O1E _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3400 _refine.ls_d_res_low 30.2800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9986 _refine.ls_number_reflns_R_free 544 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.9600 _refine.ls_percent_reflns_R_free 5.2000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2161 _refine.ls_R_factor_R_free 0.2798 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2127 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.2813 _refine.ls_wR_factor_R_work 0.2138 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5TUP _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.4530 _refine.pdbx_overall_ESU_R_Free 0.2920 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 1.1000 _refine.pdbx_solvent_shrinkage_radii 1.1000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 24.2410 _refine.overall_SU_ML 0.2650 _refine.overall_SU_R_Cruickshank_DPI 0.4532 _refine.overall_SU_R_free 0.2916 _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.7268 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.3400 _refine_hist.d_res_low 30.2800 _refine_hist.number_atoms_solvent 42 _refine_hist.number_atoms_total 1899 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 244 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 45.12 _refine_hist.pdbx_number_atoms_protein 1857 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.013 1878 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1778 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.444 1.630 2542 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.184 1.574 4134 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.520 5.000 241 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 38.243 24.643 84 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.683 15.000 339 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 21.718 15.000 7 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.053 0.200 263 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 2072 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 341 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.3400 _refine_ls_shell.d_res_low 2.4000 _refine_ls_shell.number_reflns_all 707 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 30 _refine_ls_shell.number_reflns_R_work 677 _refine_ls_shell.percent_reflns_obs 91.2300 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3820 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2600 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7O1E _struct.title 'Crystal structure of PCNA from Chaetomium thermophilum' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7O1E _struct_keywords.text 'PCNA, DNA clamp, DNA replication, PIP, homotrimer, REPLICATION' _struct_keywords.pdbx_keywords REPLICATION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code G0SF70_CHATD _struct_ref.pdbx_db_accession G0SF70 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LEARLEQASILKKVVDAIKDLVQDCNFDCNDSGIALQAMDNSHVALVSMMLKAEGFSPYRCDRNIALGVNLTSLTKVLRA AQNEDILTLKAEDAPDVLNLVFESSETDRISEYDLKLMDIDQEHLGIPETEYAATITMPSNEFKRITTDLMAMSESVTIE ANKDGVKFSCQGDIGNGSVTLRQHTNVEKPNESIEIELSEPVSLTFSLKYLVNFCKASALSNTVKICLSNEVPLLVEYSL GGSSYLRFYLAPKIGDDD ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7O1E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 261 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession G0SF70 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 259 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 259 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7O1E ALA A 1 ? UNP G0SF70 ? ? 'expression tag' -1 1 1 7O1E MET A 2 ? UNP G0SF70 ? ? 'expression tag' 0 2 1 7O1E ALA A 3 ? UNP G0SF70 ? ? 'expression tag' 1 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 1 2 A,B 1 3 A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -y+1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 86.2700000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 43.1350000000 -0.8660254038 -0.5000000000 0.0000000000 74.7120115845 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 11 ? LYS A 22 ? ALA A 9 LYS A 20 1 ? 12 HELX_P HELX_P2 AA2 GLU A 57 ? PHE A 59 ? GLU A 55 PHE A 57 5 ? 3 HELX_P HELX_P3 AA3 LEU A 74 ? ARG A 82 ? LEU A 72 ARG A 80 1 ? 9 HELX_P HELX_P4 AA4 SER A 143 ? ALA A 155 ? SER A 141 ALA A 153 1 ? 13 HELX_P HELX_P5 AA5 LYS A 192 ? SER A 196 ? LYS A 190 SER A 194 5 ? 5 HELX_P HELX_P6 AA6 LEU A 211 ? CYS A 218 ? LEU A 209 CYS A 216 1 ? 8 HELX_P HELX_P7 AA7 LYS A 219 ? LEU A 223 ? LYS A 217 LEU A 221 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 60 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 58 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 61 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 59 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.81 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 9 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA2 8 9 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 62 ? CYS A 64 ? TYR A 60 CYS A 62 AA1 2 LEU A 4 ? LEU A 8 ? LEU A 2 LEU A 6 AA1 3 ILE A 89 ? ALA A 94 ? ILE A 87 ALA A 92 AA1 4 VAL A 100 ? GLU A 106 ? VAL A 98 GLU A 104 AA1 5 ILE A 113 ? LYS A 119 ? ILE A 111 LYS A 117 AA2 1 ILE A 68 ? ASN A 73 ? ILE A 66 ASN A 71 AA2 2 ASP A 27 ? ASN A 33 ? ASP A 25 ASN A 31 AA2 3 GLY A 36 ? MET A 42 ? GLY A 34 MET A 40 AA2 4 LEU A 49 ? LYS A 55 ? LEU A 47 LYS A 53 AA2 5 TYR A 248 ? LEU A 253 ? TYR A 246 LEU A 251 AA2 6 LEU A 237 ? SER A 242 ? LEU A 235 SER A 240 AA2 7 THR A 226 ? LEU A 231 ? THR A 224 LEU A 229 AA2 8 ALA A 137 ? PRO A 142 ? ALA A 135 PRO A 140 AA2 9 GLU A 198 ? LEU A 201 ? GLU A 196 LEU A 199 AA3 1 ASN A 179 ? ARG A 185 ? ASN A 177 ARG A 183 AA3 2 GLY A 168 ? GLN A 174 ? GLY A 166 GLN A 172 AA3 3 SER A 159 ? ASN A 165 ? SER A 157 ASN A 163 AA3 4 VAL A 205 ? SER A 210 ? VAL A 203 SER A 208 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ARG A 63 ? O ARG A 61 N GLU A 5 ? N GLU A 3 AA1 2 3 N LEU A 8 ? N LEU A 6 O LEU A 90 ? O LEU A 88 AA1 3 4 N LYS A 93 ? N LYS A 91 O ASN A 102 ? O ASN A 100 AA1 4 5 N LEU A 103 ? N LEU A 101 O TYR A 116 ? O TYR A 114 AA2 1 2 O ILE A 68 ? O ILE A 66 N CYS A 32 ? N CYS A 30 AA2 2 3 N ASP A 31 ? N ASP A 29 O ALA A 38 ? O ALA A 36 AA2 3 4 N ALA A 41 ? N ALA A 39 O VAL A 50 ? O VAL A 48 AA2 4 5 N SER A 51 ? N SER A 49 O ARG A 250 ? O ARG A 248 AA2 5 6 O PHE A 251 ? O PHE A 249 N VAL A 239 ? N VAL A 237 AA2 6 7 O LEU A 238 ? O LEU A 236 N CYS A 230 ? N CYS A 228 AA2 7 8 O LEU A 231 ? O LEU A 229 N ALA A 137 ? N ALA A 135 AA2 8 9 N THR A 138 ? N THR A 136 O GLU A 200 ? O GLU A 198 AA3 1 2 O LEU A 184 ? O LEU A 182 N VAL A 169 ? N VAL A 167 AA3 2 3 O SER A 172 ? O SER A 170 N THR A 161 ? N THR A 159 AA3 3 4 N ILE A 162 ? N ILE A 160 O LEU A 207 ? O LEU A 205 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 24 ? ? -97.04 -73.12 2 1 SER A 58 ? ? -157.53 78.56 3 1 ALA A 95 ? ? 36.49 64.87 4 1 GLU A 201 ? ? -179.81 121.47 # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 18.393 _pdbx_refine_tls.origin_y 26.573 _pdbx_refine_tls.origin_z -0.241 _pdbx_refine_tls.T[1][1] 0.0132 _pdbx_refine_tls.T[2][2] 0.1655 _pdbx_refine_tls.T[3][3] 0.5966 _pdbx_refine_tls.T[1][2] 0.0084 _pdbx_refine_tls.T[1][3] 0.0129 _pdbx_refine_tls.T[2][3] 0.0356 _pdbx_refine_tls.L[1][1] 1.4774 _pdbx_refine_tls.L[2][2] 4.7240 _pdbx_refine_tls.L[3][3] 0.8708 _pdbx_refine_tls.L[1][2] 0.3050 _pdbx_refine_tls.L[1][3] 0.2502 _pdbx_refine_tls.L[2][3] 0.5199 _pdbx_refine_tls.S[1][1] 0.1180 _pdbx_refine_tls.S[2][2] 0.0113 _pdbx_refine_tls.S[3][3] -0.1293 _pdbx_refine_tls.S[1][2] 0.0330 _pdbx_refine_tls.S[1][3] 0.0270 _pdbx_refine_tls.S[2][3] 0.2849 _pdbx_refine_tls.S[2][1] -0.0927 _pdbx_refine_tls.S[3][1] -0.0117 _pdbx_refine_tls.S[3][2] -0.1054 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 1 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 255 _pdbx_refine_tls_group.selection_details ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA -1 ? A ALA 1 2 1 Y 1 A MET 0 ? A MET 2 3 1 Y 1 A SER 106 ? A SER 108 4 1 Y 1 A GLU 107 ? A GLU 109 5 1 Y 1 A GLU 124 ? A GLU 126 6 1 Y 1 A HIS 125 ? A HIS 127 7 1 Y 1 A LEU 126 ? A LEU 128 8 1 Y 1 A GLY 127 ? A GLY 129 9 1 Y 1 A ILE 128 ? A ILE 130 10 1 Y 1 A PRO 129 ? A PRO 131 11 1 Y 1 A GLU 130 ? A GLU 132 12 1 Y 1 A THR 131 ? A THR 133 13 1 Y 1 A GLU 132 ? A GLU 134 14 1 Y 1 A GLY 256 ? A GLY 258 15 1 Y 1 A ASP 257 ? A ASP 259 16 1 Y 1 A ASP 258 ? A ASP 260 17 1 Y 1 A GLU 259 ? A GLU 261 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TYR N N N N 321 TYR CA C N S 322 TYR C C N N 323 TYR O O N N 324 TYR CB C N N 325 TYR CG C Y N 326 TYR CD1 C Y N 327 TYR CD2 C Y N 328 TYR CE1 C Y N 329 TYR CE2 C Y N 330 TYR CZ C Y N 331 TYR OH O N N 332 TYR OXT O N N 333 TYR H H N N 334 TYR H2 H N N 335 TYR HA H N N 336 TYR HB2 H N N 337 TYR HB3 H N N 338 TYR HD1 H N N 339 TYR HD2 H N N 340 TYR HE1 H N N 341 TYR HE2 H N N 342 TYR HH H N N 343 TYR HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _pdbx_audit_support.funding_organization 'Other private' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number RIG70668 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5TUP _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7O1E _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011592 _atom_sites.fract_transf_matrix[1][2] 0.006692 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013385 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011008 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_