data_7OFN # _entry.id 7OFN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7OFN pdb_00007ofn 10.2210/pdb7ofn/pdb WWPDB D_1292115669 ? ? BMRB 25387 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 25387 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7OFN _pdbx_database_status.recvd_initial_deposition_date 2021-05-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Quilici, G.' 1 0000-0003-1379-3583 'Berardi, A.' 2 0000-0002-0193-8194 'Musco, G.' 3 0000-0002-0469-2994 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Chem.Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1554-8937 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 17 _citation.language ? _citation.page_first 230 _citation.page_last 239 _citation.title 'Solution Structure of the BPSL1445 Protein of Burkholderia pseudomallei Reveals the SYLF Domain Three-Dimensional Fold.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acschembio.1c00886 _citation.pdbx_database_id_PubMed 34968022 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Quilici, G.' 1 ? primary 'Berardi, A.' 2 ? primary 'Fabris, C.' 3 ? primary 'Ghitti, M.' 4 0000-0003-4059-0095 primary 'Punta, M.' 5 ? primary 'Gourlay, L.J.' 6 0000-0002-6369-2230 primary 'Bolognesi, M.' 7 0000-0002-9253-5170 primary 'Musco, G.' 8 0000-0002-0469-2994 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Lipoprotein _entity.formula_weight 16536.766 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ;GS do not belong to the real sequence, they derive from the vector region, to match pdb sequence numbering to BPSL1445 sequence add 32 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSATNASKRQAIDASVDATLSRLYSTVRGSRELVAKSRGVLVFPDVIQAGLIIGGQTGNGALRVGGATVGYYNTSSLSVG LQAGAQSKAIVFLFMTQDALDKFRNSDGWAAGADASVALVKMGANGAIDTTTATAPVEVIVLTNAGLMGDVSISGTKVTK LKI ; _entity_poly.pdbx_seq_one_letter_code_can ;GSATNASKRQAIDASVDATLSRLYSTVRGSRELVAKSRGVLVFPDVIQAGLIIGGQTGNGALRVGGATVGYYNTSSLSVG LQAGAQSKAIVFLFMTQDALDKFRNSDGWAAGADASVALVKMGANGAIDTTTATAPVEVIVLTNAGLMGDVSISGTKVTK LKI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 THR n 1 5 ASN n 1 6 ALA n 1 7 SER n 1 8 LYS n 1 9 ARG n 1 10 GLN n 1 11 ALA n 1 12 ILE n 1 13 ASP n 1 14 ALA n 1 15 SER n 1 16 VAL n 1 17 ASP n 1 18 ALA n 1 19 THR n 1 20 LEU n 1 21 SER n 1 22 ARG n 1 23 LEU n 1 24 TYR n 1 25 SER n 1 26 THR n 1 27 VAL n 1 28 ARG n 1 29 GLY n 1 30 SER n 1 31 ARG n 1 32 GLU n 1 33 LEU n 1 34 VAL n 1 35 ALA n 1 36 LYS n 1 37 SER n 1 38 ARG n 1 39 GLY n 1 40 VAL n 1 41 LEU n 1 42 VAL n 1 43 PHE n 1 44 PRO n 1 45 ASP n 1 46 VAL n 1 47 ILE n 1 48 GLN n 1 49 ALA n 1 50 GLY n 1 51 LEU n 1 52 ILE n 1 53 ILE n 1 54 GLY n 1 55 GLY n 1 56 GLN n 1 57 THR n 1 58 GLY n 1 59 ASN n 1 60 GLY n 1 61 ALA n 1 62 LEU n 1 63 ARG n 1 64 VAL n 1 65 GLY n 1 66 GLY n 1 67 ALA n 1 68 THR n 1 69 VAL n 1 70 GLY n 1 71 TYR n 1 72 TYR n 1 73 ASN n 1 74 THR n 1 75 SER n 1 76 SER n 1 77 LEU n 1 78 SER n 1 79 VAL n 1 80 GLY n 1 81 LEU n 1 82 GLN n 1 83 ALA n 1 84 GLY n 1 85 ALA n 1 86 GLN n 1 87 SER n 1 88 LYS n 1 89 ALA n 1 90 ILE n 1 91 VAL n 1 92 PHE n 1 93 LEU n 1 94 PHE n 1 95 MET n 1 96 THR n 1 97 GLN n 1 98 ASP n 1 99 ALA n 1 100 LEU n 1 101 ASP n 1 102 LYS n 1 103 PHE n 1 104 ARG n 1 105 ASN n 1 106 SER n 1 107 ASP n 1 108 GLY n 1 109 TRP n 1 110 ALA n 1 111 ALA n 1 112 GLY n 1 113 ALA n 1 114 ASP n 1 115 ALA n 1 116 SER n 1 117 VAL n 1 118 ALA n 1 119 LEU n 1 120 VAL n 1 121 LYS n 1 122 MET n 1 123 GLY n 1 124 ALA n 1 125 ASN n 1 126 GLY n 1 127 ALA n 1 128 ILE n 1 129 ASP n 1 130 THR n 1 131 THR n 1 132 THR n 1 133 ALA n 1 134 THR n 1 135 ALA n 1 136 PRO n 1 137 VAL n 1 138 GLU n 1 139 VAL n 1 140 ILE n 1 141 VAL n 1 142 LEU n 1 143 THR n 1 144 ASN n 1 145 ALA n 1 146 GLY n 1 147 LEU n 1 148 MET n 1 149 GLY n 1 150 ASP n 1 151 VAL n 1 152 SER n 1 153 ILE n 1 154 SER n 1 155 GLY n 1 156 THR n 1 157 LYS n 1 158 VAL n 1 159 THR n 1 160 LYS n 1 161 LEU n 1 162 LYS n 1 163 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 163 _entity_src_gen.gene_src_common_name 'Pseudomonas pseudomallei' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BOC42_05350, CXQ84_09430, DF122_22840, ERS013345_04496' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Burkholderia pseudomallei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 28450 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-4T-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A069B8F8_BURPE _struct_ref.pdbx_db_accession A0A069B8F8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ATNASKRQAIDASVDATLSRLYSTVRGSRELVAKSRGVLVFPDVIQAGLIIGGQTGNGALRVGGATVGYYNTSSLSVGLQ AGAQSKAIVFLFMTQDALDKFRNSDGWAAGADASVALVKMGANGAIDTTTATAPVEVIVLTNAGLMGDVSISGTKVTKLK I ; _struct_ref.pdbx_align_begin 35 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7OFN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 163 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A069B8F8 _struct_ref_seq.db_align_beg 35 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 195 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 163 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7OFN GLY A 1 ? UNP A0A069B8F8 ? ? 'expression tag' 1 1 1 7OFN SER A 2 ? UNP A0A069B8F8 ? ? 'expression tag' 2 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H NOESY' 1 isotropic 2 1 2 '2D 1H-1H NOESY' 1 isotropic 3 1 3 '3D 1H-15N NOESY' 1 isotropic 4 1 4 '3D 1H-13C NOESY' 1 isotropic 5 1 5 '3D C(CO)NH' 1 isotropic 7 1 5 '3D H(CCO)NH' 1 isotropic 6 1 5 '3D HNCA' 1 isotropic 8 1 5 '3D HNCO' 1 isotropic 9 1 4 '3D HCCH-TOCSY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 295 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label standard_conditions _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.3 mM BPSL1445, 150 mM sodium chloride, 20 mM NaH2PO4, 20 mM Na2HPO4, 2 mM DTT, 90% H2O/10% D2O' '90% H2O/10% D2O' unlabel_water solution ? 2 '0.3 mM BPSL1445, 150 mM sodium chloride, 20 mM NaH2PO4, 20 mM Na2HPO4, 2 mM DTT, 100% D2O' '100% D2O' unlabel_D2O solution ? 3 '0.3 mM BPSL1445, 150 mM sodium chloride, 20 mM NaH2PO4, 20 mM Na2HPO4, 2 mM DTT, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_H2O solution ? 4 '0.3 mM BPSL1445, 150 mM sodium chloride, 20 mM NaH2PO4, 20 mM Na2HPO4, 2 mM DTT, 100% D2O' '100% D2O' 15N_13C_D2O solution ? 5 '0.3 mM BPSL1445, 150 mM sodium chloride, 20 mM NaH2PO4, 20 mM Na2HPO4, 2 mM DTT, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_13C_H2O solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 7OFN _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 7OFN _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7OFN _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement TopSpin ? 'Bruker Biospin' 2 'structure calculation' ARIA 3.2 ;Linge, O'Donoghue and Nilges ; 3 'chemical shift assignment' 'CcpNmr Analysis' 2.4 CCPN 4 'peak picking' 'CcpNmr Analysis' 2.4 CCPN # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7OFN _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7OFN _struct.title 'NMR solution structure of the SYLF domain of Burkholderia pseudomallei BPSL1445' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7OFN _struct_keywords.text 'Burkholderia pseudomallei Lipoprotein SYLF domain beta berrel, LIPID BINDING PROTEIN' _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 4 ? VAL A 27 ? THR A 4 VAL A 27 1 ? 24 HELX_P HELX_P2 AA2 GLY A 29 ? SER A 37 ? GLY A 29 SER A 37 1 ? 9 HELX_P HELX_P3 AA3 SER A 78 ? ALA A 83 ? SER A 78 ALA A 83 1 ? 6 HELX_P HELX_P4 AA4 THR A 96 ? SER A 106 ? THR A 96 SER A 106 1 ? 11 HELX_P HELX_P5 AA5 ASP A 129 ? ALA A 133 ? ASP A 129 ALA A 133 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 109 ? ALA A 110 ? TRP A 109 ALA A 110 AA1 2 LYS A 157 ? LEU A 161 ? LYS A 157 LEU A 161 AA1 3 ALA A 67 ? SER A 76 ? ALA A 67 SER A 76 AA1 4 ASN A 59 ? VAL A 64 ? ASN A 59 VAL A 64 AA1 5 GLY A 39 ? ASP A 45 ? GLY A 39 ASP A 45 AA1 6 LYS A 88 ? PHE A 94 ? LYS A 88 PHE A 94 AA1 7 VAL A 137 ? THR A 143 ? VAL A 137 THR A 143 AA1 8 VAL A 117 ? LEU A 119 ? VAL A 117 LEU A 119 AA2 1 TRP A 109 ? ALA A 110 ? TRP A 109 ALA A 110 AA2 2 LYS A 157 ? LEU A 161 ? LYS A 157 LEU A 161 AA2 3 ALA A 67 ? SER A 76 ? ALA A 67 SER A 76 AA2 4 ASN A 59 ? VAL A 64 ? ASN A 59 VAL A 64 AA2 5 GLY A 39 ? ASP A 45 ? GLY A 39 ASP A 45 AA2 6 LYS A 88 ? PHE A 94 ? LYS A 88 PHE A 94 AA2 7 VAL A 137 ? THR A 143 ? VAL A 137 THR A 143 AA2 8 GLY A 146 ? LEU A 147 ? GLY A 146 LEU A 147 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TRP A 109 ? N TRP A 109 O VAL A 158 ? O VAL A 158 AA1 2 3 O THR A 159 ? O THR A 159 N ASN A 73 ? N ASN A 73 AA1 3 4 O TYR A 72 ? O TYR A 72 N GLY A 60 ? N GLY A 60 AA1 4 5 O ARG A 63 ? O ARG A 63 N VAL A 40 ? N VAL A 40 AA1 5 6 N LEU A 41 ? N LEU A 41 O PHE A 92 ? O PHE A 92 AA1 6 7 N VAL A 91 ? N VAL A 91 O ILE A 140 ? O ILE A 140 AA1 7 8 O VAL A 139 ? O VAL A 139 N ALA A 118 ? N ALA A 118 AA2 1 2 N TRP A 109 ? N TRP A 109 O VAL A 158 ? O VAL A 158 AA2 2 3 O THR A 159 ? O THR A 159 N ASN A 73 ? N ASN A 73 AA2 3 4 O TYR A 72 ? O TYR A 72 N GLY A 60 ? N GLY A 60 AA2 4 5 O ARG A 63 ? O ARG A 63 N VAL A 40 ? N VAL A 40 AA2 5 6 N LEU A 41 ? N LEU A 41 O PHE A 92 ? O PHE A 92 AA2 6 7 N VAL A 91 ? N VAL A 91 O ILE A 140 ? O ILE A 140 AA2 7 8 N THR A 143 ? N THR A 143 O GLY A 146 ? O GLY A 146 # _atom_sites.entry_id 7OFN _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 MET 122 122 122 MET MET A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 MET 148 148 148 MET MET A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 THR 159 159 159 THR THR A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 ILE 163 163 163 ILE ILE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-12-29 2 'Structure model' 1 1 2022-02-02 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 BPSL1445 0.3 ? mM 'natural abundance' 1 'sodium chloride' 150 ? mM 'natural abundance' 1 NaH2PO4 20 ? mM 'natural abundance' 1 Na2HPO4 20 ? mM 'natural abundance' 1 DTT 2 ? mM 'natural abundance' 2 BPSL1445 0.3 ? mM 'natural abundance' 2 'sodium chloride' 150 ? mM 'natural abundance' 2 NaH2PO4 20 ? mM 'natural abundance' 2 Na2HPO4 20 ? mM 'natural abundance' 2 DTT 2 ? mM 'natural abundance' 3 BPSL1445 0.3 ? mM 'natural abundance' 3 'sodium chloride' 150 ? mM 'natural abundance' 3 NaH2PO4 20 ? mM 'natural abundance' 3 Na2HPO4 20 ? mM 'natural abundance' 3 DTT 2 ? mM 'natural abundance' 4 BPSL1445 0.3 ? mM 'natural abundance' 4 'sodium chloride' 150 ? mM 'natural abundance' 4 NaH2PO4 20 ? mM 'natural abundance' 4 Na2HPO4 20 ? mM 'natural abundance' 4 DTT 2 ? mM 'natural abundance' 5 BPSL1445 0.3 ? mM 'natural abundance' 5 'sodium chloride' 150 ? mM 'natural abundance' 5 NaH2PO4 20 ? mM 'natural abundance' 5 Na2HPO4 20 ? mM 'natural abundance' 5 DTT 2 ? mM 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 45 ? ? HZ2 A LYS 88 ? ? 1.59 2 2 HE A ARG 9 ? ? HH A TYR 71 ? ? 1.11 3 4 OD2 A ASP 45 ? ? HZ1 A LYS 88 ? ? 1.55 4 7 HH A TYR 24 ? ? HH11 A ARG 31 ? ? 0.97 5 7 OD1 A ASP 129 ? ? HG1 A THR 132 ? ? 1.59 6 10 HE A ARG 9 ? ? HH A TYR 71 ? ? 1.11 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 3 ? ? -141.12 28.13 2 1 ALA A 85 ? ? -95.60 41.25 3 1 THR A 134 ? ? -154.46 -39.13 4 2 GLN A 48 ? ? -179.97 -30.91 5 2 ALA A 49 ? ? -143.69 29.23 6 2 GLN A 86 ? ? -141.04 35.47 7 2 THR A 134 ? ? -129.13 -52.78 8 3 GLN A 48 ? ? -84.68 43.55 9 3 ALA A 49 ? ? -96.08 32.60 10 3 ALA A 85 ? ? -87.51 47.22 11 3 THR A 134 ? ? -131.64 -38.18 12 3 ASP A 150 ? ? -118.80 54.47 13 4 SER A 2 ? ? 61.08 62.13 14 4 GLN A 48 ? ? -140.41 -33.35 15 4 THR A 57 ? ? 72.55 -64.67 16 4 THR A 134 ? ? -154.56 -35.36 17 5 ALA A 3 ? ? -130.72 -67.21 18 5 PRO A 44 ? ? -84.42 47.90 19 5 ALA A 85 ? ? -147.10 24.75 20 5 THR A 134 ? ? -164.84 22.08 21 6 SER A 2 ? ? 53.75 -167.49 22 6 THR A 134 ? ? -136.87 -39.26 23 6 ASP A 150 ? ? -151.82 53.53 24 7 SER A 2 ? ? -96.76 35.09 25 7 THR A 134 ? ? -136.25 -61.24 26 8 THR A 4 ? ? 68.59 109.67 27 8 SER A 76 ? ? -100.45 68.23 28 8 ALA A 85 ? ? -150.75 38.46 29 8 ASP A 107 ? ? -115.08 65.58 30 8 THR A 134 ? ? -134.31 -57.55 31 9 ILE A 47 ? ? -102.84 58.91 32 9 GLN A 86 ? ? 72.20 115.15 33 9 ALA A 113 ? ? -99.34 -69.55 34 9 THR A 134 ? ? -148.99 16.92 35 9 ASP A 150 ? ? -162.89 60.59 36 10 THR A 134 ? ? -140.57 -52.71 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Fondazione CARIPLO' Italy 2009-3577 1 'Italian Association for Cancer Research' Italy IG-214400 2 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Confirmed by NMR relaxation' #