data_7O9G
# 
_entry.id   7O9G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.384 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7O9G         pdb_00007o9g 10.2210/pdb7o9g/pdb 
WWPDB D_1292115289 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2022-02-02 
2 'Structure model' 1 1 2022-03-09 
3 'Structure model' 1 2 2024-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                      
2 2 'Structure model' citation_author               
3 3 'Structure model' chem_comp_atom                
4 3 'Structure model' chem_comp_bond                
5 3 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'          
2 2 'Structure model' '_citation.page_first'              
3 2 'Structure model' '_citation.page_last'               
4 2 'Structure model' '_citation.pdbx_database_id_DOI'    
5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
6 2 'Structure model' '_citation.title'                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7O9G 
_pdbx_database_status.recvd_initial_deposition_date   2021-04-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Czech, L.'   1 0000-0001-7398-1186 
'Mais, C.-N.' 2 0000-0003-1927-2885 
'Bange, G.'   3 0000-0002-7826-0932 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            13 
_citation.language                  ? 
_citation.page_first                1069 
_citation.page_last                 1069 
_citation.title                     'Inhibition of SRP-dependent protein secretion by the bacterial alarmone (p)ppGpp.' 
_citation.year                      2022 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-022-28675-0 
_citation.pdbx_database_id_PubMed   35217658 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Czech, L.'         1  0000-0001-7398-1186 
primary 'Mais, C.N.'        2  0000-0003-1927-2885 
primary 'Kratzat, H.'       3  0000-0001-5849-6131 
primary 'Sarmah, P.'        4  ?                   
primary 'Giammarinaro, P.'  5  ?                   
primary 'Freibert, S.A.'    6  0000-0002-8521-2963 
primary 'Esser, H.F.'       7  ?                   
primary 'Musial, J.'        8  ?                   
primary 'Berninghausen, O.' 9  0000-0002-9255-0522 
primary 'Steinchen, W.'     10 ?                   
primary 'Beckmann, R.'      11 0000-0003-4291-3898 
primary 'Koch, H.G.'        12 0000-0001-5913-0334 
primary 'Bange, G.'         13 0000-0002-7826-0932 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Signal recognition particle protein' 33395.465 1 ? ? ? ? 
2 non-polymer syn "GUANOSINE-5',3'-TETRAPHOSPHATE"      603.160   1 ? ? ? ? 
3 non-polymer syn 'MAGNESIUM ION'                       24.305    1 ? ? ? ? 
4 water       nat water                                 18.015    9 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Fifty-four homolog' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTPGQEFVKIVR
NELVAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDF
FPSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASINPVETLFVVDAMTGQDAANTAKAFNEA
LPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMGDHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTPGQEFVKIVR
NELVAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDF
FPSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASINPVETLFVVDAMTGQDAANTAKAFNEA
LPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMGDHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "GUANOSINE-5',3'-TETRAPHOSPHATE" G4P 
3 'MAGNESIUM ION'                  MG  
4 water                            HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   PHE n 
1 4   ASP n 
1 5   ASN n 
1 6   LEU n 
1 7   THR n 
1 8   ASP n 
1 9   ARG n 
1 10  LEU n 
1 11  SER n 
1 12  ARG n 
1 13  THR n 
1 14  LEU n 
1 15  ARG n 
1 16  ASN n 
1 17  ILE n 
1 18  SER n 
1 19  GLY n 
1 20  ARG n 
1 21  GLY n 
1 22  ARG n 
1 23  LEU n 
1 24  THR n 
1 25  GLU n 
1 26  ASP n 
1 27  ASN n 
1 28  VAL n 
1 29  LYS n 
1 30  ASP n 
1 31  THR n 
1 32  LEU n 
1 33  ARG n 
1 34  GLU n 
1 35  VAL n 
1 36  ARG n 
1 37  MET n 
1 38  ALA n 
1 39  LEU n 
1 40  LEU n 
1 41  GLU n 
1 42  ALA n 
1 43  ASP n 
1 44  VAL n 
1 45  ALA n 
1 46  LEU n 
1 47  PRO n 
1 48  VAL n 
1 49  VAL n 
1 50  ARG n 
1 51  GLU n 
1 52  PHE n 
1 53  ILE n 
1 54  ASN n 
1 55  ARG n 
1 56  VAL n 
1 57  LYS n 
1 58  GLU n 
1 59  LYS n 
1 60  ALA n 
1 61  VAL n 
1 62  GLY n 
1 63  HIS n 
1 64  GLU n 
1 65  VAL n 
1 66  ASN n 
1 67  LYS n 
1 68  SER n 
1 69  LEU n 
1 70  THR n 
1 71  PRO n 
1 72  GLY n 
1 73  GLN n 
1 74  GLU n 
1 75  PHE n 
1 76  VAL n 
1 77  LYS n 
1 78  ILE n 
1 79  VAL n 
1 80  ARG n 
1 81  ASN n 
1 82  GLU n 
1 83  LEU n 
1 84  VAL n 
1 85  ALA n 
1 86  ALA n 
1 87  MET n 
1 88  GLY n 
1 89  GLU n 
1 90  GLU n 
1 91  ASN n 
1 92  GLN n 
1 93  THR n 
1 94  LEU n 
1 95  ASN n 
1 96  LEU n 
1 97  ALA n 
1 98  ALA n 
1 99  GLN n 
1 100 PRO n 
1 101 PRO n 
1 102 ALA n 
1 103 VAL n 
1 104 VAL n 
1 105 LEU n 
1 106 MET n 
1 107 ALA n 
1 108 GLY n 
1 109 LEU n 
1 110 GLN n 
1 111 GLY n 
1 112 ALA n 
1 113 GLY n 
1 114 LYS n 
1 115 THR n 
1 116 THR n 
1 117 SER n 
1 118 VAL n 
1 119 GLY n 
1 120 LYS n 
1 121 LEU n 
1 122 GLY n 
1 123 LYS n 
1 124 PHE n 
1 125 LEU n 
1 126 ARG n 
1 127 GLU n 
1 128 LYS n 
1 129 HIS n 
1 130 LYS n 
1 131 LYS n 
1 132 LYS n 
1 133 VAL n 
1 134 LEU n 
1 135 VAL n 
1 136 VAL n 
1 137 SER n 
1 138 ALA n 
1 139 ASP n 
1 140 VAL n 
1 141 TYR n 
1 142 ARG n 
1 143 PRO n 
1 144 ALA n 
1 145 ALA n 
1 146 ILE n 
1 147 LYS n 
1 148 GLN n 
1 149 LEU n 
1 150 GLU n 
1 151 THR n 
1 152 LEU n 
1 153 ALA n 
1 154 GLU n 
1 155 GLN n 
1 156 VAL n 
1 157 GLY n 
1 158 VAL n 
1 159 ASP n 
1 160 PHE n 
1 161 PHE n 
1 162 PRO n 
1 163 SER n 
1 164 ASP n 
1 165 VAL n 
1 166 GLY n 
1 167 GLN n 
1 168 LYS n 
1 169 PRO n 
1 170 VAL n 
1 171 ASP n 
1 172 ILE n 
1 173 VAL n 
1 174 ASN n 
1 175 ALA n 
1 176 ALA n 
1 177 LEU n 
1 178 LYS n 
1 179 GLU n 
1 180 ALA n 
1 181 LYS n 
1 182 LEU n 
1 183 LYS n 
1 184 PHE n 
1 185 TYR n 
1 186 ASP n 
1 187 VAL n 
1 188 LEU n 
1 189 LEU n 
1 190 VAL n 
1 191 ASP n 
1 192 THR n 
1 193 ALA n 
1 194 GLY n 
1 195 ARG n 
1 196 LEU n 
1 197 HIS n 
1 198 VAL n 
1 199 ASP n 
1 200 GLU n 
1 201 ALA n 
1 202 MET n 
1 203 MET n 
1 204 ASP n 
1 205 GLU n 
1 206 ILE n 
1 207 LYS n 
1 208 GLN n 
1 209 VAL n 
1 210 HIS n 
1 211 ALA n 
1 212 SER n 
1 213 ILE n 
1 214 ASN n 
1 215 PRO n 
1 216 VAL n 
1 217 GLU n 
1 218 THR n 
1 219 LEU n 
1 220 PHE n 
1 221 VAL n 
1 222 VAL n 
1 223 ASP n 
1 224 ALA n 
1 225 MET n 
1 226 THR n 
1 227 GLY n 
1 228 GLN n 
1 229 ASP n 
1 230 ALA n 
1 231 ALA n 
1 232 ASN n 
1 233 THR n 
1 234 ALA n 
1 235 LYS n 
1 236 ALA n 
1 237 PHE n 
1 238 ASN n 
1 239 GLU n 
1 240 ALA n 
1 241 LEU n 
1 242 PRO n 
1 243 LEU n 
1 244 THR n 
1 245 GLY n 
1 246 VAL n 
1 247 VAL n 
1 248 LEU n 
1 249 THR n 
1 250 LYS n 
1 251 VAL n 
1 252 ASP n 
1 253 GLY n 
1 254 ASP n 
1 255 ALA n 
1 256 ARG n 
1 257 GLY n 
1 258 GLY n 
1 259 ALA n 
1 260 ALA n 
1 261 LEU n 
1 262 SER n 
1 263 ILE n 
1 264 ARG n 
1 265 HIS n 
1 266 ILE n 
1 267 THR n 
1 268 GLY n 
1 269 LYS n 
1 270 PRO n 
1 271 ILE n 
1 272 LYS n 
1 273 PHE n 
1 274 LEU n 
1 275 GLY n 
1 276 VAL n 
1 277 GLY n 
1 278 GLU n 
1 279 LYS n 
1 280 THR n 
1 281 GLU n 
1 282 ALA n 
1 283 LEU n 
1 284 GLU n 
1 285 PRO n 
1 286 PHE n 
1 287 HIS n 
1 288 PRO n 
1 289 ASP n 
1 290 ARG n 
1 291 ILE n 
1 292 ALA n 
1 293 SER n 
1 294 ARG n 
1 295 ILE n 
1 296 LEU n 
1 297 GLY n 
1 298 MET n 
1 299 GLY n 
1 300 ASP n 
1 301 HIS n 
1 302 HIS n 
1 303 HIS n 
1 304 HIS n 
1 305 HIS n 
1 306 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   306 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ffh, BANRA_03474' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                          ?                                'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                         ?                                'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                       ?                                'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                  ?                                'C4 H7 N O4'        133.103 
G4P 'RNA linking'       . "GUANOSINE-5',3'-TETRAPHOSPHATE" 'guanosine tetraphosphate;ppGpp' 'C10 H17 N5 O17 P4' 603.160 
GLN 'L-peptide linking' y GLUTAMINE                        ?                                'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                  ?                                'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                          ?                                'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                        ?                                'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                            ?                                'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                       ?                                'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                          ?                                'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                           ?                                'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                       ?                                'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                  ?                                'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                    ?                                'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                          ?                                'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                           ?                                'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                        ?                                'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                         ?                                'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                           ?                                'C5 H11 N O2'       117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   ?   ?   ?   A . n 
A 1 2   GLY 2   1   ?   ?   ?   A . n 
A 1 3   PHE 3   2   ?   ?   ?   A . n 
A 1 4   ASP 4   3   3   ASP ASP A . n 
A 1 5   ASN 5   4   4   ASN ASN A . n 
A 1 6   LEU 6   5   5   LEU LEU A . n 
A 1 7   THR 7   6   6   THR THR A . n 
A 1 8   ASP 8   7   7   ASP ASP A . n 
A 1 9   ARG 9   8   8   ARG ARG A . n 
A 1 10  LEU 10  9   9   LEU LEU A . n 
A 1 11  SER 11  10  10  SER SER A . n 
A 1 12  ARG 12  11  11  ARG ARG A . n 
A 1 13  THR 13  12  12  THR THR A . n 
A 1 14  LEU 14  13  13  LEU LEU A . n 
A 1 15  ARG 15  14  14  ARG ARG A . n 
A 1 16  ASN 16  15  15  ASN ASN A . n 
A 1 17  ILE 17  16  16  ILE ILE A . n 
A 1 18  SER 18  17  17  SER SER A . n 
A 1 19  GLY 19  18  18  GLY GLY A . n 
A 1 20  ARG 20  19  19  ARG ARG A . n 
A 1 21  GLY 21  20  20  GLY GLY A . n 
A 1 22  ARG 22  21  21  ARG ARG A . n 
A 1 23  LEU 23  22  22  LEU LEU A . n 
A 1 24  THR 24  23  23  THR THR A . n 
A 1 25  GLU 25  24  24  GLU GLU A . n 
A 1 26  ASP 26  25  25  ASP ASP A . n 
A 1 27  ASN 27  26  26  ASN ASN A . n 
A 1 28  VAL 28  27  27  VAL VAL A . n 
A 1 29  LYS 29  28  28  LYS LYS A . n 
A 1 30  ASP 30  29  29  ASP ASP A . n 
A 1 31  THR 31  30  30  THR THR A . n 
A 1 32  LEU 32  31  31  LEU LEU A . n 
A 1 33  ARG 33  32  32  ARG ARG A . n 
A 1 34  GLU 34  33  33  GLU GLU A . n 
A 1 35  VAL 35  34  34  VAL VAL A . n 
A 1 36  ARG 36  35  35  ARG ARG A . n 
A 1 37  MET 37  36  36  MET MET A . n 
A 1 38  ALA 38  37  37  ALA ALA A . n 
A 1 39  LEU 39  38  38  LEU LEU A . n 
A 1 40  LEU 40  39  39  LEU LEU A . n 
A 1 41  GLU 41  40  40  GLU GLU A . n 
A 1 42  ALA 42  41  41  ALA ALA A . n 
A 1 43  ASP 43  42  42  ASP ASP A . n 
A 1 44  VAL 44  43  43  VAL VAL A . n 
A 1 45  ALA 45  44  44  ALA ALA A . n 
A 1 46  LEU 46  45  45  LEU LEU A . n 
A 1 47  PRO 47  46  46  PRO PRO A . n 
A 1 48  VAL 48  47  47  VAL VAL A . n 
A 1 49  VAL 49  48  48  VAL VAL A . n 
A 1 50  ARG 50  49  49  ARG ARG A . n 
A 1 51  GLU 51  50  50  GLU GLU A . n 
A 1 52  PHE 52  51  51  PHE PHE A . n 
A 1 53  ILE 53  52  52  ILE ILE A . n 
A 1 54  ASN 54  53  53  ASN ASN A . n 
A 1 55  ARG 55  54  54  ARG ARG A . n 
A 1 56  VAL 56  55  55  VAL VAL A . n 
A 1 57  LYS 57  56  56  LYS LYS A . n 
A 1 58  GLU 58  57  57  GLU GLU A . n 
A 1 59  LYS 59  58  58  LYS LYS A . n 
A 1 60  ALA 60  59  59  ALA ALA A . n 
A 1 61  VAL 61  60  60  VAL VAL A . n 
A 1 62  GLY 62  61  61  GLY GLY A . n 
A 1 63  HIS 63  62  62  HIS HIS A . n 
A 1 64  GLU 64  63  63  GLU GLU A . n 
A 1 65  VAL 65  64  64  VAL VAL A . n 
A 1 66  ASN 66  65  65  ASN ASN A . n 
A 1 67  LYS 67  66  66  LYS LYS A . n 
A 1 68  SER 68  67  67  SER SER A . n 
A 1 69  LEU 69  68  68  LEU LEU A . n 
A 1 70  THR 70  69  69  THR THR A . n 
A 1 71  PRO 71  70  70  PRO PRO A . n 
A 1 72  GLY 72  71  71  GLY GLY A . n 
A 1 73  GLN 73  72  72  GLN GLN A . n 
A 1 74  GLU 74  73  73  GLU GLU A . n 
A 1 75  PHE 75  74  74  PHE PHE A . n 
A 1 76  VAL 76  75  75  VAL VAL A . n 
A 1 77  LYS 77  76  76  LYS LYS A . n 
A 1 78  ILE 78  77  77  ILE ILE A . n 
A 1 79  VAL 79  78  78  VAL VAL A . n 
A 1 80  ARG 80  79  79  ARG ARG A . n 
A 1 81  ASN 81  80  80  ASN ASN A . n 
A 1 82  GLU 82  81  81  GLU GLU A . n 
A 1 83  LEU 83  82  82  LEU LEU A . n 
A 1 84  VAL 84  83  83  VAL VAL A . n 
A 1 85  ALA 85  84  84  ALA ALA A . n 
A 1 86  ALA 86  85  85  ALA ALA A . n 
A 1 87  MET 87  86  86  MET MET A . n 
A 1 88  GLY 88  87  87  GLY GLY A . n 
A 1 89  GLU 89  88  88  GLU GLU A . n 
A 1 90  GLU 90  89  89  GLU GLU A . n 
A 1 91  ASN 91  90  90  ASN ASN A . n 
A 1 92  GLN 92  91  91  GLN GLN A . n 
A 1 93  THR 93  92  92  THR THR A . n 
A 1 94  LEU 94  93  93  LEU LEU A . n 
A 1 95  ASN 95  94  94  ASN ASN A . n 
A 1 96  LEU 96  95  95  LEU LEU A . n 
A 1 97  ALA 97  96  96  ALA ALA A . n 
A 1 98  ALA 98  97  97  ALA ALA A . n 
A 1 99  GLN 99  98  98  GLN GLN A . n 
A 1 100 PRO 100 99  99  PRO PRO A . n 
A 1 101 PRO 101 100 100 PRO PRO A . n 
A 1 102 ALA 102 101 101 ALA ALA A . n 
A 1 103 VAL 103 102 102 VAL VAL A . n 
A 1 104 VAL 104 103 103 VAL VAL A . n 
A 1 105 LEU 105 104 104 LEU LEU A . n 
A 1 106 MET 106 105 105 MET MET A . n 
A 1 107 ALA 107 106 106 ALA ALA A . n 
A 1 108 GLY 108 107 107 GLY GLY A . n 
A 1 109 LEU 109 108 108 LEU LEU A . n 
A 1 110 GLN 110 109 109 GLN GLN A . n 
A 1 111 GLY 111 110 110 GLY GLY A . n 
A 1 112 ALA 112 111 111 ALA ALA A . n 
A 1 113 GLY 113 112 112 GLY GLY A . n 
A 1 114 LYS 114 113 113 LYS LYS A . n 
A 1 115 THR 115 114 114 THR THR A . n 
A 1 116 THR 116 115 115 THR THR A . n 
A 1 117 SER 117 116 116 SER SER A . n 
A 1 118 VAL 118 117 117 VAL VAL A . n 
A 1 119 GLY 119 118 118 GLY GLY A . n 
A 1 120 LYS 120 119 119 LYS LYS A . n 
A 1 121 LEU 121 120 120 LEU LEU A . n 
A 1 122 GLY 122 121 121 GLY GLY A . n 
A 1 123 LYS 123 122 122 LYS LYS A . n 
A 1 124 PHE 124 123 123 PHE PHE A . n 
A 1 125 LEU 125 124 124 LEU LEU A . n 
A 1 126 ARG 126 125 125 ARG ARG A . n 
A 1 127 GLU 127 126 126 GLU GLU A . n 
A 1 128 LYS 128 127 127 LYS LYS A . n 
A 1 129 HIS 129 128 128 HIS HIS A . n 
A 1 130 LYS 130 129 129 LYS LYS A . n 
A 1 131 LYS 131 130 130 LYS LYS A . n 
A 1 132 LYS 132 131 131 LYS LYS A . n 
A 1 133 VAL 133 132 132 VAL VAL A . n 
A 1 134 LEU 134 133 133 LEU LEU A . n 
A 1 135 VAL 135 134 134 VAL VAL A . n 
A 1 136 VAL 136 135 135 VAL VAL A . n 
A 1 137 SER 137 136 136 SER SER A . n 
A 1 138 ALA 138 137 137 ALA ALA A . n 
A 1 139 ASP 139 138 138 ASP ASP A . n 
A 1 140 VAL 140 139 139 VAL VAL A . n 
A 1 141 TYR 141 140 140 TYR TYR A . n 
A 1 142 ARG 142 141 141 ARG ARG A . n 
A 1 143 PRO 143 142 142 PRO PRO A . n 
A 1 144 ALA 144 143 143 ALA ALA A . n 
A 1 145 ALA 145 144 144 ALA ALA A . n 
A 1 146 ILE 146 145 145 ILE ILE A . n 
A 1 147 LYS 147 146 146 LYS LYS A . n 
A 1 148 GLN 148 147 147 GLN GLN A . n 
A 1 149 LEU 149 148 148 LEU LEU A . n 
A 1 150 GLU 150 149 149 GLU GLU A . n 
A 1 151 THR 151 150 150 THR THR A . n 
A 1 152 LEU 152 151 151 LEU LEU A . n 
A 1 153 ALA 153 152 152 ALA ALA A . n 
A 1 154 GLU 154 153 153 GLU GLU A . n 
A 1 155 GLN 155 154 154 GLN GLN A . n 
A 1 156 VAL 156 155 155 VAL VAL A . n 
A 1 157 GLY 157 156 156 GLY GLY A . n 
A 1 158 VAL 158 157 157 VAL VAL A . n 
A 1 159 ASP 159 158 158 ASP ASP A . n 
A 1 160 PHE 160 159 159 PHE PHE A . n 
A 1 161 PHE 161 160 160 PHE PHE A . n 
A 1 162 PRO 162 161 161 PRO PRO A . n 
A 1 163 SER 163 162 162 SER SER A . n 
A 1 164 ASP 164 163 163 ASP ASP A . n 
A 1 165 VAL 165 164 164 VAL VAL A . n 
A 1 166 GLY 166 165 165 GLY GLY A . n 
A 1 167 GLN 167 166 166 GLN GLN A . n 
A 1 168 LYS 168 167 167 LYS LYS A . n 
A 1 169 PRO 169 168 168 PRO PRO A . n 
A 1 170 VAL 170 169 169 VAL VAL A . n 
A 1 171 ASP 171 170 170 ASP ASP A . n 
A 1 172 ILE 172 171 171 ILE ILE A . n 
A 1 173 VAL 173 172 172 VAL VAL A . n 
A 1 174 ASN 174 173 173 ASN ASN A . n 
A 1 175 ALA 175 174 174 ALA ALA A . n 
A 1 176 ALA 176 175 175 ALA ALA A . n 
A 1 177 LEU 177 176 176 LEU LEU A . n 
A 1 178 LYS 178 177 177 LYS LYS A . n 
A 1 179 GLU 179 178 178 GLU GLU A . n 
A 1 180 ALA 180 179 179 ALA ALA A . n 
A 1 181 LYS 181 180 180 LYS LYS A . n 
A 1 182 LEU 182 181 181 LEU LEU A . n 
A 1 183 LYS 183 182 182 LYS LYS A . n 
A 1 184 PHE 184 183 183 PHE PHE A . n 
A 1 185 TYR 185 184 184 TYR TYR A . n 
A 1 186 ASP 186 185 185 ASP ASP A . n 
A 1 187 VAL 187 186 186 VAL VAL A . n 
A 1 188 LEU 188 187 187 LEU LEU A . n 
A 1 189 LEU 189 188 188 LEU LEU A . n 
A 1 190 VAL 190 189 189 VAL VAL A . n 
A 1 191 ASP 191 190 190 ASP ASP A . n 
A 1 192 THR 192 191 191 THR THR A . n 
A 1 193 ALA 193 192 192 ALA ALA A . n 
A 1 194 GLY 194 193 193 GLY GLY A . n 
A 1 195 ARG 195 194 194 ARG ARG A . n 
A 1 196 LEU 196 195 195 LEU LEU A . n 
A 1 197 HIS 197 196 196 HIS HIS A . n 
A 1 198 VAL 198 197 197 VAL VAL A . n 
A 1 199 ASP 199 198 198 ASP ASP A . n 
A 1 200 GLU 200 199 199 GLU GLU A . n 
A 1 201 ALA 201 200 200 ALA ALA A . n 
A 1 202 MET 202 201 201 MET MET A . n 
A 1 203 MET 203 202 202 MET MET A . n 
A 1 204 ASP 204 203 203 ASP ASP A . n 
A 1 205 GLU 205 204 204 GLU GLU A . n 
A 1 206 ILE 206 205 205 ILE ILE A . n 
A 1 207 LYS 207 206 206 LYS LYS A . n 
A 1 208 GLN 208 207 207 GLN GLN A . n 
A 1 209 VAL 209 208 208 VAL VAL A . n 
A 1 210 HIS 210 209 209 HIS HIS A . n 
A 1 211 ALA 211 210 210 ALA ALA A . n 
A 1 212 SER 212 211 211 SER SER A . n 
A 1 213 ILE 213 212 212 ILE ILE A . n 
A 1 214 ASN 214 213 213 ASN ASN A . n 
A 1 215 PRO 215 214 214 PRO PRO A . n 
A 1 216 VAL 216 215 215 VAL VAL A . n 
A 1 217 GLU 217 216 216 GLU GLU A . n 
A 1 218 THR 218 217 217 THR THR A . n 
A 1 219 LEU 219 218 218 LEU LEU A . n 
A 1 220 PHE 220 219 219 PHE PHE A . n 
A 1 221 VAL 221 220 220 VAL VAL A . n 
A 1 222 VAL 222 221 221 VAL VAL A . n 
A 1 223 ASP 223 222 222 ASP ASP A . n 
A 1 224 ALA 224 223 223 ALA ALA A . n 
A 1 225 MET 225 224 224 MET MET A . n 
A 1 226 THR 226 225 225 THR THR A . n 
A 1 227 GLY 227 226 226 GLY GLY A . n 
A 1 228 GLN 228 227 227 GLN GLN A . n 
A 1 229 ASP 229 228 228 ASP ASP A . n 
A 1 230 ALA 230 229 229 ALA ALA A . n 
A 1 231 ALA 231 230 230 ALA ALA A . n 
A 1 232 ASN 232 231 231 ASN ASN A . n 
A 1 233 THR 233 232 232 THR THR A . n 
A 1 234 ALA 234 233 233 ALA ALA A . n 
A 1 235 LYS 235 234 234 LYS LYS A . n 
A 1 236 ALA 236 235 235 ALA ALA A . n 
A 1 237 PHE 237 236 236 PHE PHE A . n 
A 1 238 ASN 238 237 237 ASN ASN A . n 
A 1 239 GLU 239 238 238 GLU GLU A . n 
A 1 240 ALA 240 239 239 ALA ALA A . n 
A 1 241 LEU 241 240 240 LEU LEU A . n 
A 1 242 PRO 242 241 241 PRO PRO A . n 
A 1 243 LEU 243 242 242 LEU LEU A . n 
A 1 244 THR 244 243 243 THR THR A . n 
A 1 245 GLY 245 244 244 GLY GLY A . n 
A 1 246 VAL 246 245 245 VAL VAL A . n 
A 1 247 VAL 247 246 246 VAL VAL A . n 
A 1 248 LEU 248 247 247 LEU LEU A . n 
A 1 249 THR 249 248 248 THR THR A . n 
A 1 250 LYS 250 249 249 LYS LYS A . n 
A 1 251 VAL 251 250 250 VAL VAL A . n 
A 1 252 ASP 252 251 251 ASP ASP A . n 
A 1 253 GLY 253 252 252 GLY GLY A . n 
A 1 254 ASP 254 253 253 ASP ASP A . n 
A 1 255 ALA 255 254 254 ALA ALA A . n 
A 1 256 ARG 256 255 255 ARG ARG A . n 
A 1 257 GLY 257 256 256 GLY GLY A . n 
A 1 258 GLY 258 257 257 GLY GLY A . n 
A 1 259 ALA 259 258 258 ALA ALA A . n 
A 1 260 ALA 260 259 259 ALA ALA A . n 
A 1 261 LEU 261 260 260 LEU LEU A . n 
A 1 262 SER 262 261 261 SER SER A . n 
A 1 263 ILE 263 262 262 ILE ILE A . n 
A 1 264 ARG 264 263 263 ARG ARG A . n 
A 1 265 HIS 265 264 264 HIS HIS A . n 
A 1 266 ILE 266 265 265 ILE ILE A . n 
A 1 267 THR 267 266 266 THR THR A . n 
A 1 268 GLY 268 267 267 GLY GLY A . n 
A 1 269 LYS 269 268 268 LYS LYS A . n 
A 1 270 PRO 270 269 269 PRO PRO A . n 
A 1 271 ILE 271 270 270 ILE ILE A . n 
A 1 272 LYS 272 271 271 LYS LYS A . n 
A 1 273 PHE 273 272 272 PHE PHE A . n 
A 1 274 LEU 274 273 273 LEU LEU A . n 
A 1 275 GLY 275 274 274 GLY GLY A . n 
A 1 276 VAL 276 275 275 VAL VAL A . n 
A 1 277 GLY 277 276 276 GLY GLY A . n 
A 1 278 GLU 278 277 277 GLU GLU A . n 
A 1 279 LYS 279 278 278 LYS LYS A . n 
A 1 280 THR 280 279 279 THR THR A . n 
A 1 281 GLU 281 280 280 GLU GLU A . n 
A 1 282 ALA 282 281 281 ALA ALA A . n 
A 1 283 LEU 283 282 282 LEU LEU A . n 
A 1 284 GLU 284 283 283 GLU GLU A . n 
A 1 285 PRO 285 284 284 PRO PRO A . n 
A 1 286 PHE 286 285 285 PHE PHE A . n 
A 1 287 HIS 287 286 286 HIS HIS A . n 
A 1 288 PRO 288 287 287 PRO PRO A . n 
A 1 289 ASP 289 288 288 ASP ASP A . n 
A 1 290 ARG 290 289 289 ARG ARG A . n 
A 1 291 ILE 291 290 290 ILE ILE A . n 
A 1 292 ALA 292 291 291 ALA ALA A . n 
A 1 293 SER 293 292 292 SER SER A . n 
A 1 294 ARG 294 293 293 ARG ARG A . n 
A 1 295 ILE 295 294 294 ILE ILE A . n 
A 1 296 LEU 296 295 295 LEU LEU A . n 
A 1 297 GLY 297 296 296 GLY GLY A . n 
A 1 298 MET 298 297 ?   ?   ?   A . n 
A 1 299 GLY 299 298 ?   ?   ?   A . n 
A 1 300 ASP 300 299 ?   ?   ?   A . n 
A 1 301 HIS 301 300 ?   ?   ?   A . n 
A 1 302 HIS 302 301 ?   ?   ?   A . n 
A 1 303 HIS 303 302 ?   ?   ?   A . n 
A 1 304 HIS 304 303 ?   ?   ?   A . n 
A 1 305 HIS 305 304 ?   ?   ?   A . n 
A 1 306 HIS 306 305 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 G4P 1 401 301 G4P G4P A . 
C 3 MG  1 402 1   MG  MG  A . 
D 4 HOH 1 501 7   HOH HOH A . 
D 4 HOH 2 502 1   HOH HOH A . 
D 4 HOH 3 503 9   HOH HOH A . 
D 4 HOH 4 504 6   HOH HOH A . 
D 4 HOH 5 505 4   HOH HOH A . 
D 4 HOH 6 506 2   HOH HOH A . 
D 4 HOH 7 507 3   HOH HOH A . 
D 4 HOH 8 508 8   HOH HOH A . 
D 4 HOH 9 509 5   HOH HOH A . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLU 89 ? CG  ? A GLU 90 CG  
2 1 Y 1 A GLU 89 ? CD  ? A GLU 90 CD  
3 1 Y 1 A GLU 89 ? OE1 ? A GLU 90 OE1 
4 1 Y 1 A GLU 89 ? OE2 ? A GLU 90 OE2 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.18.2_3874: ???)' 1 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot   ? ? ? .                    2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .                    3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? .                    4 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                    5 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   96.27 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7O9G 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     48.630 
_cell.length_a_esd                 ? 
_cell.length_b                     38.200 
_cell.length_b_esd                 ? 
_cell.length_c                     78.440 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7O9G 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7O9G 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.27 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.77 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2 M ammonium acetate, 20 % (w/v) PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2019-12-10 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97626 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PETRA III, EMBL c/o DESY BEAMLINE P14 (MX2)' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97626 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   'P14 (MX2)' 
_diffrn_source.pdbx_synchrotron_site       'PETRA III, EMBL c/o DESY' 
# 
_reflns.B_iso_Wilson_estimate                          ? 
_reflns.entry_id                                       7O9G 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              2.80 
_reflns.d_resolution_low                               43.26 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     7083 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     ? 
_reflns.observed_criterion_sigma_I                     ? 
_reflns.percent_possible_obs                           97.41 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                3.4 
_reflns.pdbx_Rmerge_I_obs                              ? 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                ? 
_reflns.pdbx_netI_over_av_sigmaI                       ? 
_reflns.pdbx_netI_over_sigmaI                          32.05 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               ? 
_reflns.pdbx_scaling_rejects                           ? 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                ? 
_reflns.pdbx_Rpim_I_all                                ? 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       ? 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   0.999 
_reflns.pdbx_CC_star                                   ? 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
# 
_reflns_shell.d_res_high                                    2.803 
_reflns_shell.d_res_low                                     2.904 
_reflns_shell.meanI_over_sigI_all                           ? 
_reflns_shell.meanI_over_sigI_obs                           ? 
_reflns_shell.number_measured_all                           ? 
_reflns_shell.number_measured_obs                           ? 
_reflns_shell.number_possible                               ? 
_reflns_shell.number_unique_all                             ? 
_reflns_shell.number_unique_obs                             698 
_reflns_shell.percent_possible_all                          ? 
_reflns_shell.percent_possible_obs                          ? 
_reflns_shell.Rmerge_F_all                                  ? 
_reflns_shell.Rmerge_F_obs                                  ? 
_reflns_shell.Rmerge_I_all                                  ? 
_reflns_shell.Rmerge_I_obs                                  ? 
_reflns_shell.meanI_over_sigI_gt                            ? 
_reflns_shell.meanI_over_uI_all                             ? 
_reflns_shell.meanI_over_uI_gt                              ? 
_reflns_shell.number_measured_gt                            ? 
_reflns_shell.number_unique_gt                              ? 
_reflns_shell.percent_possible_gt                           ? 
_reflns_shell.Rmerge_F_gt                                   ? 
_reflns_shell.Rmerge_I_gt                                   ? 
_reflns_shell.pdbx_redundancy                               ? 
_reflns_shell.pdbx_Rsym_value                               ? 
_reflns_shell.pdbx_chi_squared                              ? 
_reflns_shell.pdbx_netI_over_sigmaI_all                     ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs                     ? 
_reflns_shell.pdbx_Rrim_I_all                               ? 
_reflns_shell.pdbx_Rpim_I_all                               ? 
_reflns_shell.pdbx_rejects                                  ? 
_reflns_shell.pdbx_ordinal                                  1 
_reflns_shell.pdbx_diffrn_id                                1 
_reflns_shell.pdbx_CC_half                                  0.996 
_reflns_shell.pdbx_CC_star                                  ? 
_reflns_shell.pdbx_R_split                                  ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal             ? 
_reflns_shell.pdbx_percent_possible_spherical               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous   ? 
_reflns_shell.pdbx_percent_possible_spherical_anomalous     ? 
_reflns_shell.pdbx_redundancy_anomalous                     ? 
_reflns_shell.pdbx_CC_half_anomalous                        ? 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous             ? 
_reflns_shell.pdbx_percent_possible_anomalous               ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7O9G 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.80 
_refine.ls_d_res_low                             43.26 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     7077 
_refine.ls_number_reflns_R_free                  355 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.43 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1952 
_refine.ls_R_factor_R_free                       0.2598 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1919 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.40 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3NG1 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.48 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        43.26 
_refine_hist.number_atoms_solvent             9 
_refine_hist.number_atoms_total               2283 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        2237 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         37 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.011  ? 2308 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.635  ? 3129 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 23.853 ? 316  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.066  ? 371  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.008  ? 401  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.80 3.21  . . 116 2202 97.00 . . . 0.3814 . 0.2683 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.21 4.04  . . 118 2228 98.00 . . . 0.3089 . 0.2027 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.04 43.26 . . 121 2292 97.00 . . . 0.1972 . 0.1645 . . . . . . . . . . . 
# 
_struct.entry_id                     7O9G 
_struct.title                        'Escherichia coli Ffh in complex with ppGpp' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7O9G 
_struct_keywords.text            
'stringent response, targeting complex, signal recognition particle, alarmones, stress, TRANSLATION' 
_struct_keywords.pdbx_keywords   TRANSLATION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A0A3P5DUI2_ECOLX 
_struct_ref.pdbx_db_accession          A0A3P5DUI2 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;FDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTPGQEFVKIVRNE
LVAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFFP
SDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASINPVETLFVVDAMTGQDAANTAKAFNEALP
LTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMGD
;
_struct_ref.pdbx_align_begin           2 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              7O9G 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 300 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             A0A3P5DUI2 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  299 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       299 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 7O9G MET A 1   ? UNP A0A3P5DUI2 ? ? 'initiating methionine' 0   1 
1 7O9G GLY A 2   ? UNP A0A3P5DUI2 ? ? 'expression tag'        1   2 
1 7O9G HIS A 301 ? UNP A0A3P5DUI2 ? ? 'expression tag'        300 3 
1 7O9G HIS A 302 ? UNP A0A3P5DUI2 ? ? 'expression tag'        301 4 
1 7O9G HIS A 303 ? UNP A0A3P5DUI2 ? ? 'expression tag'        302 5 
1 7O9G HIS A 304 ? UNP A0A3P5DUI2 ? ? 'expression tag'        303 6 
1 7O9G HIS A 305 ? UNP A0A3P5DUI2 ? ? 'expression tag'        304 7 
1 7O9G HIS A 306 ? UNP A0A3P5DUI2 ? ? 'expression tag'        305 8 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 900   ? 
1 MORE         -16   ? 
1 'SSA (A^2)'  13820 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 4   ? ARG A 20  ? ASP A 3   ARG A 19  1 ? 17 
HELX_P HELX_P2  AA2 THR A 24  ? ALA A 42  ? THR A 23  ALA A 41  1 ? 19 
HELX_P HELX_P3  AA3 ALA A 45  ? ALA A 60  ? ALA A 44  ALA A 59  1 ? 16 
HELX_P HELX_P4  AA4 VAL A 61  ? LYS A 67  ? VAL A 60  LYS A 66  1 ? 7  
HELX_P HELX_P5  AA5 THR A 70  ? GLY A 88  ? THR A 69  GLY A 87  1 ? 19 
HELX_P HELX_P6  AA6 GLY A 113 ? LYS A 130 ? GLY A 112 LYS A 129 1 ? 18 
HELX_P HELX_P7  AA7 ARG A 142 ? GLY A 157 ? ARG A 141 GLY A 156 1 ? 16 
HELX_P HELX_P8  AA8 LYS A 168 ? LYS A 183 ? LYS A 167 LYS A 182 1 ? 16 
HELX_P HELX_P9  AA9 ASP A 199 ? ASN A 214 ? ASP A 198 ASN A 213 1 ? 16 
HELX_P HELX_P10 AB1 GLY A 227 ? LEU A 241 ? GLY A 226 LEU A 240 1 ? 15 
HELX_P HELX_P11 AB2 LYS A 250 ? ALA A 255 ? LYS A 249 ALA A 254 1 ? 6  
HELX_P HELX_P12 AB3 GLY A 258 ? GLY A 268 ? GLY A 257 GLY A 267 1 ? 11 
HELX_P HELX_P13 AB4 HIS A 287 ? GLY A 297 ? HIS A 286 GLY A 296 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A THR 115 OG1 ? ? ? 1_555 C MG . MG ? ? A THR 114 A MG 402 1_555 ? ? ? ? ? ? ? 2.580 ? ? 
metalc2 metalc ? ? B G4P .   O2B ? ? ? 1_555 C MG . MG ? ? A G4P 401 A MG 402 1_555 ? ? ? ? ? ? ? 2.934 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_pdbx_struct_conn_angle.id                    1 
_pdbx_struct_conn_angle.ptnr1_label_atom_id   OG1 
_pdbx_struct_conn_angle.ptnr1_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr1_label_asym_id   A 
_pdbx_struct_conn_angle.ptnr1_label_comp_id   THR 
_pdbx_struct_conn_angle.ptnr1_label_seq_id    115 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id    THR 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id     114 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr1_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr2_label_atom_id   MG 
_pdbx_struct_conn_angle.ptnr2_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr2_label_asym_id   C 
_pdbx_struct_conn_angle.ptnr2_label_comp_id   MG 
_pdbx_struct_conn_angle.ptnr2_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id    MG 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id     402 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr2_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr3_label_atom_id   O2B 
_pdbx_struct_conn_angle.ptnr3_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr3_label_asym_id   B 
_pdbx_struct_conn_angle.ptnr3_label_comp_id   G4P 
_pdbx_struct_conn_angle.ptnr3_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id    G4P 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id     401 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr3_symmetry        1_555 
_pdbx_struct_conn_angle.value                 57.3 
_pdbx_struct_conn_angle.value_esd             ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          PRO 
_struct_mon_prot_cis.label_seq_id           100 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           PRO 
_struct_mon_prot_cis.auth_seq_id            99 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    101 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     100 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -7.81 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   8 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? parallel      
AA1 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ASP A 159 ? PHE A 161 ? ASP A 158 PHE A 160 
AA1 2 VAL A 133 ? SER A 137 ? VAL A 132 SER A 136 
AA1 3 VAL A 187 ? ASP A 191 ? VAL A 186 ASP A 190 
AA1 4 ALA A 102 ? ALA A 107 ? ALA A 101 ALA A 106 
AA1 5 GLU A 217 ? ASP A 223 ? GLU A 216 ASP A 222 
AA1 6 GLY A 245 ? THR A 249 ? GLY A 244 THR A 248 
AA1 7 ILE A 271 ? GLY A 275 ? ILE A 270 GLY A 274 
AA1 8 LEU A 283 ? PRO A 285 ? LEU A 282 PRO A 284 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ASP A 159 ? O ASP A 158 N VAL A 135 ? N VAL A 134 
AA1 2 3 N VAL A 136 ? N VAL A 135 O ASP A 191 ? O ASP A 190 
AA1 3 4 O LEU A 188 ? O LEU A 187 N ALA A 102 ? N ALA A 101 
AA1 4 5 N ALA A 107 ? N ALA A 106 O VAL A 221 ? O VAL A 220 
AA1 5 6 N VAL A 222 ? N VAL A 221 O VAL A 247 ? O VAL A 246 
AA1 6 7 N LEU A 248 ? N LEU A 247 O GLY A 275 ? O GLY A 274 
AA1 7 8 N LEU A 274 ? N LEU A 273 O GLU A 284 ? O GLU A 283 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              273 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              273 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CD2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              273 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                100.23 
_pdbx_validate_rmsd_angle.angle_target_value         111.00 
_pdbx_validate_rmsd_angle.angle_deviation            -10.77 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.70 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 89  ? ? 48.07   -134.73 
2 1 LEU A 195 ? ? 82.15   -11.22  
3 1 ASN A 213 ? ? 30.62   71.06   
4 1 ARG A 255 ? ? -123.94 -50.69  
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -1.6324 
_pdbx_refine_tls.origin_y         0.2404 
_pdbx_refine_tls.origin_z         18.5000 
_pdbx_refine_tls.T[1][1]          0.4616 
_pdbx_refine_tls.T[1][1]_esd      ? 
_pdbx_refine_tls.T[1][2]          0.0436 
_pdbx_refine_tls.T[1][2]_esd      ? 
_pdbx_refine_tls.T[1][3]          0.0212 
_pdbx_refine_tls.T[1][3]_esd      ? 
_pdbx_refine_tls.T[2][2]          0.4445 
_pdbx_refine_tls.T[2][2]_esd      ? 
_pdbx_refine_tls.T[2][3]          -0.0292 
_pdbx_refine_tls.T[2][3]_esd      ? 
_pdbx_refine_tls.T[3][3]          0.4077 
_pdbx_refine_tls.T[3][3]_esd      ? 
_pdbx_refine_tls.L[1][1]          1.1272 
_pdbx_refine_tls.L[1][1]_esd      ? 
_pdbx_refine_tls.L[1][2]          0.3838 
_pdbx_refine_tls.L[1][2]_esd      ? 
_pdbx_refine_tls.L[1][3]          0.9713 
_pdbx_refine_tls.L[1][3]_esd      ? 
_pdbx_refine_tls.L[2][2]          0.8143 
_pdbx_refine_tls.L[2][2]_esd      ? 
_pdbx_refine_tls.L[2][3]          0.0347 
_pdbx_refine_tls.L[2][3]_esd      ? 
_pdbx_refine_tls.L[3][3]          0.8791 
_pdbx_refine_tls.L[3][3]_esd      ? 
_pdbx_refine_tls.S[1][1]          0.0323 
_pdbx_refine_tls.S[1][1]_esd      ? 
_pdbx_refine_tls.S[1][2]          -0.0827 
_pdbx_refine_tls.S[1][2]_esd      ? 
_pdbx_refine_tls.S[1][3]          -0.1442 
_pdbx_refine_tls.S[1][3]_esd      ? 
_pdbx_refine_tls.S[2][1]          0.0354 
_pdbx_refine_tls.S[2][1]_esd      ? 
_pdbx_refine_tls.S[2][2]          0.0532 
_pdbx_refine_tls.S[2][2]_esd      ? 
_pdbx_refine_tls.S[2][3]          -0.1036 
_pdbx_refine_tls.S[2][3]_esd      ? 
_pdbx_refine_tls.S[3][1]          0.0151 
_pdbx_refine_tls.S[3][1]_esd      ? 
_pdbx_refine_tls.S[3][2]          -0.0360 
_pdbx_refine_tls.S[3][2]_esd      ? 
_pdbx_refine_tls.S[3][3]          0.0001 
_pdbx_refine_tls.S[3][3]_esd      ? 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.beg_PDB_ins_code    ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.end_PDB_ins_code    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   
;(chain 'A' and resid 3 through 296)
;
# 
_pdbx_entry_details.entry_id                 7O9G 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 0   ? A MET 1   
2  1 Y 1 A GLY 1   ? A GLY 2   
3  1 Y 1 A PHE 2   ? A PHE 3   
4  1 Y 1 A MET 297 ? A MET 298 
5  1 Y 1 A GLY 298 ? A GLY 299 
6  1 Y 1 A ASP 299 ? A ASP 300 
7  1 Y 1 A HIS 300 ? A HIS 301 
8  1 Y 1 A HIS 301 ? A HIS 302 
9  1 Y 1 A HIS 302 ? A HIS 303 
10 1 Y 1 A HIS 303 ? A HIS 304 
11 1 Y 1 A HIS 304 ? A HIS 305 
12 1 Y 1 A HIS 305 ? A HIS 306 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N      N  N N 1   
ALA CA     C  N S 2   
ALA C      C  N N 3   
ALA O      O  N N 4   
ALA CB     C  N N 5   
ALA OXT    O  N N 6   
ALA H      H  N N 7   
ALA H2     H  N N 8   
ALA HA     H  N N 9   
ALA HB1    H  N N 10  
ALA HB2    H  N N 11  
ALA HB3    H  N N 12  
ALA HXT    H  N N 13  
ARG N      N  N N 14  
ARG CA     C  N S 15  
ARG C      C  N N 16  
ARG O      O  N N 17  
ARG CB     C  N N 18  
ARG CG     C  N N 19  
ARG CD     C  N N 20  
ARG NE     N  N N 21  
ARG CZ     C  N N 22  
ARG NH1    N  N N 23  
ARG NH2    N  N N 24  
ARG OXT    O  N N 25  
ARG H      H  N N 26  
ARG H2     H  N N 27  
ARG HA     H  N N 28  
ARG HB2    H  N N 29  
ARG HB3    H  N N 30  
ARG HG2    H  N N 31  
ARG HG3    H  N N 32  
ARG HD2    H  N N 33  
ARG HD3    H  N N 34  
ARG HE     H  N N 35  
ARG HH11   H  N N 36  
ARG HH12   H  N N 37  
ARG HH21   H  N N 38  
ARG HH22   H  N N 39  
ARG HXT    H  N N 40  
ASN N      N  N N 41  
ASN CA     C  N S 42  
ASN C      C  N N 43  
ASN O      O  N N 44  
ASN CB     C  N N 45  
ASN CG     C  N N 46  
ASN OD1    O  N N 47  
ASN ND2    N  N N 48  
ASN OXT    O  N N 49  
ASN H      H  N N 50  
ASN H2     H  N N 51  
ASN HA     H  N N 52  
ASN HB2    H  N N 53  
ASN HB3    H  N N 54  
ASN HD21   H  N N 55  
ASN HD22   H  N N 56  
ASN HXT    H  N N 57  
ASP N      N  N N 58  
ASP CA     C  N S 59  
ASP C      C  N N 60  
ASP O      O  N N 61  
ASP CB     C  N N 62  
ASP CG     C  N N 63  
ASP OD1    O  N N 64  
ASP OD2    O  N N 65  
ASP OXT    O  N N 66  
ASP H      H  N N 67  
ASP H2     H  N N 68  
ASP HA     H  N N 69  
ASP HB2    H  N N 70  
ASP HB3    H  N N 71  
ASP HD2    H  N N 72  
ASP HXT    H  N N 73  
G4P PB     P  N N 74  
G4P O1B    O  N N 75  
G4P O2B    O  N N 76  
G4P O3B    O  N N 77  
G4P O3A    O  N N 78  
G4P PA     P  N S 79  
G4P O1A    O  N N 80  
G4P O2A    O  N N 81  
G4P "O5'"  O  N N 82  
G4P "C5'"  C  N N 83  
G4P "C4'"  C  N R 84  
G4P "O4'"  O  N N 85  
G4P "C3'"  C  N S 86  
G4P "O3'"  O  N N 87  
G4P "C2'"  C  N R 88  
G4P "O2'"  O  N N 89  
G4P "C1'"  C  N R 90  
G4P N9     N  Y N 91  
G4P C8     C  Y N 92  
G4P N7     N  Y N 93  
G4P C5     C  Y N 94  
G4P C6     C  N N 95  
G4P O6     O  N N 96  
G4P N1     N  N N 97  
G4P C2     C  N N 98  
G4P N2     N  N N 99  
G4P N3     N  N N 100 
G4P C4     C  Y N 101 
G4P PC     P  N S 102 
G4P O1C    O  N N 103 
G4P O2C    O  N N 104 
G4P O3C    O  N N 105 
G4P PD     P  N N 106 
G4P O1D    O  N N 107 
G4P O2D    O  N N 108 
G4P O3D    O  N N 109 
G4P HOB2   H  N N 110 
G4P HOB3   H  N N 111 
G4P HOA2   H  N N 112 
G4P "H5'"  H  N N 113 
G4P "H5''" H  N N 114 
G4P "H4'"  H  N N 115 
G4P "H3'"  H  N N 116 
G4P "H2'"  H  N N 117 
G4P "HO2'" H  N N 118 
G4P "H1'"  H  N N 119 
G4P H8     H  N N 120 
G4P HN1    H  N N 121 
G4P HN21   H  N N 122 
G4P HN22   H  N N 123 
G4P H2C    H  N N 124 
G4P H2D    H  N N 125 
G4P H3D    H  N N 126 
GLN N      N  N N 127 
GLN CA     C  N S 128 
GLN C      C  N N 129 
GLN O      O  N N 130 
GLN CB     C  N N 131 
GLN CG     C  N N 132 
GLN CD     C  N N 133 
GLN OE1    O  N N 134 
GLN NE2    N  N N 135 
GLN OXT    O  N N 136 
GLN H      H  N N 137 
GLN H2     H  N N 138 
GLN HA     H  N N 139 
GLN HB2    H  N N 140 
GLN HB3    H  N N 141 
GLN HG2    H  N N 142 
GLN HG3    H  N N 143 
GLN HE21   H  N N 144 
GLN HE22   H  N N 145 
GLN HXT    H  N N 146 
GLU N      N  N N 147 
GLU CA     C  N S 148 
GLU C      C  N N 149 
GLU O      O  N N 150 
GLU CB     C  N N 151 
GLU CG     C  N N 152 
GLU CD     C  N N 153 
GLU OE1    O  N N 154 
GLU OE2    O  N N 155 
GLU OXT    O  N N 156 
GLU H      H  N N 157 
GLU H2     H  N N 158 
GLU HA     H  N N 159 
GLU HB2    H  N N 160 
GLU HB3    H  N N 161 
GLU HG2    H  N N 162 
GLU HG3    H  N N 163 
GLU HE2    H  N N 164 
GLU HXT    H  N N 165 
GLY N      N  N N 166 
GLY CA     C  N N 167 
GLY C      C  N N 168 
GLY O      O  N N 169 
GLY OXT    O  N N 170 
GLY H      H  N N 171 
GLY H2     H  N N 172 
GLY HA2    H  N N 173 
GLY HA3    H  N N 174 
GLY HXT    H  N N 175 
HIS N      N  N N 176 
HIS CA     C  N S 177 
HIS C      C  N N 178 
HIS O      O  N N 179 
HIS CB     C  N N 180 
HIS CG     C  Y N 181 
HIS ND1    N  Y N 182 
HIS CD2    C  Y N 183 
HIS CE1    C  Y N 184 
HIS NE2    N  Y N 185 
HIS OXT    O  N N 186 
HIS H      H  N N 187 
HIS H2     H  N N 188 
HIS HA     H  N N 189 
HIS HB2    H  N N 190 
HIS HB3    H  N N 191 
HIS HD1    H  N N 192 
HIS HD2    H  N N 193 
HIS HE1    H  N N 194 
HIS HE2    H  N N 195 
HIS HXT    H  N N 196 
HOH O      O  N N 197 
HOH H1     H  N N 198 
HOH H2     H  N N 199 
ILE N      N  N N 200 
ILE CA     C  N S 201 
ILE C      C  N N 202 
ILE O      O  N N 203 
ILE CB     C  N S 204 
ILE CG1    C  N N 205 
ILE CG2    C  N N 206 
ILE CD1    C  N N 207 
ILE OXT    O  N N 208 
ILE H      H  N N 209 
ILE H2     H  N N 210 
ILE HA     H  N N 211 
ILE HB     H  N N 212 
ILE HG12   H  N N 213 
ILE HG13   H  N N 214 
ILE HG21   H  N N 215 
ILE HG22   H  N N 216 
ILE HG23   H  N N 217 
ILE HD11   H  N N 218 
ILE HD12   H  N N 219 
ILE HD13   H  N N 220 
ILE HXT    H  N N 221 
LEU N      N  N N 222 
LEU CA     C  N S 223 
LEU C      C  N N 224 
LEU O      O  N N 225 
LEU CB     C  N N 226 
LEU CG     C  N N 227 
LEU CD1    C  N N 228 
LEU CD2    C  N N 229 
LEU OXT    O  N N 230 
LEU H      H  N N 231 
LEU H2     H  N N 232 
LEU HA     H  N N 233 
LEU HB2    H  N N 234 
LEU HB3    H  N N 235 
LEU HG     H  N N 236 
LEU HD11   H  N N 237 
LEU HD12   H  N N 238 
LEU HD13   H  N N 239 
LEU HD21   H  N N 240 
LEU HD22   H  N N 241 
LEU HD23   H  N N 242 
LEU HXT    H  N N 243 
LYS N      N  N N 244 
LYS CA     C  N S 245 
LYS C      C  N N 246 
LYS O      O  N N 247 
LYS CB     C  N N 248 
LYS CG     C  N N 249 
LYS CD     C  N N 250 
LYS CE     C  N N 251 
LYS NZ     N  N N 252 
LYS OXT    O  N N 253 
LYS H      H  N N 254 
LYS H2     H  N N 255 
LYS HA     H  N N 256 
LYS HB2    H  N N 257 
LYS HB3    H  N N 258 
LYS HG2    H  N N 259 
LYS HG3    H  N N 260 
LYS HD2    H  N N 261 
LYS HD3    H  N N 262 
LYS HE2    H  N N 263 
LYS HE3    H  N N 264 
LYS HZ1    H  N N 265 
LYS HZ2    H  N N 266 
LYS HZ3    H  N N 267 
LYS HXT    H  N N 268 
MET N      N  N N 269 
MET CA     C  N S 270 
MET C      C  N N 271 
MET O      O  N N 272 
MET CB     C  N N 273 
MET CG     C  N N 274 
MET SD     S  N N 275 
MET CE     C  N N 276 
MET OXT    O  N N 277 
MET H      H  N N 278 
MET H2     H  N N 279 
MET HA     H  N N 280 
MET HB2    H  N N 281 
MET HB3    H  N N 282 
MET HG2    H  N N 283 
MET HG3    H  N N 284 
MET HE1    H  N N 285 
MET HE2    H  N N 286 
MET HE3    H  N N 287 
MET HXT    H  N N 288 
MG  MG     MG N N 289 
PHE N      N  N N 290 
PHE CA     C  N S 291 
PHE C      C  N N 292 
PHE O      O  N N 293 
PHE CB     C  N N 294 
PHE CG     C  Y N 295 
PHE CD1    C  Y N 296 
PHE CD2    C  Y N 297 
PHE CE1    C  Y N 298 
PHE CE2    C  Y N 299 
PHE CZ     C  Y N 300 
PHE OXT    O  N N 301 
PHE H      H  N N 302 
PHE H2     H  N N 303 
PHE HA     H  N N 304 
PHE HB2    H  N N 305 
PHE HB3    H  N N 306 
PHE HD1    H  N N 307 
PHE HD2    H  N N 308 
PHE HE1    H  N N 309 
PHE HE2    H  N N 310 
PHE HZ     H  N N 311 
PHE HXT    H  N N 312 
PRO N      N  N N 313 
PRO CA     C  N S 314 
PRO C      C  N N 315 
PRO O      O  N N 316 
PRO CB     C  N N 317 
PRO CG     C  N N 318 
PRO CD     C  N N 319 
PRO OXT    O  N N 320 
PRO H      H  N N 321 
PRO HA     H  N N 322 
PRO HB2    H  N N 323 
PRO HB3    H  N N 324 
PRO HG2    H  N N 325 
PRO HG3    H  N N 326 
PRO HD2    H  N N 327 
PRO HD3    H  N N 328 
PRO HXT    H  N N 329 
SER N      N  N N 330 
SER CA     C  N S 331 
SER C      C  N N 332 
SER O      O  N N 333 
SER CB     C  N N 334 
SER OG     O  N N 335 
SER OXT    O  N N 336 
SER H      H  N N 337 
SER H2     H  N N 338 
SER HA     H  N N 339 
SER HB2    H  N N 340 
SER HB3    H  N N 341 
SER HG     H  N N 342 
SER HXT    H  N N 343 
THR N      N  N N 344 
THR CA     C  N S 345 
THR C      C  N N 346 
THR O      O  N N 347 
THR CB     C  N R 348 
THR OG1    O  N N 349 
THR CG2    C  N N 350 
THR OXT    O  N N 351 
THR H      H  N N 352 
THR H2     H  N N 353 
THR HA     H  N N 354 
THR HB     H  N N 355 
THR HG1    H  N N 356 
THR HG21   H  N N 357 
THR HG22   H  N N 358 
THR HG23   H  N N 359 
THR HXT    H  N N 360 
TYR N      N  N N 361 
TYR CA     C  N S 362 
TYR C      C  N N 363 
TYR O      O  N N 364 
TYR CB     C  N N 365 
TYR CG     C  Y N 366 
TYR CD1    C  Y N 367 
TYR CD2    C  Y N 368 
TYR CE1    C  Y N 369 
TYR CE2    C  Y N 370 
TYR CZ     C  Y N 371 
TYR OH     O  N N 372 
TYR OXT    O  N N 373 
TYR H      H  N N 374 
TYR H2     H  N N 375 
TYR HA     H  N N 376 
TYR HB2    H  N N 377 
TYR HB3    H  N N 378 
TYR HD1    H  N N 379 
TYR HD2    H  N N 380 
TYR HE1    H  N N 381 
TYR HE2    H  N N 382 
TYR HH     H  N N 383 
TYR HXT    H  N N 384 
VAL N      N  N N 385 
VAL CA     C  N S 386 
VAL C      C  N N 387 
VAL O      O  N N 388 
VAL CB     C  N N 389 
VAL CG1    C  N N 390 
VAL CG2    C  N N 391 
VAL OXT    O  N N 392 
VAL H      H  N N 393 
VAL H2     H  N N 394 
VAL HA     H  N N 395 
VAL HB     H  N N 396 
VAL HG11   H  N N 397 
VAL HG12   H  N N 398 
VAL HG13   H  N N 399 
VAL HG21   H  N N 400 
VAL HG22   H  N N 401 
VAL HG23   H  N N 402 
VAL HXT    H  N N 403 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N     CA     sing N N 1   
ALA N     H      sing N N 2   
ALA N     H2     sing N N 3   
ALA CA    C      sing N N 4   
ALA CA    CB     sing N N 5   
ALA CA    HA     sing N N 6   
ALA C     O      doub N N 7   
ALA C     OXT    sing N N 8   
ALA CB    HB1    sing N N 9   
ALA CB    HB2    sing N N 10  
ALA CB    HB3    sing N N 11  
ALA OXT   HXT    sing N N 12  
ARG N     CA     sing N N 13  
ARG N     H      sing N N 14  
ARG N     H2     sing N N 15  
ARG CA    C      sing N N 16  
ARG CA    CB     sing N N 17  
ARG CA    HA     sing N N 18  
ARG C     O      doub N N 19  
ARG C     OXT    sing N N 20  
ARG CB    CG     sing N N 21  
ARG CB    HB2    sing N N 22  
ARG CB    HB3    sing N N 23  
ARG CG    CD     sing N N 24  
ARG CG    HG2    sing N N 25  
ARG CG    HG3    sing N N 26  
ARG CD    NE     sing N N 27  
ARG CD    HD2    sing N N 28  
ARG CD    HD3    sing N N 29  
ARG NE    CZ     sing N N 30  
ARG NE    HE     sing N N 31  
ARG CZ    NH1    sing N N 32  
ARG CZ    NH2    doub N N 33  
ARG NH1   HH11   sing N N 34  
ARG NH1   HH12   sing N N 35  
ARG NH2   HH21   sing N N 36  
ARG NH2   HH22   sing N N 37  
ARG OXT   HXT    sing N N 38  
ASN N     CA     sing N N 39  
ASN N     H      sing N N 40  
ASN N     H2     sing N N 41  
ASN CA    C      sing N N 42  
ASN CA    CB     sing N N 43  
ASN CA    HA     sing N N 44  
ASN C     O      doub N N 45  
ASN C     OXT    sing N N 46  
ASN CB    CG     sing N N 47  
ASN CB    HB2    sing N N 48  
ASN CB    HB3    sing N N 49  
ASN CG    OD1    doub N N 50  
ASN CG    ND2    sing N N 51  
ASN ND2   HD21   sing N N 52  
ASN ND2   HD22   sing N N 53  
ASN OXT   HXT    sing N N 54  
ASP N     CA     sing N N 55  
ASP N     H      sing N N 56  
ASP N     H2     sing N N 57  
ASP CA    C      sing N N 58  
ASP CA    CB     sing N N 59  
ASP CA    HA     sing N N 60  
ASP C     O      doub N N 61  
ASP C     OXT    sing N N 62  
ASP CB    CG     sing N N 63  
ASP CB    HB2    sing N N 64  
ASP CB    HB3    sing N N 65  
ASP CG    OD1    doub N N 66  
ASP CG    OD2    sing N N 67  
ASP OD2   HD2    sing N N 68  
ASP OXT   HXT    sing N N 69  
G4P PB    O1B    doub N N 70  
G4P PB    O2B    sing N N 71  
G4P PB    O3B    sing N N 72  
G4P PB    O3A    sing N N 73  
G4P O2B   HOB2   sing N N 74  
G4P O3B   HOB3   sing N N 75  
G4P O3A   PA     sing N N 76  
G4P PA    O1A    doub N N 77  
G4P PA    O2A    sing N N 78  
G4P PA    "O5'"  sing N N 79  
G4P O2A   HOA2   sing N N 80  
G4P "O5'" "C5'"  sing N N 81  
G4P "C5'" "C4'"  sing N N 82  
G4P "C5'" "H5'"  sing N N 83  
G4P "C5'" "H5''" sing N N 84  
G4P "C4'" "O4'"  sing N N 85  
G4P "C4'" "C3'"  sing N N 86  
G4P "C4'" "H4'"  sing N N 87  
G4P "O4'" "C1'"  sing N N 88  
G4P "C3'" "O3'"  sing N N 89  
G4P "C3'" "C2'"  sing N N 90  
G4P "C3'" "H3'"  sing N N 91  
G4P "O3'" PC     sing N N 92  
G4P "C2'" "O2'"  sing N N 93  
G4P "C2'" "C1'"  sing N N 94  
G4P "C2'" "H2'"  sing N N 95  
G4P "O2'" "HO2'" sing N N 96  
G4P "C1'" N9     sing N N 97  
G4P "C1'" "H1'"  sing N N 98  
G4P N9    C8     sing Y N 99  
G4P N9    C4     sing Y N 100 
G4P C8    N7     doub Y N 101 
G4P C8    H8     sing N N 102 
G4P N7    C5     sing Y N 103 
G4P C5    C6     sing N N 104 
G4P C5    C4     doub Y N 105 
G4P C6    O6     doub N N 106 
G4P C6    N1     sing N N 107 
G4P N1    C2     sing N N 108 
G4P N1    HN1    sing N N 109 
G4P C2    N2     sing N N 110 
G4P C2    N3     doub N N 111 
G4P N2    HN21   sing N N 112 
G4P N2    HN22   sing N N 113 
G4P N3    C4     sing N N 114 
G4P PC    O1C    doub N N 115 
G4P PC    O2C    sing N N 116 
G4P PC    O3C    sing N N 117 
G4P O2C   H2C    sing N N 118 
G4P O3C   PD     sing N N 119 
G4P PD    O1D    doub N N 120 
G4P PD    O2D    sing N N 121 
G4P PD    O3D    sing N N 122 
G4P O2D   H2D    sing N N 123 
G4P O3D   H3D    sing N N 124 
GLN N     CA     sing N N 125 
GLN N     H      sing N N 126 
GLN N     H2     sing N N 127 
GLN CA    C      sing N N 128 
GLN CA    CB     sing N N 129 
GLN CA    HA     sing N N 130 
GLN C     O      doub N N 131 
GLN C     OXT    sing N N 132 
GLN CB    CG     sing N N 133 
GLN CB    HB2    sing N N 134 
GLN CB    HB3    sing N N 135 
GLN CG    CD     sing N N 136 
GLN CG    HG2    sing N N 137 
GLN CG    HG3    sing N N 138 
GLN CD    OE1    doub N N 139 
GLN CD    NE2    sing N N 140 
GLN NE2   HE21   sing N N 141 
GLN NE2   HE22   sing N N 142 
GLN OXT   HXT    sing N N 143 
GLU N     CA     sing N N 144 
GLU N     H      sing N N 145 
GLU N     H2     sing N N 146 
GLU CA    C      sing N N 147 
GLU CA    CB     sing N N 148 
GLU CA    HA     sing N N 149 
GLU C     O      doub N N 150 
GLU C     OXT    sing N N 151 
GLU CB    CG     sing N N 152 
GLU CB    HB2    sing N N 153 
GLU CB    HB3    sing N N 154 
GLU CG    CD     sing N N 155 
GLU CG    HG2    sing N N 156 
GLU CG    HG3    sing N N 157 
GLU CD    OE1    doub N N 158 
GLU CD    OE2    sing N N 159 
GLU OE2   HE2    sing N N 160 
GLU OXT   HXT    sing N N 161 
GLY N     CA     sing N N 162 
GLY N     H      sing N N 163 
GLY N     H2     sing N N 164 
GLY CA    C      sing N N 165 
GLY CA    HA2    sing N N 166 
GLY CA    HA3    sing N N 167 
GLY C     O      doub N N 168 
GLY C     OXT    sing N N 169 
GLY OXT   HXT    sing N N 170 
HIS N     CA     sing N N 171 
HIS N     H      sing N N 172 
HIS N     H2     sing N N 173 
HIS CA    C      sing N N 174 
HIS CA    CB     sing N N 175 
HIS CA    HA     sing N N 176 
HIS C     O      doub N N 177 
HIS C     OXT    sing N N 178 
HIS CB    CG     sing N N 179 
HIS CB    HB2    sing N N 180 
HIS CB    HB3    sing N N 181 
HIS CG    ND1    sing Y N 182 
HIS CG    CD2    doub Y N 183 
HIS ND1   CE1    doub Y N 184 
HIS ND1   HD1    sing N N 185 
HIS CD2   NE2    sing Y N 186 
HIS CD2   HD2    sing N N 187 
HIS CE1   NE2    sing Y N 188 
HIS CE1   HE1    sing N N 189 
HIS NE2   HE2    sing N N 190 
HIS OXT   HXT    sing N N 191 
HOH O     H1     sing N N 192 
HOH O     H2     sing N N 193 
ILE N     CA     sing N N 194 
ILE N     H      sing N N 195 
ILE N     H2     sing N N 196 
ILE CA    C      sing N N 197 
ILE CA    CB     sing N N 198 
ILE CA    HA     sing N N 199 
ILE C     O      doub N N 200 
ILE C     OXT    sing N N 201 
ILE CB    CG1    sing N N 202 
ILE CB    CG2    sing N N 203 
ILE CB    HB     sing N N 204 
ILE CG1   CD1    sing N N 205 
ILE CG1   HG12   sing N N 206 
ILE CG1   HG13   sing N N 207 
ILE CG2   HG21   sing N N 208 
ILE CG2   HG22   sing N N 209 
ILE CG2   HG23   sing N N 210 
ILE CD1   HD11   sing N N 211 
ILE CD1   HD12   sing N N 212 
ILE CD1   HD13   sing N N 213 
ILE OXT   HXT    sing N N 214 
LEU N     CA     sing N N 215 
LEU N     H      sing N N 216 
LEU N     H2     sing N N 217 
LEU CA    C      sing N N 218 
LEU CA    CB     sing N N 219 
LEU CA    HA     sing N N 220 
LEU C     O      doub N N 221 
LEU C     OXT    sing N N 222 
LEU CB    CG     sing N N 223 
LEU CB    HB2    sing N N 224 
LEU CB    HB3    sing N N 225 
LEU CG    CD1    sing N N 226 
LEU CG    CD2    sing N N 227 
LEU CG    HG     sing N N 228 
LEU CD1   HD11   sing N N 229 
LEU CD1   HD12   sing N N 230 
LEU CD1   HD13   sing N N 231 
LEU CD2   HD21   sing N N 232 
LEU CD2   HD22   sing N N 233 
LEU CD2   HD23   sing N N 234 
LEU OXT   HXT    sing N N 235 
LYS N     CA     sing N N 236 
LYS N     H      sing N N 237 
LYS N     H2     sing N N 238 
LYS CA    C      sing N N 239 
LYS CA    CB     sing N N 240 
LYS CA    HA     sing N N 241 
LYS C     O      doub N N 242 
LYS C     OXT    sing N N 243 
LYS CB    CG     sing N N 244 
LYS CB    HB2    sing N N 245 
LYS CB    HB3    sing N N 246 
LYS CG    CD     sing N N 247 
LYS CG    HG2    sing N N 248 
LYS CG    HG3    sing N N 249 
LYS CD    CE     sing N N 250 
LYS CD    HD2    sing N N 251 
LYS CD    HD3    sing N N 252 
LYS CE    NZ     sing N N 253 
LYS CE    HE2    sing N N 254 
LYS CE    HE3    sing N N 255 
LYS NZ    HZ1    sing N N 256 
LYS NZ    HZ2    sing N N 257 
LYS NZ    HZ3    sing N N 258 
LYS OXT   HXT    sing N N 259 
MET N     CA     sing N N 260 
MET N     H      sing N N 261 
MET N     H2     sing N N 262 
MET CA    C      sing N N 263 
MET CA    CB     sing N N 264 
MET CA    HA     sing N N 265 
MET C     O      doub N N 266 
MET C     OXT    sing N N 267 
MET CB    CG     sing N N 268 
MET CB    HB2    sing N N 269 
MET CB    HB3    sing N N 270 
MET CG    SD     sing N N 271 
MET CG    HG2    sing N N 272 
MET CG    HG3    sing N N 273 
MET SD    CE     sing N N 274 
MET CE    HE1    sing N N 275 
MET CE    HE2    sing N N 276 
MET CE    HE3    sing N N 277 
MET OXT   HXT    sing N N 278 
PHE N     CA     sing N N 279 
PHE N     H      sing N N 280 
PHE N     H2     sing N N 281 
PHE CA    C      sing N N 282 
PHE CA    CB     sing N N 283 
PHE CA    HA     sing N N 284 
PHE C     O      doub N N 285 
PHE C     OXT    sing N N 286 
PHE CB    CG     sing N N 287 
PHE CB    HB2    sing N N 288 
PHE CB    HB3    sing N N 289 
PHE CG    CD1    doub Y N 290 
PHE CG    CD2    sing Y N 291 
PHE CD1   CE1    sing Y N 292 
PHE CD1   HD1    sing N N 293 
PHE CD2   CE2    doub Y N 294 
PHE CD2   HD2    sing N N 295 
PHE CE1   CZ     doub Y N 296 
PHE CE1   HE1    sing N N 297 
PHE CE2   CZ     sing Y N 298 
PHE CE2   HE2    sing N N 299 
PHE CZ    HZ     sing N N 300 
PHE OXT   HXT    sing N N 301 
PRO N     CA     sing N N 302 
PRO N     CD     sing N N 303 
PRO N     H      sing N N 304 
PRO CA    C      sing N N 305 
PRO CA    CB     sing N N 306 
PRO CA    HA     sing N N 307 
PRO C     O      doub N N 308 
PRO C     OXT    sing N N 309 
PRO CB    CG     sing N N 310 
PRO CB    HB2    sing N N 311 
PRO CB    HB3    sing N N 312 
PRO CG    CD     sing N N 313 
PRO CG    HG2    sing N N 314 
PRO CG    HG3    sing N N 315 
PRO CD    HD2    sing N N 316 
PRO CD    HD3    sing N N 317 
PRO OXT   HXT    sing N N 318 
SER N     CA     sing N N 319 
SER N     H      sing N N 320 
SER N     H2     sing N N 321 
SER CA    C      sing N N 322 
SER CA    CB     sing N N 323 
SER CA    HA     sing N N 324 
SER C     O      doub N N 325 
SER C     OXT    sing N N 326 
SER CB    OG     sing N N 327 
SER CB    HB2    sing N N 328 
SER CB    HB3    sing N N 329 
SER OG    HG     sing N N 330 
SER OXT   HXT    sing N N 331 
THR N     CA     sing N N 332 
THR N     H      sing N N 333 
THR N     H2     sing N N 334 
THR CA    C      sing N N 335 
THR CA    CB     sing N N 336 
THR CA    HA     sing N N 337 
THR C     O      doub N N 338 
THR C     OXT    sing N N 339 
THR CB    OG1    sing N N 340 
THR CB    CG2    sing N N 341 
THR CB    HB     sing N N 342 
THR OG1   HG1    sing N N 343 
THR CG2   HG21   sing N N 344 
THR CG2   HG22   sing N N 345 
THR CG2   HG23   sing N N 346 
THR OXT   HXT    sing N N 347 
TYR N     CA     sing N N 348 
TYR N     H      sing N N 349 
TYR N     H2     sing N N 350 
TYR CA    C      sing N N 351 
TYR CA    CB     sing N N 352 
TYR CA    HA     sing N N 353 
TYR C     O      doub N N 354 
TYR C     OXT    sing N N 355 
TYR CB    CG     sing N N 356 
TYR CB    HB2    sing N N 357 
TYR CB    HB3    sing N N 358 
TYR CG    CD1    doub Y N 359 
TYR CG    CD2    sing Y N 360 
TYR CD1   CE1    sing Y N 361 
TYR CD1   HD1    sing N N 362 
TYR CD2   CE2    doub Y N 363 
TYR CD2   HD2    sing N N 364 
TYR CE1   CZ     doub Y N 365 
TYR CE1   HE1    sing N N 366 
TYR CE2   CZ     sing Y N 367 
TYR CE2   HE2    sing N N 368 
TYR CZ    OH     sing N N 369 
TYR OH    HH     sing N N 370 
TYR OXT   HXT    sing N N 371 
VAL N     CA     sing N N 372 
VAL N     H      sing N N 373 
VAL N     H2     sing N N 374 
VAL CA    C      sing N N 375 
VAL CA    CB     sing N N 376 
VAL CA    HA     sing N N 377 
VAL C     O      doub N N 378 
VAL C     OXT    sing N N 379 
VAL CB    CG1    sing N N 380 
VAL CB    CG2    sing N N 381 
VAL CB    HB     sing N N 382 
VAL CG1   HG11   sing N N 383 
VAL CG1   HG12   sing N N 384 
VAL CG1   HG13   sing N N 385 
VAL CG2   HG21   sing N N 386 
VAL CG2   HG22   sing N N 387 
VAL CG2   HG23   sing N N 388 
VAL OXT   HXT    sing N N 389 
# 
_pdbx_audit_support.funding_organization   'German Research Foundation (DFG)' 
_pdbx_audit_support.country                Germany 
_pdbx_audit_support.grant_number           SPP1879 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        G4P 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   G4P 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   3NG1 
_pdbx_initial_refinement_model.details          ? 
# 
_atom_sites.entry_id                    7O9G 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.020563 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002260 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.026178 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012825 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
H  
MG 
N  
O  
P  
S  
# 
loop_