data_7OBX # _entry.id 7OBX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7OBX pdb_00007obx 10.2210/pdb7obx/pdb WWPDB D_1292115442 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-05-04 2 'Structure model' 1 1 2023-06-07 3 'Structure model' 1 2 2024-02-07 4 'Structure model' 1 3 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7OBX _pdbx_database_status.recvd_initial_deposition_date 2021-04-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Centorrino, F.' 1 ? 'Andlovic, B.' 2 ? 'Ottmann, C.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Cell Chem Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2451-9456 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'IFN alpha primes cancer cells for Fusicoccin-induced cell death via 14-3-3 PPI stabilization.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.chembiol.2023.04.005 _citation.pdbx_database_id_PubMed 37130519 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Andlovic, B.' 1 ? primary 'Heilmann, G.' 2 ? primary 'Ninck, S.' 3 ? primary 'Andrei, S.A.' 4 ? primary 'Centorrino, F.' 5 ? primary 'Higuchi, Y.' 6 ? primary 'Kato, N.' 7 ? primary 'Brunsveld, L.' 8 ? primary 'Arkin, M.' 9 ? primary 'Menninger, S.' 10 ? primary 'Choidas, A.' 11 ? primary 'Wolf, A.' 12 ? primary 'Klebl, B.' 13 ? primary 'Kaschani, F.' 14 ? primary 'Kaiser, M.' 15 ? primary 'Eickhoff, J.' 16 ? primary 'Ottmann, C.' 17 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '14-3-3 protein sigma' 28226.518 1 ? ? ? ? 2 polymer syn 'SSBP4 phosphopeptide' 1268.308 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 water nat water 18.015 443 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Epithelial cell marker protein 1,Stratifin' 2 'Single-stranded DNA-binding protein 4' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELS(CSO)EERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNE EGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAY QEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ADNAGEEGGEAPQEPQS ; ;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM DISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNA GEEGGEAPQEPQS ; A ? 2 'polypeptide(L)' no yes 'ESYSPGMTM(SEP)V' ESYSPGMTMSV B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'MAGNESIUM ION' MG 4 'CHLORIDE ION' CL 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 GLU n 1 8 ARG n 1 9 ALA n 1 10 SER n 1 11 LEU n 1 12 ILE n 1 13 GLN n 1 14 LYS n 1 15 ALA n 1 16 LYS n 1 17 LEU n 1 18 ALA n 1 19 GLU n 1 20 GLN n 1 21 ALA n 1 22 GLU n 1 23 ARG n 1 24 TYR n 1 25 GLU n 1 26 ASP n 1 27 MET n 1 28 ALA n 1 29 ALA n 1 30 PHE n 1 31 MET n 1 32 LYS n 1 33 GLY n 1 34 ALA n 1 35 VAL n 1 36 GLU n 1 37 LYS n 1 38 GLY n 1 39 GLU n 1 40 GLU n 1 41 LEU n 1 42 SER n 1 43 CSO n 1 44 GLU n 1 45 GLU n 1 46 ARG n 1 47 ASN n 1 48 LEU n 1 49 LEU n 1 50 SER n 1 51 VAL n 1 52 ALA n 1 53 TYR n 1 54 LYS n 1 55 ASN n 1 56 VAL n 1 57 VAL n 1 58 GLY n 1 59 GLY n 1 60 GLN n 1 61 ARG n 1 62 ALA n 1 63 ALA n 1 64 TRP n 1 65 ARG n 1 66 VAL n 1 67 LEU n 1 68 SER n 1 69 SER n 1 70 ILE n 1 71 GLU n 1 72 GLN n 1 73 LYS n 1 74 SER n 1 75 ASN n 1 76 GLU n 1 77 GLU n 1 78 GLY n 1 79 SER n 1 80 GLU n 1 81 GLU n 1 82 LYS n 1 83 GLY n 1 84 PRO n 1 85 GLU n 1 86 VAL n 1 87 ARG n 1 88 GLU n 1 89 TYR n 1 90 ARG n 1 91 GLU n 1 92 LYS n 1 93 VAL n 1 94 GLU n 1 95 THR n 1 96 GLU n 1 97 LEU n 1 98 GLN n 1 99 GLY n 1 100 VAL n 1 101 CYS n 1 102 ASP n 1 103 THR n 1 104 VAL n 1 105 LEU n 1 106 GLY n 1 107 LEU n 1 108 LEU n 1 109 ASP n 1 110 SER n 1 111 HIS n 1 112 LEU n 1 113 ILE n 1 114 LYS n 1 115 GLU n 1 116 ALA n 1 117 GLY n 1 118 ASP n 1 119 ALA n 1 120 GLU n 1 121 SER n 1 122 ARG n 1 123 VAL n 1 124 PHE n 1 125 TYR n 1 126 LEU n 1 127 LYS n 1 128 MET n 1 129 LYS n 1 130 GLY n 1 131 ASP n 1 132 TYR n 1 133 TYR n 1 134 ARG n 1 135 TYR n 1 136 LEU n 1 137 ALA n 1 138 GLU n 1 139 VAL n 1 140 ALA n 1 141 THR n 1 142 GLY n 1 143 ASP n 1 144 ASP n 1 145 LYS n 1 146 LYS n 1 147 ARG n 1 148 ILE n 1 149 ILE n 1 150 ASP n 1 151 SER n 1 152 ALA n 1 153 ARG n 1 154 SER n 1 155 ALA n 1 156 TYR n 1 157 GLN n 1 158 GLU n 1 159 ALA n 1 160 MET n 1 161 ASP n 1 162 ILE n 1 163 SER n 1 164 LYS n 1 165 LYS n 1 166 GLU n 1 167 MET n 1 168 PRO n 1 169 PRO n 1 170 THR n 1 171 ASN n 1 172 PRO n 1 173 ILE n 1 174 ARG n 1 175 LEU n 1 176 GLY n 1 177 LEU n 1 178 ALA n 1 179 LEU n 1 180 ASN n 1 181 PHE n 1 182 SER n 1 183 VAL n 1 184 PHE n 1 185 HIS n 1 186 TYR n 1 187 GLU n 1 188 ILE n 1 189 ALA n 1 190 ASN n 1 191 SER n 1 192 PRO n 1 193 GLU n 1 194 GLU n 1 195 ALA n 1 196 ILE n 1 197 SER n 1 198 LEU n 1 199 ALA n 1 200 LYS n 1 201 THR n 1 202 THR n 1 203 PHE n 1 204 ASP n 1 205 GLU n 1 206 ALA n 1 207 MET n 1 208 ALA n 1 209 ASP n 1 210 LEU n 1 211 HIS n 1 212 THR n 1 213 LEU n 1 214 SER n 1 215 GLU n 1 216 ASP n 1 217 SER n 1 218 TYR n 1 219 LYS n 1 220 ASP n 1 221 SER n 1 222 THR n 1 223 LEU n 1 224 ILE n 1 225 MET n 1 226 GLN n 1 227 LEU n 1 228 LEU n 1 229 ARG n 1 230 ASP n 1 231 ASN n 1 232 LEU n 1 233 THR n 1 234 LEU n 1 235 TRP n 1 236 THR n 1 237 ALA n 1 238 ASP n 1 239 ASN n 1 240 ALA n 1 241 GLY n 1 242 GLU n 1 243 GLU n 1 244 GLY n 1 245 GLY n 1 246 GLU n 1 247 ALA n 1 248 PRO n 1 249 GLN n 1 250 GLU n 1 251 PRO n 1 252 GLN n 1 253 SER n 2 1 GLU n 2 2 SER n 2 3 TYR n 2 4 SER n 2 5 PRO n 2 6 GLY n 2 7 MET n 2 8 THR n 2 9 MET n 2 10 SEP n 2 11 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 253 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SFN, HME1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 11 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S' 137.158 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 -4 GLY GLY A . n A 1 2 ALA 2 -3 -3 ALA ALA A . n A 1 3 MET 3 -2 -2 MET MET A . n A 1 4 GLY 4 -1 -1 GLY GLY A . n A 1 5 SER 5 0 0 SER SER A . n A 1 6 MET 6 1 1 MET MET A . n A 1 7 GLU 7 2 2 GLU GLU A . n A 1 8 ARG 8 3 3 ARG ARG A . n A 1 9 ALA 9 4 4 ALA ALA A . n A 1 10 SER 10 5 5 SER SER A . n A 1 11 LEU 11 6 6 LEU LEU A . n A 1 12 ILE 12 7 7 ILE ILE A . n A 1 13 GLN 13 8 8 GLN GLN A . n A 1 14 LYS 14 9 9 LYS LYS A . n A 1 15 ALA 15 10 10 ALA ALA A . n A 1 16 LYS 16 11 11 LYS LYS A . n A 1 17 LEU 17 12 12 LEU LEU A . n A 1 18 ALA 18 13 13 ALA ALA A . n A 1 19 GLU 19 14 14 GLU GLU A . n A 1 20 GLN 20 15 15 GLN GLN A . n A 1 21 ALA 21 16 16 ALA ALA A . n A 1 22 GLU 22 17 17 GLU GLU A . n A 1 23 ARG 23 18 18 ARG ARG A . n A 1 24 TYR 24 19 19 TYR TYR A . n A 1 25 GLU 25 20 20 GLU GLU A . n A 1 26 ASP 26 21 21 ASP ASP A . n A 1 27 MET 27 22 22 MET MET A . n A 1 28 ALA 28 23 23 ALA ALA A . n A 1 29 ALA 29 24 24 ALA ALA A . n A 1 30 PHE 30 25 25 PHE PHE A . n A 1 31 MET 31 26 26 MET MET A . n A 1 32 LYS 32 27 27 LYS LYS A . n A 1 33 GLY 33 28 28 GLY GLY A . n A 1 34 ALA 34 29 29 ALA ALA A . n A 1 35 VAL 35 30 30 VAL VAL A . n A 1 36 GLU 36 31 31 GLU GLU A . n A 1 37 LYS 37 32 32 LYS LYS A . n A 1 38 GLY 38 33 33 GLY GLY A . n A 1 39 GLU 39 34 34 GLU GLU A . n A 1 40 GLU 40 35 35 GLU GLU A . n A 1 41 LEU 41 36 36 LEU LEU A . n A 1 42 SER 42 37 37 SER SER A . n A 1 43 CSO 43 38 38 CSO CSO A . n A 1 44 GLU 44 39 39 GLU GLU A . n A 1 45 GLU 45 40 40 GLU GLU A . n A 1 46 ARG 46 41 41 ARG ARG A . n A 1 47 ASN 47 42 42 ASN ASN A . n A 1 48 LEU 48 43 43 LEU LEU A . n A 1 49 LEU 49 44 44 LEU LEU A . n A 1 50 SER 50 45 45 SER SER A . n A 1 51 VAL 51 46 46 VAL VAL A . n A 1 52 ALA 52 47 47 ALA ALA A . n A 1 53 TYR 53 48 48 TYR TYR A . n A 1 54 LYS 54 49 49 LYS LYS A . n A 1 55 ASN 55 50 50 ASN ASN A . n A 1 56 VAL 56 51 51 VAL VAL A . n A 1 57 VAL 57 52 52 VAL VAL A . n A 1 58 GLY 58 53 53 GLY GLY A . n A 1 59 GLY 59 54 54 GLY GLY A . n A 1 60 GLN 60 55 55 GLN GLN A . n A 1 61 ARG 61 56 56 ARG ARG A . n A 1 62 ALA 62 57 57 ALA ALA A . n A 1 63 ALA 63 58 58 ALA ALA A . n A 1 64 TRP 64 59 59 TRP TRP A . n A 1 65 ARG 65 60 60 ARG ARG A . n A 1 66 VAL 66 61 61 VAL VAL A . n A 1 67 LEU 67 62 62 LEU LEU A . n A 1 68 SER 68 63 63 SER SER A . n A 1 69 SER 69 64 64 SER SER A . n A 1 70 ILE 70 65 65 ILE ILE A . n A 1 71 GLU 71 66 66 GLU GLU A . n A 1 72 GLN 72 67 67 GLN GLN A . n A 1 73 LYS 73 68 68 LYS LYS A . n A 1 74 SER 74 69 69 SER SER A . n A 1 75 ASN 75 70 70 ASN ASN A . n A 1 76 GLU 76 71 71 GLU GLU A . n A 1 77 GLU 77 72 72 GLU GLU A . n A 1 78 GLY 78 73 73 GLY GLY A . n A 1 79 SER 79 74 74 SER SER A . n A 1 80 GLU 80 75 75 GLU GLU A . n A 1 81 GLU 81 76 76 GLU GLU A . n A 1 82 LYS 82 77 77 LYS LYS A . n A 1 83 GLY 83 78 78 GLY GLY A . n A 1 84 PRO 84 79 79 PRO PRO A . n A 1 85 GLU 85 80 80 GLU GLU A . n A 1 86 VAL 86 81 81 VAL VAL A . n A 1 87 ARG 87 82 82 ARG ARG A . n A 1 88 GLU 88 83 83 GLU GLU A . n A 1 89 TYR 89 84 84 TYR TYR A . n A 1 90 ARG 90 85 85 ARG ARG A . n A 1 91 GLU 91 86 86 GLU GLU A . n A 1 92 LYS 92 87 87 LYS LYS A . n A 1 93 VAL 93 88 88 VAL VAL A . n A 1 94 GLU 94 89 89 GLU GLU A . n A 1 95 THR 95 90 90 THR THR A . n A 1 96 GLU 96 91 91 GLU GLU A . n A 1 97 LEU 97 92 92 LEU LEU A . n A 1 98 GLN 98 93 93 GLN GLN A . n A 1 99 GLY 99 94 94 GLY GLY A . n A 1 100 VAL 100 95 95 VAL VAL A . n A 1 101 CYS 101 96 96 CYS CYS A . n A 1 102 ASP 102 97 97 ASP ASP A . n A 1 103 THR 103 98 98 THR THR A . n A 1 104 VAL 104 99 99 VAL VAL A . n A 1 105 LEU 105 100 100 LEU LEU A . n A 1 106 GLY 106 101 101 GLY GLY A . n A 1 107 LEU 107 102 102 LEU LEU A . n A 1 108 LEU 108 103 103 LEU LEU A . n A 1 109 ASP 109 104 104 ASP ASP A . n A 1 110 SER 110 105 105 SER SER A . n A 1 111 HIS 111 106 106 HIS HIS A . n A 1 112 LEU 112 107 107 LEU LEU A . n A 1 113 ILE 113 108 108 ILE ILE A . n A 1 114 LYS 114 109 109 LYS LYS A . n A 1 115 GLU 115 110 110 GLU GLU A . n A 1 116 ALA 116 111 111 ALA ALA A . n A 1 117 GLY 117 112 112 GLY GLY A . n A 1 118 ASP 118 113 113 ASP ASP A . n A 1 119 ALA 119 114 114 ALA ALA A . n A 1 120 GLU 120 115 115 GLU GLU A . n A 1 121 SER 121 116 116 SER SER A . n A 1 122 ARG 122 117 117 ARG ARG A . n A 1 123 VAL 123 118 118 VAL VAL A . n A 1 124 PHE 124 119 119 PHE PHE A . n A 1 125 TYR 125 120 120 TYR TYR A . n A 1 126 LEU 126 121 121 LEU LEU A . n A 1 127 LYS 127 122 122 LYS LYS A . n A 1 128 MET 128 123 123 MET MET A . n A 1 129 LYS 129 124 124 LYS LYS A . n A 1 130 GLY 130 125 125 GLY GLY A . n A 1 131 ASP 131 126 126 ASP ASP A . n A 1 132 TYR 132 127 127 TYR TYR A . n A 1 133 TYR 133 128 128 TYR TYR A . n A 1 134 ARG 134 129 129 ARG ARG A . n A 1 135 TYR 135 130 130 TYR TYR A . n A 1 136 LEU 136 131 131 LEU LEU A . n A 1 137 ALA 137 132 132 ALA ALA A . n A 1 138 GLU 138 133 133 GLU GLU A . n A 1 139 VAL 139 134 134 VAL VAL A . n A 1 140 ALA 140 135 135 ALA ALA A . n A 1 141 THR 141 136 136 THR THR A . n A 1 142 GLY 142 137 137 GLY GLY A . n A 1 143 ASP 143 138 138 ASP ASP A . n A 1 144 ASP 144 139 139 ASP ASP A . n A 1 145 LYS 145 140 140 LYS LYS A . n A 1 146 LYS 146 141 141 LYS LYS A . n A 1 147 ARG 147 142 142 ARG ARG A . n A 1 148 ILE 148 143 143 ILE ILE A . n A 1 149 ILE 149 144 144 ILE ILE A . n A 1 150 ASP 150 145 145 ASP ASP A . n A 1 151 SER 151 146 146 SER SER A . n A 1 152 ALA 152 147 147 ALA ALA A . n A 1 153 ARG 153 148 148 ARG ARG A . n A 1 154 SER 154 149 149 SER SER A . n A 1 155 ALA 155 150 150 ALA ALA A . n A 1 156 TYR 156 151 151 TYR TYR A . n A 1 157 GLN 157 152 152 GLN GLN A . n A 1 158 GLU 158 153 153 GLU GLU A . n A 1 159 ALA 159 154 154 ALA ALA A . n A 1 160 MET 160 155 155 MET MET A . n A 1 161 ASP 161 156 156 ASP ASP A . n A 1 162 ILE 162 157 157 ILE ILE A . n A 1 163 SER 163 158 158 SER SER A . n A 1 164 LYS 164 159 159 LYS LYS A . n A 1 165 LYS 165 160 160 LYS LYS A . n A 1 166 GLU 166 161 161 GLU GLU A . n A 1 167 MET 167 162 162 MET MET A . n A 1 168 PRO 168 163 163 PRO PRO A . n A 1 169 PRO 169 164 164 PRO PRO A . n A 1 170 THR 170 165 165 THR THR A . n A 1 171 ASN 171 166 166 ASN ASN A . n A 1 172 PRO 172 167 167 PRO PRO A . n A 1 173 ILE 173 168 168 ILE ILE A . n A 1 174 ARG 174 169 169 ARG ARG A . n A 1 175 LEU 175 170 170 LEU LEU A . n A 1 176 GLY 176 171 171 GLY GLY A . n A 1 177 LEU 177 172 172 LEU LEU A . n A 1 178 ALA 178 173 173 ALA ALA A . n A 1 179 LEU 179 174 174 LEU LEU A . n A 1 180 ASN 180 175 175 ASN ASN A . n A 1 181 PHE 181 176 176 PHE PHE A . n A 1 182 SER 182 177 177 SER SER A . n A 1 183 VAL 183 178 178 VAL VAL A . n A 1 184 PHE 184 179 179 PHE PHE A . n A 1 185 HIS 185 180 180 HIS HIS A . n A 1 186 TYR 186 181 181 TYR TYR A . n A 1 187 GLU 187 182 182 GLU GLU A . n A 1 188 ILE 188 183 183 ILE ILE A . n A 1 189 ALA 189 184 184 ALA ALA A . n A 1 190 ASN 190 185 185 ASN ASN A . n A 1 191 SER 191 186 186 SER SER A . n A 1 192 PRO 192 187 187 PRO PRO A . n A 1 193 GLU 193 188 188 GLU GLU A . n A 1 194 GLU 194 189 189 GLU GLU A . n A 1 195 ALA 195 190 190 ALA ALA A . n A 1 196 ILE 196 191 191 ILE ILE A . n A 1 197 SER 197 192 192 SER SER A . n A 1 198 LEU 198 193 193 LEU LEU A . n A 1 199 ALA 199 194 194 ALA ALA A . n A 1 200 LYS 200 195 195 LYS LYS A . n A 1 201 THR 201 196 196 THR THR A . n A 1 202 THR 202 197 197 THR THR A . n A 1 203 PHE 203 198 198 PHE PHE A . n A 1 204 ASP 204 199 199 ASP ASP A . n A 1 205 GLU 205 200 200 GLU GLU A . n A 1 206 ALA 206 201 201 ALA ALA A . n A 1 207 MET 207 202 202 MET MET A . n A 1 208 ALA 208 203 203 ALA ALA A . n A 1 209 ASP 209 204 204 ASP ASP A . n A 1 210 LEU 210 205 205 LEU LEU A . n A 1 211 HIS 211 206 206 HIS HIS A . n A 1 212 THR 212 207 207 THR THR A . n A 1 213 LEU 213 208 208 LEU LEU A . n A 1 214 SER 214 209 209 SER SER A . n A 1 215 GLU 215 210 210 GLU GLU A . n A 1 216 ASP 216 211 211 ASP ASP A . n A 1 217 SER 217 212 212 SER SER A . n A 1 218 TYR 218 213 213 TYR TYR A . n A 1 219 LYS 219 214 214 LYS LYS A . n A 1 220 ASP 220 215 215 ASP ASP A . n A 1 221 SER 221 216 216 SER SER A . n A 1 222 THR 222 217 217 THR THR A . n A 1 223 LEU 223 218 218 LEU LEU A . n A 1 224 ILE 224 219 219 ILE ILE A . n A 1 225 MET 225 220 220 MET MET A . n A 1 226 GLN 226 221 221 GLN GLN A . n A 1 227 LEU 227 222 222 LEU LEU A . n A 1 228 LEU 228 223 223 LEU LEU A . n A 1 229 ARG 229 224 224 ARG ARG A . n A 1 230 ASP 230 225 225 ASP ASP A . n A 1 231 ASN 231 226 226 ASN ASN A . n A 1 232 LEU 232 227 227 LEU LEU A . n A 1 233 THR 233 228 228 THR THR A . n A 1 234 LEU 234 229 229 LEU LEU A . n A 1 235 TRP 235 230 230 TRP TRP A . n A 1 236 THR 236 231 231 THR THR A . n A 1 237 ALA 237 232 ? ? ? A . n A 1 238 ASP 238 233 ? ? ? A . n A 1 239 ASN 239 234 ? ? ? A . n A 1 240 ALA 240 235 ? ? ? A . n A 1 241 GLY 241 236 ? ? ? A . n A 1 242 GLU 242 237 ? ? ? A . n A 1 243 GLU 243 238 ? ? ? A . n A 1 244 GLY 244 239 ? ? ? A . n A 1 245 GLY 245 240 ? ? ? A . n A 1 246 GLU 246 241 ? ? ? A . n A 1 247 ALA 247 242 ? ? ? A . n A 1 248 PRO 248 243 ? ? ? A . n A 1 249 GLN 249 244 ? ? ? A . n A 1 250 GLU 250 245 ? ? ? A . n A 1 251 PRO 251 246 ? ? ? A . n A 1 252 GLN 252 247 ? ? ? A . n A 1 253 SER 253 248 ? ? ? A . n B 2 1 GLU 1 375 ? ? ? B . n B 2 2 SER 2 376 ? ? ? B . n B 2 3 TYR 3 377 ? ? ? B . n B 2 4 SER 4 378 ? ? ? B . n B 2 5 PRO 5 379 ? ? ? B . n B 2 6 GLY 6 380 380 GLY GLY B . n B 2 7 MET 7 381 381 MET MET B . n B 2 8 THR 8 382 382 THR THR B . n B 2 9 MET 9 383 383 MET MET B . n B 2 10 SEP 10 384 384 SEP SEP B . n B 2 11 VAL 11 385 385 VAL VAL B . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id SEP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id SEP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 MG 1 301 1 MG MG A . D 3 MG 1 302 2 MG MG A . E 4 CL 1 303 3 CL CL A . F 5 HOH 1 401 362 HOH HOH A . F 5 HOH 2 402 70 HOH HOH A . F 5 HOH 3 403 197 HOH HOH A . F 5 HOH 4 404 199 HOH HOH A . F 5 HOH 5 405 2 HOH HOH A . F 5 HOH 6 406 222 HOH HOH A . F 5 HOH 7 407 79 HOH HOH A . F 5 HOH 8 408 343 HOH HOH A . F 5 HOH 9 409 73 HOH HOH A . F 5 HOH 10 410 466 HOH HOH A . F 5 HOH 11 411 321 HOH HOH A . F 5 HOH 12 412 46 HOH HOH A . F 5 HOH 13 413 298 HOH HOH A . F 5 HOH 14 414 111 HOH HOH A . F 5 HOH 15 415 179 HOH HOH A . F 5 HOH 16 416 336 HOH HOH A . F 5 HOH 17 417 280 HOH HOH A . F 5 HOH 18 418 83 HOH HOH A . F 5 HOH 19 419 468 HOH HOH A . F 5 HOH 20 420 484 HOH HOH A . F 5 HOH 21 421 215 HOH HOH A . F 5 HOH 22 422 241 HOH HOH A . F 5 HOH 23 423 77 HOH HOH A . F 5 HOH 24 424 268 HOH HOH A . F 5 HOH 25 425 292 HOH HOH A . F 5 HOH 26 426 80 HOH HOH A . F 5 HOH 27 427 385 HOH HOH A . F 5 HOH 28 428 178 HOH HOH A . F 5 HOH 29 429 477 HOH HOH A . F 5 HOH 30 430 26 HOH HOH A . F 5 HOH 31 431 323 HOH HOH A . F 5 HOH 32 432 134 HOH HOH A . F 5 HOH 33 433 152 HOH HOH A . F 5 HOH 34 434 245 HOH HOH A . F 5 HOH 35 435 324 HOH HOH A . F 5 HOH 36 436 325 HOH HOH A . F 5 HOH 37 437 21 HOH HOH A . F 5 HOH 38 438 154 HOH HOH A . F 5 HOH 39 439 33 HOH HOH A . F 5 HOH 40 440 81 HOH HOH A . F 5 HOH 41 441 90 HOH HOH A . F 5 HOH 42 442 237 HOH HOH A . F 5 HOH 43 443 17 HOH HOH A . F 5 HOH 44 444 246 HOH HOH A . F 5 HOH 45 445 104 HOH HOH A . F 5 HOH 46 446 452 HOH HOH A . F 5 HOH 47 447 277 HOH HOH A . F 5 HOH 48 448 162 HOH HOH A . F 5 HOH 49 449 338 HOH HOH A . F 5 HOH 50 450 4 HOH HOH A . F 5 HOH 51 451 14 HOH HOH A . F 5 HOH 52 452 165 HOH HOH A . F 5 HOH 53 453 107 HOH HOH A . F 5 HOH 54 454 97 HOH HOH A . F 5 HOH 55 455 206 HOH HOH A . F 5 HOH 56 456 242 HOH HOH A . F 5 HOH 57 457 9 HOH HOH A . F 5 HOH 58 458 143 HOH HOH A . F 5 HOH 59 459 218 HOH HOH A . F 5 HOH 60 460 37 HOH HOH A . F 5 HOH 61 461 34 HOH HOH A . F 5 HOH 62 462 155 HOH HOH A . F 5 HOH 63 463 50 HOH HOH A . F 5 HOH 64 464 94 HOH HOH A . F 5 HOH 65 465 391 HOH HOH A . F 5 HOH 66 466 248 HOH HOH A . F 5 HOH 67 467 220 HOH HOH A . F 5 HOH 68 468 462 HOH HOH A . F 5 HOH 69 469 186 HOH HOH A . F 5 HOH 70 470 185 HOH HOH A . F 5 HOH 71 471 345 HOH HOH A . F 5 HOH 72 472 417 HOH HOH A . F 5 HOH 73 473 110 HOH HOH A . F 5 HOH 74 474 216 HOH HOH A . F 5 HOH 75 475 146 HOH HOH A . F 5 HOH 76 476 234 HOH HOH A . F 5 HOH 77 477 64 HOH HOH A . F 5 HOH 78 478 113 HOH HOH A . F 5 HOH 79 479 208 HOH HOH A . F 5 HOH 80 480 453 HOH HOH A . F 5 HOH 81 481 58 HOH HOH A . F 5 HOH 82 482 47 HOH HOH A . F 5 HOH 83 483 371 HOH HOH A . F 5 HOH 84 484 285 HOH HOH A . F 5 HOH 85 485 54 HOH HOH A . F 5 HOH 86 486 91 HOH HOH A . F 5 HOH 87 487 318 HOH HOH A . F 5 HOH 88 488 384 HOH HOH A . F 5 HOH 89 489 10 HOH HOH A . F 5 HOH 90 490 106 HOH HOH A . F 5 HOH 91 491 243 HOH HOH A . F 5 HOH 92 492 347 HOH HOH A . F 5 HOH 93 493 6 HOH HOH A . F 5 HOH 94 494 16 HOH HOH A . F 5 HOH 95 495 132 HOH HOH A . F 5 HOH 96 496 13 HOH HOH A . F 5 HOH 97 497 390 HOH HOH A . F 5 HOH 98 498 56 HOH HOH A . F 5 HOH 99 499 43 HOH HOH A . F 5 HOH 100 500 284 HOH HOH A . F 5 HOH 101 501 287 HOH HOH A . F 5 HOH 102 502 467 HOH HOH A . F 5 HOH 103 503 258 HOH HOH A . F 5 HOH 104 504 137 HOH HOH A . F 5 HOH 105 505 342 HOH HOH A . F 5 HOH 106 506 7 HOH HOH A . F 5 HOH 107 507 92 HOH HOH A . F 5 HOH 108 508 184 HOH HOH A . F 5 HOH 109 509 27 HOH HOH A . F 5 HOH 110 510 86 HOH HOH A . F 5 HOH 111 511 18 HOH HOH A . F 5 HOH 112 512 109 HOH HOH A . F 5 HOH 113 513 188 HOH HOH A . F 5 HOH 114 514 38 HOH HOH A . F 5 HOH 115 515 101 HOH HOH A . F 5 HOH 116 516 415 HOH HOH A . F 5 HOH 117 517 28 HOH HOH A . F 5 HOH 118 518 159 HOH HOH A . F 5 HOH 119 519 75 HOH HOH A . F 5 HOH 120 520 22 HOH HOH A . F 5 HOH 121 521 150 HOH HOH A . F 5 HOH 122 522 238 HOH HOH A . F 5 HOH 123 523 252 HOH HOH A . F 5 HOH 124 524 194 HOH HOH A . F 5 HOH 125 525 23 HOH HOH A . F 5 HOH 126 526 5 HOH HOH A . F 5 HOH 127 527 329 HOH HOH A . F 5 HOH 128 528 36 HOH HOH A . F 5 HOH 129 529 363 HOH HOH A . F 5 HOH 130 530 136 HOH HOH A . F 5 HOH 131 531 29 HOH HOH A . F 5 HOH 132 532 393 HOH HOH A . F 5 HOH 133 533 193 HOH HOH A . F 5 HOH 134 534 67 HOH HOH A . F 5 HOH 135 535 52 HOH HOH A . F 5 HOH 136 536 24 HOH HOH A . F 5 HOH 137 537 213 HOH HOH A . F 5 HOH 138 538 416 HOH HOH A . F 5 HOH 139 539 448 HOH HOH A . F 5 HOH 140 540 66 HOH HOH A . F 5 HOH 141 541 19 HOH HOH A . F 5 HOH 142 542 406 HOH HOH A . F 5 HOH 143 543 290 HOH HOH A . F 5 HOH 144 544 85 HOH HOH A . F 5 HOH 145 545 272 HOH HOH A . F 5 HOH 146 546 124 HOH HOH A . F 5 HOH 147 547 364 HOH HOH A . F 5 HOH 148 548 163 HOH HOH A . F 5 HOH 149 549 35 HOH HOH A . F 5 HOH 150 550 99 HOH HOH A . F 5 HOH 151 551 45 HOH HOH A . F 5 HOH 152 552 20 HOH HOH A . F 5 HOH 153 553 328 HOH HOH A . F 5 HOH 154 554 192 HOH HOH A . F 5 HOH 155 555 386 HOH HOH A . F 5 HOH 156 556 196 HOH HOH A . F 5 HOH 157 557 11 HOH HOH A . F 5 HOH 158 558 76 HOH HOH A . F 5 HOH 159 559 15 HOH HOH A . F 5 HOH 160 560 177 HOH HOH A . F 5 HOH 161 561 100 HOH HOH A . F 5 HOH 162 562 102 HOH HOH A . F 5 HOH 163 563 105 HOH HOH A . F 5 HOH 164 564 112 HOH HOH A . F 5 HOH 165 565 359 HOH HOH A . F 5 HOH 166 566 446 HOH HOH A . F 5 HOH 167 567 39 HOH HOH A . F 5 HOH 168 568 84 HOH HOH A . F 5 HOH 169 569 126 HOH HOH A . F 5 HOH 170 570 228 HOH HOH A . F 5 HOH 171 571 313 HOH HOH A . F 5 HOH 172 572 71 HOH HOH A . F 5 HOH 173 573 40 HOH HOH A . F 5 HOH 174 574 42 HOH HOH A . F 5 HOH 175 575 147 HOH HOH A . F 5 HOH 176 576 48 HOH HOH A . F 5 HOH 177 577 269 HOH HOH A . F 5 HOH 178 578 262 HOH HOH A . F 5 HOH 179 579 360 HOH HOH A . F 5 HOH 180 580 98 HOH HOH A . F 5 HOH 181 581 257 HOH HOH A . F 5 HOH 182 582 144 HOH HOH A . F 5 HOH 183 583 205 HOH HOH A . F 5 HOH 184 584 224 HOH HOH A . F 5 HOH 185 585 332 HOH HOH A . F 5 HOH 186 586 53 HOH HOH A . F 5 HOH 187 587 231 HOH HOH A . F 5 HOH 188 588 51 HOH HOH A . F 5 HOH 189 589 44 HOH HOH A . F 5 HOH 190 590 441 HOH HOH A . F 5 HOH 191 591 392 HOH HOH A . F 5 HOH 192 592 135 HOH HOH A . F 5 HOH 193 593 312 HOH HOH A . F 5 HOH 194 594 133 HOH HOH A . F 5 HOH 195 595 123 HOH HOH A . F 5 HOH 196 596 121 HOH HOH A . F 5 HOH 197 597 330 HOH HOH A . F 5 HOH 198 598 399 HOH HOH A . F 5 HOH 199 599 117 HOH HOH A . F 5 HOH 200 600 149 HOH HOH A . F 5 HOH 201 601 89 HOH HOH A . F 5 HOH 202 602 95 HOH HOH A . F 5 HOH 203 603 30 HOH HOH A . F 5 HOH 204 604 115 HOH HOH A . F 5 HOH 205 605 189 HOH HOH A . F 5 HOH 206 606 57 HOH HOH A . F 5 HOH 207 607 157 HOH HOH A . F 5 HOH 208 608 191 HOH HOH A . F 5 HOH 209 609 60 HOH HOH A . F 5 HOH 210 610 183 HOH HOH A . F 5 HOH 211 611 427 HOH HOH A . F 5 HOH 212 612 261 HOH HOH A . F 5 HOH 213 613 429 HOH HOH A . F 5 HOH 214 614 239 HOH HOH A . F 5 HOH 215 615 129 HOH HOH A . F 5 HOH 216 616 288 HOH HOH A . F 5 HOH 217 617 316 HOH HOH A . F 5 HOH 218 618 219 HOH HOH A . F 5 HOH 219 619 425 HOH HOH A . F 5 HOH 220 620 397 HOH HOH A . F 5 HOH 221 621 160 HOH HOH A . F 5 HOH 222 622 55 HOH HOH A . F 5 HOH 223 623 153 HOH HOH A . F 5 HOH 224 624 286 HOH HOH A . F 5 HOH 225 625 32 HOH HOH A . F 5 HOH 226 626 319 HOH HOH A . F 5 HOH 227 627 210 HOH HOH A . F 5 HOH 228 628 214 HOH HOH A . F 5 HOH 229 629 435 HOH HOH A . F 5 HOH 230 630 341 HOH HOH A . F 5 HOH 231 631 407 HOH HOH A . F 5 HOH 232 632 307 HOH HOH A . F 5 HOH 233 633 303 HOH HOH A . F 5 HOH 234 634 119 HOH HOH A . F 5 HOH 235 635 139 HOH HOH A . F 5 HOH 236 636 431 HOH HOH A . F 5 HOH 237 637 412 HOH HOH A . F 5 HOH 238 638 8 HOH HOH A . F 5 HOH 239 639 266 HOH HOH A . F 5 HOH 240 640 63 HOH HOH A . F 5 HOH 241 641 249 HOH HOH A . F 5 HOH 242 642 378 HOH HOH A . F 5 HOH 243 643 389 HOH HOH A . F 5 HOH 244 644 244 HOH HOH A . F 5 HOH 245 645 293 HOH HOH A . F 5 HOH 246 646 402 HOH HOH A . F 5 HOH 247 647 369 HOH HOH A . F 5 HOH 248 648 271 HOH HOH A . F 5 HOH 249 649 116 HOH HOH A . F 5 HOH 250 650 296 HOH HOH A . F 5 HOH 251 651 201 HOH HOH A . F 5 HOH 252 652 212 HOH HOH A . F 5 HOH 253 653 173 HOH HOH A . F 5 HOH 254 654 289 HOH HOH A . F 5 HOH 255 655 335 HOH HOH A . F 5 HOH 256 656 140 HOH HOH A . F 5 HOH 257 657 409 HOH HOH A . F 5 HOH 258 658 158 HOH HOH A . F 5 HOH 259 659 457 HOH HOH A . F 5 HOH 260 660 74 HOH HOH A . F 5 HOH 261 661 381 HOH HOH A . F 5 HOH 262 662 175 HOH HOH A . F 5 HOH 263 663 171 HOH HOH A . F 5 HOH 264 664 377 HOH HOH A . F 5 HOH 265 665 169 HOH HOH A . F 5 HOH 266 666 260 HOH HOH A . F 5 HOH 267 667 250 HOH HOH A . F 5 HOH 268 668 361 HOH HOH A . F 5 HOH 269 669 62 HOH HOH A . F 5 HOH 270 670 279 HOH HOH A . F 5 HOH 271 671 291 HOH HOH A . F 5 HOH 272 672 388 HOH HOH A . F 5 HOH 273 673 255 HOH HOH A . F 5 HOH 274 674 478 HOH HOH A . F 5 HOH 275 675 114 HOH HOH A . F 5 HOH 276 676 142 HOH HOH A . F 5 HOH 277 677 433 HOH HOH A . F 5 HOH 278 678 430 HOH HOH A . F 5 HOH 279 679 302 HOH HOH A . F 5 HOH 280 680 151 HOH HOH A . F 5 HOH 281 681 463 HOH HOH A . F 5 HOH 282 682 411 HOH HOH A . F 5 HOH 283 683 403 HOH HOH A . F 5 HOH 284 684 273 HOH HOH A . F 5 HOH 285 685 207 HOH HOH A . F 5 HOH 286 686 458 HOH HOH A . F 5 HOH 287 687 195 HOH HOH A . F 5 HOH 288 688 421 HOH HOH A . F 5 HOH 289 689 130 HOH HOH A . F 5 HOH 290 690 304 HOH HOH A . F 5 HOH 291 691 138 HOH HOH A . F 5 HOH 292 692 226 HOH HOH A . F 5 HOH 293 693 337 HOH HOH A . F 5 HOH 294 694 161 HOH HOH A . F 5 HOH 295 695 69 HOH HOH A . F 5 HOH 296 696 418 HOH HOH A . F 5 HOH 297 697 211 HOH HOH A . F 5 HOH 298 698 164 HOH HOH A . F 5 HOH 299 699 122 HOH HOH A . F 5 HOH 300 700 253 HOH HOH A . F 5 HOH 301 701 187 HOH HOH A . F 5 HOH 302 702 240 HOH HOH A . F 5 HOH 303 703 366 HOH HOH A . F 5 HOH 304 704 317 HOH HOH A . F 5 HOH 305 705 170 HOH HOH A . F 5 HOH 306 706 346 HOH HOH A . F 5 HOH 307 707 294 HOH HOH A . F 5 HOH 308 708 156 HOH HOH A . F 5 HOH 309 709 236 HOH HOH A . F 5 HOH 310 710 315 HOH HOH A . F 5 HOH 311 711 495 HOH HOH A . F 5 HOH 312 712 351 HOH HOH A . F 5 HOH 313 713 202 HOH HOH A . F 5 HOH 314 714 395 HOH HOH A . F 5 HOH 315 715 374 HOH HOH A . F 5 HOH 316 716 145 HOH HOH A . F 5 HOH 317 717 82 HOH HOH A . F 5 HOH 318 718 275 HOH HOH A . F 5 HOH 319 719 233 HOH HOH A . F 5 HOH 320 720 209 HOH HOH A . F 5 HOH 321 721 493 HOH HOH A . F 5 HOH 322 722 198 HOH HOH A . F 5 HOH 323 723 373 HOH HOH A . F 5 HOH 324 724 492 HOH HOH A . F 5 HOH 325 725 331 HOH HOH A . F 5 HOH 326 726 423 HOH HOH A . F 5 HOH 327 727 348 HOH HOH A . F 5 HOH 328 728 479 HOH HOH A . F 5 HOH 329 729 401 HOH HOH A . F 5 HOH 330 730 270 HOH HOH A . F 5 HOH 331 731 103 HOH HOH A . F 5 HOH 332 732 299 HOH HOH A . F 5 HOH 333 733 476 HOH HOH A . F 5 HOH 334 734 350 HOH HOH A . F 5 HOH 335 735 396 HOH HOH A . F 5 HOH 336 736 469 HOH HOH A . F 5 HOH 337 737 176 HOH HOH A . F 5 HOH 338 738 308 HOH HOH A . F 5 HOH 339 739 181 HOH HOH A . F 5 HOH 340 740 96 HOH HOH A . F 5 HOH 341 741 235 HOH HOH A . F 5 HOH 342 742 125 HOH HOH A . F 5 HOH 343 743 141 HOH HOH A . F 5 HOH 344 744 424 HOH HOH A . F 5 HOH 345 745 78 HOH HOH A . F 5 HOH 346 746 259 HOH HOH A . F 5 HOH 347 747 118 HOH HOH A . F 5 HOH 348 748 432 HOH HOH A . F 5 HOH 349 749 283 HOH HOH A . F 5 HOH 350 750 295 HOH HOH A . F 5 HOH 351 751 339 HOH HOH A . F 5 HOH 352 752 256 HOH HOH A . F 5 HOH 353 753 459 HOH HOH A . F 5 HOH 354 754 31 HOH HOH A . F 5 HOH 355 755 72 HOH HOH A . F 5 HOH 356 756 357 HOH HOH A . F 5 HOH 357 757 61 HOH HOH A . F 5 HOH 358 758 470 HOH HOH A . F 5 HOH 359 759 301 HOH HOH A . F 5 HOH 360 760 282 HOH HOH A . F 5 HOH 361 761 281 HOH HOH A . F 5 HOH 362 762 383 HOH HOH A . F 5 HOH 363 763 419 HOH HOH A . F 5 HOH 364 764 166 HOH HOH A . F 5 HOH 365 765 447 HOH HOH A . F 5 HOH 366 766 172 HOH HOH A . F 5 HOH 367 767 93 HOH HOH A . F 5 HOH 368 768 49 HOH HOH A . F 5 HOH 369 769 127 HOH HOH A . F 5 HOH 370 770 131 HOH HOH A . F 5 HOH 371 771 276 HOH HOH A . F 5 HOH 372 772 372 HOH HOH A . F 5 HOH 373 773 227 HOH HOH A . F 5 HOH 374 774 180 HOH HOH A . F 5 HOH 375 775 460 HOH HOH A . F 5 HOH 376 776 443 HOH HOH A . F 5 HOH 377 777 481 HOH HOH A . F 5 HOH 378 778 420 HOH HOH A . F 5 HOH 379 779 68 HOH HOH A . F 5 HOH 380 780 333 HOH HOH A . F 5 HOH 381 781 263 HOH HOH A . F 5 HOH 382 782 12 HOH HOH A . F 5 HOH 383 783 490 HOH HOH A . F 5 HOH 384 784 108 HOH HOH A . F 5 HOH 385 785 464 HOH HOH A . F 5 HOH 386 786 309 HOH HOH A . F 5 HOH 387 787 41 HOH HOH A . F 5 HOH 388 788 382 HOH HOH A . F 5 HOH 389 789 278 HOH HOH A . F 5 HOH 390 790 247 HOH HOH A . F 5 HOH 391 791 442 HOH HOH A . F 5 HOH 392 792 354 HOH HOH A . F 5 HOH 393 793 326 HOH HOH A . F 5 HOH 394 794 267 HOH HOH A . F 5 HOH 395 795 25 HOH HOH A . F 5 HOH 396 796 200 HOH HOH A . F 5 HOH 397 797 456 HOH HOH A . F 5 HOH 398 798 358 HOH HOH A . F 5 HOH 399 799 204 HOH HOH A . F 5 HOH 400 800 482 HOH HOH A . F 5 HOH 401 801 340 HOH HOH A . F 5 HOH 402 802 232 HOH HOH A . F 5 HOH 403 803 486 HOH HOH A . F 5 HOH 404 804 475 HOH HOH A . F 5 HOH 405 805 440 HOH HOH A . F 5 HOH 406 806 445 HOH HOH A . F 5 HOH 407 807 88 HOH HOH A . F 5 HOH 408 808 353 HOH HOH A . F 5 HOH 409 809 230 HOH HOH A . F 5 HOH 410 810 254 HOH HOH A . F 5 HOH 411 811 408 HOH HOH A . F 5 HOH 412 812 167 HOH HOH A . F 5 HOH 413 813 65 HOH HOH A . F 5 HOH 414 814 148 HOH HOH A . F 5 HOH 415 815 128 HOH HOH A . F 5 HOH 416 816 436 HOH HOH A . F 5 HOH 417 817 300 HOH HOH A . F 5 HOH 418 818 370 HOH HOH A . F 5 HOH 419 819 59 HOH HOH A . F 5 HOH 420 820 454 HOH HOH A . F 5 HOH 421 821 387 HOH HOH A . F 5 HOH 422 822 168 HOH HOH A . F 5 HOH 423 823 223 HOH HOH A . F 5 HOH 424 824 311 HOH HOH A . F 5 HOH 425 825 217 HOH HOH A . F 5 HOH 426 826 379 HOH HOH A . F 5 HOH 427 827 306 HOH HOH A . G 5 HOH 1 401 174 HOH HOH B . G 5 HOH 2 402 297 HOH HOH B . G 5 HOH 3 403 182 HOH HOH B . G 5 HOH 4 404 472 HOH HOH B . G 5 HOH 5 405 87 HOH HOH B . G 5 HOH 6 406 497 HOH HOH B . G 5 HOH 7 407 265 HOH HOH B . G 5 HOH 8 408 251 HOH HOH B . G 5 HOH 9 409 120 HOH HOH B . G 5 HOH 10 410 375 HOH HOH B . G 5 HOH 11 411 221 HOH HOH B . G 5 HOH 12 412 352 HOH HOH B . G 5 HOH 13 413 349 HOH HOH B . G 5 HOH 14 414 404 HOH HOH B . G 5 HOH 15 415 274 HOH HOH B . G 5 HOH 16 416 428 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 67 ? CD ? A GLN 72 CD 2 1 Y 1 A GLN 67 ? OE1 ? A GLN 72 OE1 3 1 Y 1 A GLN 67 ? NE2 ? A GLN 72 NE2 4 1 Y 1 A LYS 68 ? CE ? A LYS 73 CE 5 1 Y 1 A LYS 68 ? NZ ? A LYS 73 NZ 6 1 Y 1 A GLU 72 ? CG ? A GLU 77 CG 7 1 Y 1 A GLU 72 ? CD ? A GLU 77 CD 8 1 Y 1 A GLU 72 ? OE1 ? A GLU 77 OE1 9 1 Y 1 A GLU 72 ? OE2 ? A GLU 77 OE2 10 1 Y 1 A LYS 214 ? CD ? A LYS 219 CD 11 1 Y 1 A LYS 214 ? CE ? A LYS 219 CE 12 1 Y 1 A LYS 214 ? NZ ? A LYS 219 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7OBX _cell.details ? _cell.formula_units_Z ? _cell.length_a 82.552 _cell.length_a_esd ? _cell.length_b 112.160 _cell.length_b_esd ? _cell.length_c 62.712 _cell.length_c_esd ? _cell.volume 580650.770 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7OBX _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7OBX _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.02 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.095 M Hepes pH 7.3, 25%PEG 400, 0.19 M CaCl2 and 5 % Glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 200K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-09-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5419 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'SEALED TUBE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-003' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5419 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 9.71 _reflns.entry_id 7OBX _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.80 _reflns.d_resolution_low 34.06 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 26828 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.2 _reflns.pdbx_Rmerge_I_obs 0.038 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.83 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 11.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1236 _reflns_shell.percent_possible_all 91.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.101 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.992 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 14.27 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7OBX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.80 _refine.ls_d_res_low 34.06 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 26819 _refine.ls_number_reflns_R_free 1341 _refine.ls_number_reflns_R_work 25478 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.17 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1391 _refine.ls_R_factor_R_free 0.1745 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1373 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4JC3 _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 16.3430 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1085 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 34.06 _refine_hist.number_atoms_solvent 443 _refine_hist.number_atoms_total 2336 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1890 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0086 ? 2030 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9259 ? 2754 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0437 ? 304 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0055 ? 364 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.5359 ? 1266 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.80 1.87 . . 125 2375 93.46 . . . 0.2034 . 0.1574 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.87 1.94 . . 131 2487 96.89 . . . 0.1819 . 0.1481 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.94 2.03 . . 131 2490 96.97 . . . 0.2002 . 0.1373 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.03 2.14 . . 132 2512 98.18 . . . 0.1842 . 0.1259 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.14 2.27 . . 132 2531 98.37 . . . 0.1627 . 0.1252 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.27 2.44 . . 134 2547 98.97 . . . 0.1522 . 0.1210 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.44 2.69 . . 137 2585 99.42 . . . 0.1862 . 0.1329 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.69 3.08 . . 136 2579 99.60 . . . 0.1826 . 0.1374 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.08 3.88 . . 139 2645 99.89 . . . 0.1475 . 0.1300 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.88 34.06 . . 144 2727 99.76 . . . 0.1803 . 0.1581 . . . . . . . . . . . # _struct.entry_id 7OBX _struct.title 'Crystal structure of 14-3-3 sigma in complex with SSBP4 phosphopeptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7OBX _struct_keywords.text '14-3-3 protein protein-peptide complex, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? G N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP 1433S_HUMAN P31947 ? 1 ;MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPE VREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKK EMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGG EAPQEPQS ; 1 2 UNP SSBP4_HUMAN Q9BWG4 ? 2 ESYSPGMTMSV 375 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7OBX A 6 ? 253 ? P31947 1 ? 248 ? 1 248 2 2 7OBX B 1 ? 11 ? Q9BWG4 375 ? 385 ? 375 385 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7OBX GLY A 1 ? UNP P31947 ? ? 'expression tag' -4 1 1 7OBX ALA A 2 ? UNP P31947 ? ? 'expression tag' -3 2 1 7OBX MET A 3 ? UNP P31947 ? ? 'expression tag' -2 3 1 7OBX GLY A 4 ? UNP P31947 ? ? 'expression tag' -1 4 1 7OBX SER A 5 ? UNP P31947 ? ? 'expression tag' 0 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F,G 1 2 A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 7 ? ALA A 21 ? GLU A 2 ALA A 16 1 ? 15 HELX_P HELX_P2 AA2 ARG A 23 ? LYS A 37 ? ARG A 18 LYS A 32 1 ? 15 HELX_P HELX_P3 AA3 SER A 42 ? ASN A 75 ? SER A 37 ASN A 70 1 ? 34 HELX_P HELX_P4 AA4 PRO A 84 ? SER A 110 ? PRO A 79 SER A 105 1 ? 27 HELX_P HELX_P5 AA5 HIS A 111 ? ALA A 116 ? HIS A 106 ALA A 111 1 ? 6 HELX_P HELX_P6 AA6 ASP A 118 ? ALA A 140 ? ASP A 113 ALA A 135 1 ? 23 HELX_P HELX_P7 AA7 ASP A 144 ? MET A 167 ? ASP A 139 MET A 162 1 ? 24 HELX_P HELX_P8 AA8 ASN A 171 ? ILE A 188 ? ASN A 166 ILE A 183 1 ? 18 HELX_P HELX_P9 AA9 SER A 191 ? LEU A 210 ? SER A 186 LEU A 205 1 ? 20 HELX_P HELX_P10 AB1 HIS A 211 ? LEU A 213 ? HIS A 206 LEU A 208 5 ? 3 HELX_P HELX_P11 AB2 SER A 214 ? THR A 236 ? SER A 209 THR A 231 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A SER 42 C ? ? ? 1_555 A CSO 43 N A ? A SER 37 A CSO 38 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale2 covale both ? A SER 42 C ? ? ? 1_555 A CSO 43 N B ? A SER 37 A CSO 38 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale3 covale both ? A CSO 43 C A ? ? 1_555 A GLU 44 N ? ? A CSO 38 A GLU 39 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale4 covale both ? A CSO 43 C B ? ? 1_555 A GLU 44 N ? ? A CSO 38 A GLU 39 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale5 covale both ? B MET 9 C ? ? ? 1_555 B SEP 10 N ? ? B MET 383 B SEP 384 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale6 covale both ? B SEP 10 C ? ? ? 1_555 B VAL 11 N ? ? B SEP 384 B VAL 385 1_555 ? ? ? ? ? ? ? 1.324 ? ? metalc1 metalc ? ? A GLU 7 OE1 ? ? ? 1_555 C MG . MG ? ? A GLU 2 A MG 301 1_555 ? ? ? ? ? ? ? 2.426 ? ? metalc2 metalc ? ? A GLU 7 OE1 ? ? ? 1_555 C MG . MG ? ? A GLU 2 A MG 301 3_654 ? ? ? ? ? ? ? 2.426 ? ? metalc3 metalc ? ? A GLU 40 OE1 ? ? ? 1_555 D MG . MG ? ? A GLU 35 A MG 302 1_555 ? ? ? ? ? ? ? 2.634 ? ? metalc4 metalc ? ? A GLU 40 OE2 ? ? ? 1_555 D MG . MG ? ? A GLU 35 A MG 302 1_555 ? ? ? ? ? ? ? 2.503 ? ? metalc5 metalc ? ? A GLU 115 O ? ? ? 1_555 D MG . MG ? ? A GLU 110 A MG 302 1_555 ? ? ? ? ? ? ? 2.278 ? ? metalc6 metalc ? ? A GLU 193 OE2 ? ? ? 1_555 D MG . MG ? ? A GLU 188 A MG 302 6_555 ? ? ? ? ? ? ? 2.321 ? ? metalc7 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 301 A HOH 443 1_555 ? ? ? ? ? ? ? 2.549 ? ? metalc8 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 301 A HOH 443 3_654 ? ? ? ? ? ? ? 2.549 ? ? metalc9 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 301 A HOH 670 1_555 ? ? ? ? ? ? ? 2.428 ? ? metalc10 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 301 A HOH 670 3_654 ? ? ? ? ? ? ? 2.428 ? ? metalc11 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 301 A HOH 697 1_555 ? ? ? ? ? ? ? 2.620 ? ? metalc12 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 301 A HOH 697 3_654 ? ? ? ? ? ? ? 2.621 ? ? metalc13 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 519 6_554 ? ? ? ? ? ? ? 2.316 ? ? metalc14 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 656 1_555 ? ? ? ? ? ? ? 2.281 ? ? metalc15 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 675 1_555 ? ? ? ? ? ? ? 2.317 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 0.0 ? 2 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 443 ? 1_555 76.1 ? 3 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 443 ? 1_555 76.1 ? 4 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 443 ? 3_654 81.7 ? 5 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 443 ? 3_654 81.7 ? 6 O ? F HOH . ? A HOH 443 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 443 ? 3_654 149.7 ? 7 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 670 ? 1_555 79.9 ? 8 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 670 ? 1_555 79.9 ? 9 O ? F HOH . ? A HOH 443 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 670 ? 1_555 125.2 ? 10 O ? F HOH . ? A HOH 443 ? 3_654 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 670 ? 1_555 69.4 ? 11 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 670 ? 3_654 143.8 ? 12 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 670 ? 3_654 143.8 ? 13 O ? F HOH . ? A HOH 443 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 670 ? 3_654 69.4 ? 14 O ? F HOH . ? A HOH 443 ? 3_654 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 670 ? 3_654 125.2 ? 15 O ? F HOH . ? A HOH 670 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 670 ? 3_654 129.3 ? 16 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 697 ? 1_555 84.2 ? 17 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 697 ? 1_555 84.2 ? 18 O ? F HOH . ? A HOH 443 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 697 ? 1_555 84.7 ? 19 O ? F HOH . ? A HOH 443 ? 3_654 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 697 ? 1_555 113.4 ? 20 O ? F HOH . ? A HOH 670 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 697 ? 1_555 44.1 ? 21 O ? F HOH . ? A HOH 670 ? 3_654 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 697 ? 1_555 102.6 ? 22 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 697 ? 3_654 164.2 ? 23 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 697 ? 3_654 164.2 ? 24 O ? F HOH . ? A HOH 443 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 697 ? 3_654 113.4 ? 25 O ? F HOH . ? A HOH 443 ? 3_654 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 697 ? 3_654 84.7 ? 26 O ? F HOH . ? A HOH 670 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 697 ? 3_654 102.6 ? 27 O ? F HOH . ? A HOH 670 ? 3_654 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 697 ? 3_654 44.1 ? 28 O ? F HOH . ? A HOH 697 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 697 ? 3_654 108.6 ? 29 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 50.5 ? 30 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? A GLU 115 ? A GLU 110 ? 1_555 84.7 ? 31 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? A GLU 115 ? A GLU 110 ? 1_555 86.9 ? 32 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 88.3 ? 33 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 123.4 ? 34 O ? A GLU 115 ? A GLU 110 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 47.2 ? 35 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 519 ? 6_554 146.5 ? 36 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 519 ? 6_554 160.0 ? 37 O ? A GLU 115 ? A GLU 110 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 519 ? 6_554 103.1 ? 38 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 519 ? 6_554 74.7 ? 39 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 656 ? 1_555 129.8 ? 40 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 656 ? 1_555 79.9 ? 41 O ? A GLU 115 ? A GLU 110 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 656 ? 1_555 85.3 ? 42 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 656 ? 1_555 118.4 ? 43 O ? F HOH . ? A HOH 519 ? 6_554 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 656 ? 1_555 83.7 ? 44 OE1 ? A GLU 40 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 675 ? 1_555 89.2 ? 45 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 675 ? 1_555 81.1 ? 46 O ? A GLU 115 ? A GLU 110 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 675 ? 1_555 167.8 ? 47 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 675 ? 1_555 143.4 ? 48 O ? F HOH . ? A HOH 519 ? 6_554 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 675 ? 1_555 87.8 ? 49 O ? F HOH . ? A HOH 656 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 675 ? 1_555 90.5 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CSO A 43 A . . . . CSO A 38 ? 1_555 . . . . . . . CYS 1 CSO Hydroxylation 'Named protein modification' 2 CSO A 43 B . . . . CSO A 38 ? 1_555 . . . . . . . CYS 1 CSO Hydroxylation 'Named protein modification' 3 SEP B 10 ? . . . . SEP B 384 ? 1_555 . . . . . . . SER 1 SEP Phosphorylation 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 110 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 105 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 HIS _struct_mon_prot_cis.pdbx_label_seq_id_2 111 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 HIS _struct_mon_prot_cis.pdbx_auth_seq_id_2 106 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 9.14 # _pdbx_entry_details.entry_id 7OBX _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 419 ? ? O A HOH 547 ? ? 1.88 2 1 O A HOH 670 ? ? O A HOH 697 ? ? 1.90 3 1 O A HOH 429 ? ? O A HOH 642 ? ? 1.95 4 1 OD A CSO 38 ? B O A HOH 401 ? ? 1.97 5 1 O A HOH 682 ? ? O A HOH 816 ? ? 2.00 6 1 O A HOH 620 ? ? O A HOH 736 ? ? 2.02 7 1 O A HOH 480 ? ? O A HOH 677 ? ? 2.02 8 1 O A HOH 420 ? ? O A HOH 500 ? ? 2.02 9 1 O A HOH 776 ? ? O A HOH 792 ? ? 2.03 10 1 O A HOH 407 ? ? O A HOH 452 ? ? 2.03 11 1 O A HOH 649 ? ? O B HOH 407 ? ? 2.05 12 1 O A HOH 435 ? ? O A HOH 754 ? ? 2.07 13 1 O A HOH 644 ? ? O A HOH 649 ? ? 2.08 14 1 OE1 A GLU 110 ? ? O A HOH 402 ? ? 2.10 15 1 O A HOH 704 ? ? O A HOH 715 ? ? 2.13 16 1 O A HOH 643 ? ? O A HOH 728 ? ? 2.13 17 1 O A HOH 407 ? ? O A HOH 505 ? ? 2.13 18 1 O A HOH 664 ? ? O A HOH 744 ? ? 2.14 19 1 O A HOH 447 ? ? O A HOH 748 ? ? 2.14 20 1 O B HOH 402 ? ? O B HOH 412 ? ? 2.14 21 1 O A HOH 427 ? ? O A HOH 583 ? ? 2.15 22 1 OD2 A ASP 211 ? ? O A HOH 403 ? ? 2.17 23 1 O A HOH 630 ? ? O A HOH 707 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OE2 A GLU 110 ? ? 1_555 HH A TYR 213 ? ? 8_555 1.59 2 1 O A HOH 749 ? ? 1_555 O A HOH 771 ? ? 2_654 2.04 3 1 O A HOH 565 ? ? 1_555 O A HOH 579 ? ? 8_455 2.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 18 ? ? -102.63 78.04 2 1 HIS A 106 ? ? -147.02 36.33 3 1 THR A 136 ? ? -140.05 -4.29 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CSO 43 A CSO 38 ? CYS 'modified residue' 2 B SEP 10 B SEP 384 ? SER 'modified residue' # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id MG _pdbx_struct_special_symmetry.auth_seq_id 301 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id MG _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 826 ? 5.91 . 2 1 O ? A HOH 827 ? 6.39 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 232 ? A ALA 237 2 1 Y 1 A ASP 233 ? A ASP 238 3 1 Y 1 A ASN 234 ? A ASN 239 4 1 Y 1 A ALA 235 ? A ALA 240 5 1 Y 1 A GLY 236 ? A GLY 241 6 1 Y 1 A GLU 237 ? A GLU 242 7 1 Y 1 A GLU 238 ? A GLU 243 8 1 Y 1 A GLY 239 ? A GLY 244 9 1 Y 1 A GLY 240 ? A GLY 245 10 1 Y 1 A GLU 241 ? A GLU 246 11 1 Y 1 A ALA 242 ? A ALA 247 12 1 Y 1 A PRO 243 ? A PRO 248 13 1 Y 1 A GLN 244 ? A GLN 249 14 1 Y 1 A GLU 245 ? A GLU 250 15 1 Y 1 A PRO 246 ? A PRO 251 16 1 Y 1 A GLN 247 ? A GLN 252 17 1 Y 1 A SER 248 ? A SER 253 18 1 Y 1 B GLU 375 ? B GLU 1 19 1 Y 1 B SER 376 ? B SER 2 20 1 Y 1 B TYR 377 ? B TYR 3 21 1 Y 1 B SER 378 ? B SER 4 22 1 Y 1 B PRO 379 ? B PRO 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CSO N N N N 75 CSO CA C N R 76 CSO CB C N N 77 CSO SG S N N 78 CSO C C N N 79 CSO O O N N 80 CSO OXT O N N 81 CSO OD O N N 82 CSO H H N N 83 CSO H2 H N N 84 CSO HA H N N 85 CSO HB2 H N N 86 CSO HB3 H N N 87 CSO HXT H N N 88 CSO HD H N N 89 CYS N N N N 90 CYS CA C N R 91 CYS C C N N 92 CYS O O N N 93 CYS CB C N N 94 CYS SG S N N 95 CYS OXT O N N 96 CYS H H N N 97 CYS H2 H N N 98 CYS HA H N N 99 CYS HB2 H N N 100 CYS HB3 H N N 101 CYS HG H N N 102 CYS HXT H N N 103 GLN N N N N 104 GLN CA C N S 105 GLN C C N N 106 GLN O O N N 107 GLN CB C N N 108 GLN CG C N N 109 GLN CD C N N 110 GLN OE1 O N N 111 GLN NE2 N N N 112 GLN OXT O N N 113 GLN H H N N 114 GLN H2 H N N 115 GLN HA H N N 116 GLN HB2 H N N 117 GLN HB3 H N N 118 GLN HG2 H N N 119 GLN HG3 H N N 120 GLN HE21 H N N 121 GLN HE22 H N N 122 GLN HXT H N N 123 GLU N N N N 124 GLU CA C N S 125 GLU C C N N 126 GLU O O N N 127 GLU CB C N N 128 GLU CG C N N 129 GLU CD C N N 130 GLU OE1 O N N 131 GLU OE2 O N N 132 GLU OXT O N N 133 GLU H H N N 134 GLU H2 H N N 135 GLU HA H N N 136 GLU HB2 H N N 137 GLU HB3 H N N 138 GLU HG2 H N N 139 GLU HG3 H N N 140 GLU HE2 H N N 141 GLU HXT H N N 142 GLY N N N N 143 GLY CA C N N 144 GLY C C N N 145 GLY O O N N 146 GLY OXT O N N 147 GLY H H N N 148 GLY H2 H N N 149 GLY HA2 H N N 150 GLY HA3 H N N 151 GLY HXT H N N 152 HIS N N N N 153 HIS CA C N S 154 HIS C C N N 155 HIS O O N N 156 HIS CB C N N 157 HIS CG C Y N 158 HIS ND1 N Y N 159 HIS CD2 C Y N 160 HIS CE1 C Y N 161 HIS NE2 N Y N 162 HIS OXT O N N 163 HIS H H N N 164 HIS H2 H N N 165 HIS HA H N N 166 HIS HB2 H N N 167 HIS HB3 H N N 168 HIS HD1 H N N 169 HIS HD2 H N N 170 HIS HE1 H N N 171 HIS HE2 H N N 172 HIS HXT H N N 173 HOH O O N N 174 HOH H1 H N N 175 HOH H2 H N N 176 ILE N N N N 177 ILE CA C N S 178 ILE C C N N 179 ILE O O N N 180 ILE CB C N S 181 ILE CG1 C N N 182 ILE CG2 C N N 183 ILE CD1 C N N 184 ILE OXT O N N 185 ILE H H N N 186 ILE H2 H N N 187 ILE HA H N N 188 ILE HB H N N 189 ILE HG12 H N N 190 ILE HG13 H N N 191 ILE HG21 H N N 192 ILE HG22 H N N 193 ILE HG23 H N N 194 ILE HD11 H N N 195 ILE HD12 H N N 196 ILE HD13 H N N 197 ILE HXT H N N 198 LEU N N N N 199 LEU CA C N S 200 LEU C C N N 201 LEU O O N N 202 LEU CB C N N 203 LEU CG C N N 204 LEU CD1 C N N 205 LEU CD2 C N N 206 LEU OXT O N N 207 LEU H H N N 208 LEU H2 H N N 209 LEU HA H N N 210 LEU HB2 H N N 211 LEU HB3 H N N 212 LEU HG H N N 213 LEU HD11 H N N 214 LEU HD12 H N N 215 LEU HD13 H N N 216 LEU HD21 H N N 217 LEU HD22 H N N 218 LEU HD23 H N N 219 LEU HXT H N N 220 LYS N N N N 221 LYS CA C N S 222 LYS C C N N 223 LYS O O N N 224 LYS CB C N N 225 LYS CG C N N 226 LYS CD C N N 227 LYS CE C N N 228 LYS NZ N N N 229 LYS OXT O N N 230 LYS H H N N 231 LYS H2 H N N 232 LYS HA H N N 233 LYS HB2 H N N 234 LYS HB3 H N N 235 LYS HG2 H N N 236 LYS HG3 H N N 237 LYS HD2 H N N 238 LYS HD3 H N N 239 LYS HE2 H N N 240 LYS HE3 H N N 241 LYS HZ1 H N N 242 LYS HZ2 H N N 243 LYS HZ3 H N N 244 LYS HXT H N N 245 MET N N N N 246 MET CA C N S 247 MET C C N N 248 MET O O N N 249 MET CB C N N 250 MET CG C N N 251 MET SD S N N 252 MET CE C N N 253 MET OXT O N N 254 MET H H N N 255 MET H2 H N N 256 MET HA H N N 257 MET HB2 H N N 258 MET HB3 H N N 259 MET HG2 H N N 260 MET HG3 H N N 261 MET HE1 H N N 262 MET HE2 H N N 263 MET HE3 H N N 264 MET HXT H N N 265 MG MG MG N N 266 PHE N N N N 267 PHE CA C N S 268 PHE C C N N 269 PHE O O N N 270 PHE CB C N N 271 PHE CG C Y N 272 PHE CD1 C Y N 273 PHE CD2 C Y N 274 PHE CE1 C Y N 275 PHE CE2 C Y N 276 PHE CZ C Y N 277 PHE OXT O N N 278 PHE H H N N 279 PHE H2 H N N 280 PHE HA H N N 281 PHE HB2 H N N 282 PHE HB3 H N N 283 PHE HD1 H N N 284 PHE HD2 H N N 285 PHE HE1 H N N 286 PHE HE2 H N N 287 PHE HZ H N N 288 PHE HXT H N N 289 PRO N N N N 290 PRO CA C N S 291 PRO C C N N 292 PRO O O N N 293 PRO CB C N N 294 PRO CG C N N 295 PRO CD C N N 296 PRO OXT O N N 297 PRO H H N N 298 PRO HA H N N 299 PRO HB2 H N N 300 PRO HB3 H N N 301 PRO HG2 H N N 302 PRO HG3 H N N 303 PRO HD2 H N N 304 PRO HD3 H N N 305 PRO HXT H N N 306 SEP N N N N 307 SEP CA C N S 308 SEP CB C N N 309 SEP OG O N N 310 SEP C C N N 311 SEP O O N N 312 SEP OXT O N N 313 SEP P P N N 314 SEP O1P O N N 315 SEP O2P O N N 316 SEP O3P O N N 317 SEP H H N N 318 SEP H2 H N N 319 SEP HA H N N 320 SEP HB2 H N N 321 SEP HB3 H N N 322 SEP HXT H N N 323 SEP HOP2 H N N 324 SEP HOP3 H N N 325 SER N N N N 326 SER CA C N S 327 SER C C N N 328 SER O O N N 329 SER CB C N N 330 SER OG O N N 331 SER OXT O N N 332 SER H H N N 333 SER H2 H N N 334 SER HA H N N 335 SER HB2 H N N 336 SER HB3 H N N 337 SER HG H N N 338 SER HXT H N N 339 THR N N N N 340 THR CA C N S 341 THR C C N N 342 THR O O N N 343 THR CB C N R 344 THR OG1 O N N 345 THR CG2 C N N 346 THR OXT O N N 347 THR H H N N 348 THR H2 H N N 349 THR HA H N N 350 THR HB H N N 351 THR HG1 H N N 352 THR HG21 H N N 353 THR HG22 H N N 354 THR HG23 H N N 355 THR HXT H N N 356 TRP N N N N 357 TRP CA C N S 358 TRP C C N N 359 TRP O O N N 360 TRP CB C N N 361 TRP CG C Y N 362 TRP CD1 C Y N 363 TRP CD2 C Y N 364 TRP NE1 N Y N 365 TRP CE2 C Y N 366 TRP CE3 C Y N 367 TRP CZ2 C Y N 368 TRP CZ3 C Y N 369 TRP CH2 C Y N 370 TRP OXT O N N 371 TRP H H N N 372 TRP H2 H N N 373 TRP HA H N N 374 TRP HB2 H N N 375 TRP HB3 H N N 376 TRP HD1 H N N 377 TRP HE1 H N N 378 TRP HE3 H N N 379 TRP HZ2 H N N 380 TRP HZ3 H N N 381 TRP HH2 H N N 382 TRP HXT H N N 383 TYR N N N N 384 TYR CA C N S 385 TYR C C N N 386 TYR O O N N 387 TYR CB C N N 388 TYR CG C Y N 389 TYR CD1 C Y N 390 TYR CD2 C Y N 391 TYR CE1 C Y N 392 TYR CE2 C Y N 393 TYR CZ C Y N 394 TYR OH O N N 395 TYR OXT O N N 396 TYR H H N N 397 TYR H2 H N N 398 TYR HA H N N 399 TYR HB2 H N N 400 TYR HB3 H N N 401 TYR HD1 H N N 402 TYR HD2 H N N 403 TYR HE1 H N N 404 TYR HE2 H N N 405 TYR HH H N N 406 TYR HXT H N N 407 VAL N N N N 408 VAL CA C N S 409 VAL C C N N 410 VAL O O N N 411 VAL CB C N N 412 VAL CG1 C N N 413 VAL CG2 C N N 414 VAL OXT O N N 415 VAL H H N N 416 VAL H2 H N N 417 VAL HA H N N 418 VAL HB H N N 419 VAL HG11 H N N 420 VAL HG12 H N N 421 VAL HG13 H N N 422 VAL HG21 H N N 423 VAL HG22 H N N 424 VAL HG23 H N N 425 VAL HXT H N N 426 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CSO N CA sing N N 70 CSO N H sing N N 71 CSO N H2 sing N N 72 CSO CA CB sing N N 73 CSO CA C sing N N 74 CSO CA HA sing N N 75 CSO CB SG sing N N 76 CSO CB HB2 sing N N 77 CSO CB HB3 sing N N 78 CSO SG OD sing N N 79 CSO C O doub N N 80 CSO C OXT sing N N 81 CSO OXT HXT sing N N 82 CSO OD HD sing N N 83 CYS N CA sing N N 84 CYS N H sing N N 85 CYS N H2 sing N N 86 CYS CA C sing N N 87 CYS CA CB sing N N 88 CYS CA HA sing N N 89 CYS C O doub N N 90 CYS C OXT sing N N 91 CYS CB SG sing N N 92 CYS CB HB2 sing N N 93 CYS CB HB3 sing N N 94 CYS SG HG sing N N 95 CYS OXT HXT sing N N 96 GLN N CA sing N N 97 GLN N H sing N N 98 GLN N H2 sing N N 99 GLN CA C sing N N 100 GLN CA CB sing N N 101 GLN CA HA sing N N 102 GLN C O doub N N 103 GLN C OXT sing N N 104 GLN CB CG sing N N 105 GLN CB HB2 sing N N 106 GLN CB HB3 sing N N 107 GLN CG CD sing N N 108 GLN CG HG2 sing N N 109 GLN CG HG3 sing N N 110 GLN CD OE1 doub N N 111 GLN CD NE2 sing N N 112 GLN NE2 HE21 sing N N 113 GLN NE2 HE22 sing N N 114 GLN OXT HXT sing N N 115 GLU N CA sing N N 116 GLU N H sing N N 117 GLU N H2 sing N N 118 GLU CA C sing N N 119 GLU CA CB sing N N 120 GLU CA HA sing N N 121 GLU C O doub N N 122 GLU C OXT sing N N 123 GLU CB CG sing N N 124 GLU CB HB2 sing N N 125 GLU CB HB3 sing N N 126 GLU CG CD sing N N 127 GLU CG HG2 sing N N 128 GLU CG HG3 sing N N 129 GLU CD OE1 doub N N 130 GLU CD OE2 sing N N 131 GLU OE2 HE2 sing N N 132 GLU OXT HXT sing N N 133 GLY N CA sing N N 134 GLY N H sing N N 135 GLY N H2 sing N N 136 GLY CA C sing N N 137 GLY CA HA2 sing N N 138 GLY CA HA3 sing N N 139 GLY C O doub N N 140 GLY C OXT sing N N 141 GLY OXT HXT sing N N 142 HIS N CA sing N N 143 HIS N H sing N N 144 HIS N H2 sing N N 145 HIS CA C sing N N 146 HIS CA CB sing N N 147 HIS CA HA sing N N 148 HIS C O doub N N 149 HIS C OXT sing N N 150 HIS CB CG sing N N 151 HIS CB HB2 sing N N 152 HIS CB HB3 sing N N 153 HIS CG ND1 sing Y N 154 HIS CG CD2 doub Y N 155 HIS ND1 CE1 doub Y N 156 HIS ND1 HD1 sing N N 157 HIS CD2 NE2 sing Y N 158 HIS CD2 HD2 sing N N 159 HIS CE1 NE2 sing Y N 160 HIS CE1 HE1 sing N N 161 HIS NE2 HE2 sing N N 162 HIS OXT HXT sing N N 163 HOH O H1 sing N N 164 HOH O H2 sing N N 165 ILE N CA sing N N 166 ILE N H sing N N 167 ILE N H2 sing N N 168 ILE CA C sing N N 169 ILE CA CB sing N N 170 ILE CA HA sing N N 171 ILE C O doub N N 172 ILE C OXT sing N N 173 ILE CB CG1 sing N N 174 ILE CB CG2 sing N N 175 ILE CB HB sing N N 176 ILE CG1 CD1 sing N N 177 ILE CG1 HG12 sing N N 178 ILE CG1 HG13 sing N N 179 ILE CG2 HG21 sing N N 180 ILE CG2 HG22 sing N N 181 ILE CG2 HG23 sing N N 182 ILE CD1 HD11 sing N N 183 ILE CD1 HD12 sing N N 184 ILE CD1 HD13 sing N N 185 ILE OXT HXT sing N N 186 LEU N CA sing N N 187 LEU N H sing N N 188 LEU N H2 sing N N 189 LEU CA C sing N N 190 LEU CA CB sing N N 191 LEU CA HA sing N N 192 LEU C O doub N N 193 LEU C OXT sing N N 194 LEU CB CG sing N N 195 LEU CB HB2 sing N N 196 LEU CB HB3 sing N N 197 LEU CG CD1 sing N N 198 LEU CG CD2 sing N N 199 LEU CG HG sing N N 200 LEU CD1 HD11 sing N N 201 LEU CD1 HD12 sing N N 202 LEU CD1 HD13 sing N N 203 LEU CD2 HD21 sing N N 204 LEU CD2 HD22 sing N N 205 LEU CD2 HD23 sing N N 206 LEU OXT HXT sing N N 207 LYS N CA sing N N 208 LYS N H sing N N 209 LYS N H2 sing N N 210 LYS CA C sing N N 211 LYS CA CB sing N N 212 LYS CA HA sing N N 213 LYS C O doub N N 214 LYS C OXT sing N N 215 LYS CB CG sing N N 216 LYS CB HB2 sing N N 217 LYS CB HB3 sing N N 218 LYS CG CD sing N N 219 LYS CG HG2 sing N N 220 LYS CG HG3 sing N N 221 LYS CD CE sing N N 222 LYS CD HD2 sing N N 223 LYS CD HD3 sing N N 224 LYS CE NZ sing N N 225 LYS CE HE2 sing N N 226 LYS CE HE3 sing N N 227 LYS NZ HZ1 sing N N 228 LYS NZ HZ2 sing N N 229 LYS NZ HZ3 sing N N 230 LYS OXT HXT sing N N 231 MET N CA sing N N 232 MET N H sing N N 233 MET N H2 sing N N 234 MET CA C sing N N 235 MET CA CB sing N N 236 MET CA HA sing N N 237 MET C O doub N N 238 MET C OXT sing N N 239 MET CB CG sing N N 240 MET CB HB2 sing N N 241 MET CB HB3 sing N N 242 MET CG SD sing N N 243 MET CG HG2 sing N N 244 MET CG HG3 sing N N 245 MET SD CE sing N N 246 MET CE HE1 sing N N 247 MET CE HE2 sing N N 248 MET CE HE3 sing N N 249 MET OXT HXT sing N N 250 PHE N CA sing N N 251 PHE N H sing N N 252 PHE N H2 sing N N 253 PHE CA C sing N N 254 PHE CA CB sing N N 255 PHE CA HA sing N N 256 PHE C O doub N N 257 PHE C OXT sing N N 258 PHE CB CG sing N N 259 PHE CB HB2 sing N N 260 PHE CB HB3 sing N N 261 PHE CG CD1 doub Y N 262 PHE CG CD2 sing Y N 263 PHE CD1 CE1 sing Y N 264 PHE CD1 HD1 sing N N 265 PHE CD2 CE2 doub Y N 266 PHE CD2 HD2 sing N N 267 PHE CE1 CZ doub Y N 268 PHE CE1 HE1 sing N N 269 PHE CE2 CZ sing Y N 270 PHE CE2 HE2 sing N N 271 PHE CZ HZ sing N N 272 PHE OXT HXT sing N N 273 PRO N CA sing N N 274 PRO N CD sing N N 275 PRO N H sing N N 276 PRO CA C sing N N 277 PRO CA CB sing N N 278 PRO CA HA sing N N 279 PRO C O doub N N 280 PRO C OXT sing N N 281 PRO CB CG sing N N 282 PRO CB HB2 sing N N 283 PRO CB HB3 sing N N 284 PRO CG CD sing N N 285 PRO CG HG2 sing N N 286 PRO CG HG3 sing N N 287 PRO CD HD2 sing N N 288 PRO CD HD3 sing N N 289 PRO OXT HXT sing N N 290 SEP N CA sing N N 291 SEP N H sing N N 292 SEP N H2 sing N N 293 SEP CA CB sing N N 294 SEP CA C sing N N 295 SEP CA HA sing N N 296 SEP CB OG sing N N 297 SEP CB HB2 sing N N 298 SEP CB HB3 sing N N 299 SEP OG P sing N N 300 SEP C O doub N N 301 SEP C OXT sing N N 302 SEP OXT HXT sing N N 303 SEP P O1P doub N N 304 SEP P O2P sing N N 305 SEP P O3P sing N N 306 SEP O2P HOP2 sing N N 307 SEP O3P HOP3 sing N N 308 SER N CA sing N N 309 SER N H sing N N 310 SER N H2 sing N N 311 SER CA C sing N N 312 SER CA CB sing N N 313 SER CA HA sing N N 314 SER C O doub N N 315 SER C OXT sing N N 316 SER CB OG sing N N 317 SER CB HB2 sing N N 318 SER CB HB3 sing N N 319 SER OG HG sing N N 320 SER OXT HXT sing N N 321 THR N CA sing N N 322 THR N H sing N N 323 THR N H2 sing N N 324 THR CA C sing N N 325 THR CA CB sing N N 326 THR CA HA sing N N 327 THR C O doub N N 328 THR C OXT sing N N 329 THR CB OG1 sing N N 330 THR CB CG2 sing N N 331 THR CB HB sing N N 332 THR OG1 HG1 sing N N 333 THR CG2 HG21 sing N N 334 THR CG2 HG22 sing N N 335 THR CG2 HG23 sing N N 336 THR OXT HXT sing N N 337 TRP N CA sing N N 338 TRP N H sing N N 339 TRP N H2 sing N N 340 TRP CA C sing N N 341 TRP CA CB sing N N 342 TRP CA HA sing N N 343 TRP C O doub N N 344 TRP C OXT sing N N 345 TRP CB CG sing N N 346 TRP CB HB2 sing N N 347 TRP CB HB3 sing N N 348 TRP CG CD1 doub Y N 349 TRP CG CD2 sing Y N 350 TRP CD1 NE1 sing Y N 351 TRP CD1 HD1 sing N N 352 TRP CD2 CE2 doub Y N 353 TRP CD2 CE3 sing Y N 354 TRP NE1 CE2 sing Y N 355 TRP NE1 HE1 sing N N 356 TRP CE2 CZ2 sing Y N 357 TRP CE3 CZ3 doub Y N 358 TRP CE3 HE3 sing N N 359 TRP CZ2 CH2 doub Y N 360 TRP CZ2 HZ2 sing N N 361 TRP CZ3 CH2 sing Y N 362 TRP CZ3 HZ3 sing N N 363 TRP CH2 HH2 sing N N 364 TRP OXT HXT sing N N 365 TYR N CA sing N N 366 TYR N H sing N N 367 TYR N H2 sing N N 368 TYR CA C sing N N 369 TYR CA CB sing N N 370 TYR CA HA sing N N 371 TYR C O doub N N 372 TYR C OXT sing N N 373 TYR CB CG sing N N 374 TYR CB HB2 sing N N 375 TYR CB HB3 sing N N 376 TYR CG CD1 doub Y N 377 TYR CG CD2 sing Y N 378 TYR CD1 CE1 sing Y N 379 TYR CD1 HD1 sing N N 380 TYR CD2 CE2 doub Y N 381 TYR CD2 HD2 sing N N 382 TYR CE1 CZ doub Y N 383 TYR CE1 HE1 sing N N 384 TYR CE2 CZ sing Y N 385 TYR CE2 HE2 sing N N 386 TYR CZ OH sing N N 387 TYR OH HH sing N N 388 TYR OXT HXT sing N N 389 VAL N CA sing N N 390 VAL N H sing N N 391 VAL N H2 sing N N 392 VAL CA C sing N N 393 VAL CA CB sing N N 394 VAL CA HA sing N N 395 VAL C O doub N N 396 VAL C OXT sing N N 397 VAL CB CG1 sing N N 398 VAL CB CG2 sing N N 399 VAL CB HB sing N N 400 VAL CG1 HG11 sing N N 401 VAL CG1 HG12 sing N N 402 VAL CG1 HG13 sing N N 403 VAL CG2 HG21 sing N N 404 VAL CG2 HG22 sing N N 405 VAL CG2 HG23 sing N N 406 VAL OXT HXT sing N N 407 # _pdbx_audit_support.funding_organization 'H2020 Marie Curie Actions of the European Commission' _pdbx_audit_support.country 'European Union' _pdbx_audit_support.grant_number 675179 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4JC3 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 7OBX _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012114 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008916 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015946 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 1.04373 23.83732 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 24.73122 6.32584 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 2.59044 63.03566 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 15.80542 1.70748 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 1.42069 35.72801 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_