data_7O2K # _entry.id 7O2K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.342 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7O2K ? ? WWPDB D_1292115017 ? ? BMRB 27877 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'Cytotoxin 3 from Naja Kaouthia' 6RC7 unspecified BMRB . 27877 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7O2K _pdbx_database_status.recvd_initial_deposition_date 2021-03-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Dubinnyi, M.A.' 1 0000-0002-5463-0169 'Dubovskii, P.V.' 2 0000-0003-2289-6023 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 558 _citation.language ? _citation.page_first 141 _citation.page_last 146 _citation.title 'The omega-loop of cobra cytotoxins tolerates multiple amino acid substitutions.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2021.04.069 _citation.pdbx_database_id_PubMed 33915327 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dubinnyi, M.A.' 1 ? primary 'Dubovskii, P.V.' 2 ? primary 'Starkov, V.G.' 3 ? primary 'Utkin, Y.N.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'Cytotoxin 2' 6756.275 1 ? ? ? ? 2 water nat water 18.015 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CX2,Toxin CM-7A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LKCNKLIPLAYKTCPAGKNLCYKMFMVSNKTVPVKRGCIDVCPKNSLLVKYVCCNTDRCN _entity_poly.pdbx_seq_one_letter_code_can LKCNKLIPLAYKTCPAGKNLCYKMFMVSNKTVPVKRGCIDVCPKNSLLVKYVCCNTDRCN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 LYS n 1 3 CYS n 1 4 ASN n 1 5 LYS n 1 6 LEU n 1 7 ILE n 1 8 PRO n 1 9 LEU n 1 10 ALA n 1 11 TYR n 1 12 LYS n 1 13 THR n 1 14 CYS n 1 15 PRO n 1 16 ALA n 1 17 GLY n 1 18 LYS n 1 19 ASN n 1 20 LEU n 1 21 CYS n 1 22 TYR n 1 23 LYS n 1 24 MET n 1 25 PHE n 1 26 MET n 1 27 VAL n 1 28 SER n 1 29 ASN n 1 30 LYS n 1 31 THR n 1 32 VAL n 1 33 PRO n 1 34 VAL n 1 35 LYS n 1 36 ARG n 1 37 GLY n 1 38 CYS n 1 39 ILE n 1 40 ASP n 1 41 VAL n 1 42 CYS n 1 43 PRO n 1 44 LYS n 1 45 ASN n 1 46 SER n 1 47 LEU n 1 48 LEU n 1 49 VAL n 1 50 LYS n 1 51 TYR n 1 52 VAL n 1 53 CYS n 1 54 CYS n 1 55 ASN n 1 56 THR n 1 57 ASP n 1 58 ARG n 1 59 CYS n 1 60 ASN n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 60 _entity_src_nat.common_name 'Monocled cobra, Naja siamensis' _entity_src_nat.pdbx_organism_scientific 'Naja kaouthia' _entity_src_nat.pdbx_ncbi_taxonomy_id 8649 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code 3SA7A_NAJKA _struct_ref.pdbx_db_accession P01445 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LKCNKLIPLAYKTCPAGKNLCYKMFMVSNKTVPVKRGCIDVCPKNSLLVKYVCCNTDRCN _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7O2K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 60 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01445 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 60 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 60 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D NOESY' 1 isotropic 2 1 1 '2D TOCSY' 1 isotropic 3 1 1 '2D NOESY' 2 isotropic 4 1 1 '2D 1H-1H COSY' 1 isotropic 5 1 1 '2D 1H-13C HSQC' 1 isotropic 6 1 1 '2D 1H-15N HSQC' 1 isotropic 7 1 1 '2D 1H-13C HSQC-TOCSY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 0 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 'Cytotoxins 2 and 3' _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err 0.05 _pdbx_nmr_exptl_sample_conditions.temperature_err 1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2 mM cytotoxin 2, 3 mM Cytotoxin 3, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 'The mixture of CT3 and CT2 Naja kaouthia' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '3 mM No Cytotoxin 3 from Naja kaouthia, 2 mM No Cytotoxin 2 from Naja kaouthia, 90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 800 ? 2 AVANCE ? Bruker 700 ? # _pdbx_nmr_refine.entry_id 7O2K _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details '582 NOE constraints, 109 angular constraints, 27 H-bonds, 4 SS-bonds' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 7O2K _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7O2K _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA ? 'Guntert P.' 2 'structure calculation' CYANA 1.0.3 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' CARA 1.8.4 'Keller and Wuthrich' 4 'peak picking' CARA 1.8.4 'Keller and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7O2K _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7O2K _struct.title 'NMR solution structue of cytotoxin 2 from Naja Kaouthia' _struct.pdbx_descriptor 'Cytotoxin 2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7O2K _struct_keywords.text 'S-type cytotoxin, cobra venom, three-finger protein, membrane-active polypeptide, TOXIN' _struct_keywords.pdbx_keywords TOXIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 3 A CYS 21 1_555 ? ? ? ? ? ? ? 2.040 ? ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 14 A CYS 38 1_555 ? ? ? ? ? ? ? 2.061 ? ? disulf3 disulf ? ? A CYS 42 SG ? ? ? 1_555 A CYS 53 SG ? ? A CYS 42 A CYS 53 1_555 ? ? ? ? ? ? ? 2.075 ? ? disulf4 disulf ? ? A CYS 54 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 54 A CYS 59 1_555 ? ? ? ? ? ? ? 2.041 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 2 ? ASN A 4 ? LYS A 2 ASN A 4 AA1 2 TYR A 11 ? THR A 13 ? TYR A 11 THR A 13 AA2 1 ASN A 29 ? ILE A 39 ? ASN A 29 ILE A 39 AA2 2 LEU A 20 ? MET A 26 ? LEU A 20 MET A 26 AA2 3 VAL A 49 ? CYS A 54 ? VAL A 49 CYS A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N CYS A 3 ? N CYS A 3 O LYS A 12 ? O LYS A 12 AA2 1 2 O ASN A 29 ? O ASN A 29 N MET A 26 ? N MET A 26 AA2 2 3 N PHE A 25 ? N PHE A 25 O LYS A 50 ? O LYS A 50 # _atom_sites.entry_id 7O2K _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 ASN 60 60 60 ASN ASN A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HOH _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 61 _pdbx_nonpoly_scheme.pdb_mon_id HOH _pdbx_nonpoly_scheme.auth_mon_id HOH _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4170 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2021-06-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'cytotoxin 2' 2 ? mM 'natural abundance' 1 'Cytotoxin 3' 3 ? mM 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A MET 26 ? ? H A ASN 29 ? ? 1.50 2 2 O A MET 26 ? ? H A ASN 29 ? ? 1.51 3 3 O A MET 26 ? ? H A ASN 29 ? ? 1.50 4 4 O A MET 26 ? ? H A ASN 29 ? ? 1.52 5 6 O A MET 26 ? ? H A ASN 29 ? ? 1.51 6 7 O A MET 26 ? ? H A ASN 29 ? ? 1.56 7 8 O A MET 26 ? ? H A ASN 29 ? ? 1.55 8 9 O A MET 26 ? ? H A ASN 29 ? ? 1.54 9 9 HZ3 A LYS 18 ? ? OD2 A ASP 40 ? ? 1.55 10 12 O A MET 26 ? ? H A ASN 29 ? ? 1.54 11 13 O A MET 26 ? ? H A ASN 29 ? ? 1.51 12 14 O A MET 26 ? ? H A ASN 29 ? ? 1.52 13 15 O A MET 26 ? ? H A ASN 29 ? ? 1.48 14 17 O A MET 26 ? ? H A ASN 29 ? ? 1.56 15 19 O A MET 26 ? ? H A ASN 29 ? ? 1.50 16 20 O A MET 26 ? ? H A ASN 29 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 8 ? ? -59.83 69.30 2 1 LEU A 9 ? ? -172.03 -34.72 3 1 PRO A 15 ? ? -50.78 -178.40 4 1 VAL A 27 ? ? -39.76 -37.89 5 1 ASN A 29 ? ? -165.63 90.16 6 1 PRO A 43 ? ? -58.15 179.19 7 1 LEU A 48 ? ? -109.01 -63.85 8 2 PRO A 8 ? ? -45.96 72.87 9 2 LEU A 9 ? ? -174.94 -37.35 10 2 PRO A 15 ? ? -50.48 -179.75 11 2 VAL A 27 ? ? -39.34 -38.34 12 2 ASN A 29 ? ? -166.41 91.78 13 2 PRO A 43 ? ? -65.25 -178.26 14 2 ARG A 58 ? ? 38.77 47.10 15 3 PRO A 8 ? ? -54.76 70.13 16 3 LEU A 9 ? ? -172.12 -36.58 17 3 PRO A 15 ? ? -46.29 -177.18 18 3 VAL A 27 ? ? -38.57 -35.91 19 3 ASN A 29 ? ? -166.46 89.77 20 3 PRO A 43 ? ? -68.22 -179.44 21 3 ARG A 58 ? ? 34.65 42.46 22 4 PRO A 8 ? ? -56.81 71.40 23 4 LEU A 9 ? ? -175.30 -36.48 24 4 PRO A 15 ? ? -46.51 -176.24 25 4 VAL A 27 ? ? -38.70 -36.01 26 4 ASN A 29 ? ? -168.41 92.29 27 4 PRO A 43 ? ? -69.89 -178.23 28 4 ARG A 58 ? ? 45.95 27.19 29 5 PRO A 8 ? ? -45.51 71.86 30 5 LEU A 9 ? ? -173.58 -37.20 31 5 PRO A 15 ? ? -49.96 -179.05 32 5 ASN A 29 ? ? -173.66 91.17 33 5 PRO A 43 ? ? -69.46 -179.18 34 5 ARG A 58 ? ? 39.68 37.72 35 6 PRO A 8 ? ? -58.44 71.46 36 6 LEU A 9 ? ? -175.76 -36.01 37 6 PRO A 15 ? ? -47.14 -179.83 38 6 VAL A 27 ? ? -38.89 -34.36 39 6 ASN A 29 ? ? -170.48 92.91 40 6 PRO A 43 ? ? -67.73 -177.25 41 7 PRO A 8 ? ? -58.44 71.87 42 7 LEU A 9 ? ? -175.92 -35.93 43 7 PRO A 15 ? ? -49.83 -178.38 44 7 VAL A 27 ? ? -37.65 -34.64 45 7 ASN A 29 ? ? -169.31 92.09 46 7 PRO A 43 ? ? -58.54 -179.73 47 8 PRO A 8 ? ? -57.86 71.58 48 8 LEU A 9 ? ? -175.95 -36.39 49 8 PRO A 15 ? ? -46.69 -177.63 50 8 ASN A 29 ? ? -171.11 92.27 51 8 PRO A 43 ? ? -63.71 -178.42 52 8 ARG A 58 ? ? 41.41 27.51 53 9 PRO A 8 ? ? -59.40 71.26 54 9 LEU A 9 ? ? -175.72 -36.03 55 9 PRO A 15 ? ? -47.07 -178.39 56 9 VAL A 27 ? ? -38.50 -35.19 57 9 ASN A 29 ? ? -169.70 92.28 58 9 PRO A 43 ? ? -58.93 -178.67 59 9 ARG A 58 ? ? 39.15 50.85 60 10 PRO A 8 ? ? -54.28 68.33 61 10 LEU A 9 ? ? -168.90 -36.77 62 10 PRO A 15 ? ? -45.85 -177.14 63 10 ASN A 29 ? ? -170.08 90.06 64 10 PRO A 43 ? ? -59.76 179.99 65 10 ARG A 58 ? ? 42.27 29.20 66 11 PRO A 8 ? ? -58.63 71.52 67 11 LEU A 9 ? ? -176.05 -35.91 68 11 PRO A 15 ? ? -46.36 -177.37 69 11 ASN A 29 ? ? -174.79 93.17 70 11 PRO A 43 ? ? -69.77 -177.63 71 11 ARG A 58 ? ? 42.11 27.59 72 12 PRO A 8 ? ? -50.47 72.59 73 12 LEU A 9 ? ? -176.09 -37.28 74 12 PRO A 15 ? ? -46.63 -177.54 75 12 VAL A 27 ? ? -38.90 -36.62 76 12 ASN A 29 ? ? -173.83 93.73 77 12 PRO A 43 ? ? -60.23 -179.89 78 12 ARG A 58 ? ? 49.12 27.75 79 13 PRO A 8 ? ? -50.46 72.76 80 13 LEU A 9 ? ? -175.99 -37.32 81 13 PRO A 15 ? ? -46.82 -177.62 82 13 VAL A 27 ? ? -39.85 -32.19 83 13 ASN A 29 ? ? -170.69 93.73 84 13 PRO A 43 ? ? -67.37 -176.76 85 14 PRO A 8 ? ? -45.87 73.16 86 14 LEU A 9 ? ? -175.28 -36.88 87 14 PRO A 15 ? ? -47.74 -177.09 88 14 VAL A 27 ? ? -39.55 -38.51 89 14 ASN A 29 ? ? -165.61 90.80 90 14 PRO A 43 ? ? -60.34 -179.53 91 15 PRO A 8 ? ? -49.61 72.76 92 15 LEU A 9 ? ? -175.89 -37.29 93 15 PRO A 15 ? ? -46.56 -177.50 94 15 ASN A 29 ? ? -170.19 91.78 95 15 PRO A 43 ? ? -69.07 -177.61 96 15 ARG A 58 ? ? 35.77 44.70 97 16 PRO A 8 ? ? -54.58 68.02 98 16 LEU A 9 ? ? -169.15 -36.75 99 16 PRO A 15 ? ? -47.78 -178.41 100 16 ASN A 29 ? ? -175.28 89.68 101 16 PRO A 43 ? ? -64.51 -177.30 102 17 PRO A 8 ? ? -59.16 70.43 103 17 LEU A 9 ? ? -174.65 -36.17 104 17 PRO A 15 ? ? -48.19 -177.80 105 17 VAL A 27 ? ? -37.76 -37.13 106 17 SER A 28 ? ? -38.82 -38.79 107 17 ASN A 29 ? ? -168.28 93.16 108 17 PRO A 43 ? ? -60.98 -178.36 109 17 LEU A 48 ? ? -110.08 -70.23 110 18 PRO A 8 ? ? -55.74 69.64 111 18 LEU A 9 ? ? -171.49 -36.63 112 18 PRO A 15 ? ? -47.15 -177.74 113 18 ASN A 29 ? ? -172.60 86.10 114 18 PRO A 43 ? ? -57.79 -179.83 115 18 ARG A 58 ? ? 40.40 28.09 116 19 PRO A 8 ? ? -47.97 72.41 117 19 LEU A 9 ? ? -175.17 -37.58 118 19 PRO A 15 ? ? -46.24 -177.48 119 19 VAL A 27 ? ? -38.32 -37.89 120 19 ASN A 29 ? ? -169.74 93.03 121 19 PRO A 43 ? ? -67.02 -179.50 122 20 PRO A 8 ? ? -59.56 71.07 123 20 LEU A 9 ? ? -175.78 -35.68 124 20 PRO A 15 ? ? -47.56 -178.13 125 20 ASN A 29 ? ? -151.87 83.09 126 20 LEU A 48 ? ? -121.66 -66.57 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #