data_7OFO # _entry.id 7OFO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7OFO pdb_00007ofo 10.2210/pdb7ofo/pdb WWPDB D_1292115693 ? ? BMRB 34622 ? 10.13018/BMR34622 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-06-23 2 'Structure model' 1 1 2022-01-12 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Other 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_citation_author.identifier_ORCID' 14 2 'Structure model' '_database_2.pdbx_DOI' 15 2 'Structure model' '_database_2.pdbx_database_accession' 16 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 17 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7OFO _pdbx_database_status.recvd_initial_deposition_date 2021-05-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 7OFM unspecified BMRB 'NMR structure of the Bak transmembrane helix in lipid nanodiscs' 34622 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sperl, L.E.' 1 ? 'Hagn, F.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Embo J.' _citation.journal_id_ASTM EMJODG _citation.journal_id_CSD 0897 _citation.journal_id_ISSN 1460-2075 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 40 _citation.language ? _citation.page_first e107159 _citation.page_last e107159 _citation.title 'High-resolution analysis of the conformational transition of pro-apoptotic Bak at the lipid membrane.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.15252/embj.2020107159 _citation.pdbx_database_id_PubMed 34523144 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sperl, L.E.' 1 ? primary 'Ruhrnossl, F.' 2 ? primary 'Schiller, A.' 3 ? primary 'Haslbeck, M.' 4 ? primary 'Hagn, F.' 5 0000-0002-1315-459X # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Bcl-2 homologous antagonist/killer' _entity.formula_weight 3244.936 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Apoptosis regulator BAK,Bcl-2-like protein 7,Bcl2-L-7' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SLGNGPILNVLVVLGVVLLGQFVVRRFFKS _entity_poly.pdbx_seq_one_letter_code_can SLGNGPILNVLVVLGVVLLGQFVVRRFFKS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LEU n 1 3 GLY n 1 4 ASN n 1 5 GLY n 1 6 PRO n 1 7 ILE n 1 8 LEU n 1 9 ASN n 1 10 VAL n 1 11 LEU n 1 12 VAL n 1 13 VAL n 1 14 LEU n 1 15 GLY n 1 16 VAL n 1 17 VAL n 1 18 LEU n 1 19 LEU n 1 20 GLY n 1 21 GLN n 1 22 PHE n 1 23 VAL n 1 24 VAL n 1 25 ARG n 1 26 ARG n 1 27 PHE n 1 28 PHE n 1 29 LYS n 1 30 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 30 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BAK1, BAK, BCL2L7, CDN1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 SER 30 30 30 SER SER A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7OFO _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7OFO _struct.title 'NMR structure of the Bak transmembrane helix in lipid nanodiscs' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7OFO _struct_keywords.text 'mitochondria, pore formation, Bcl2 proteins, APOPTOSIS' _struct_keywords.pdbx_keywords APOPTOSIS # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BAK_HUMAN _struct_ref.pdbx_db_accession Q16611 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LGNGPILNVLVVLGVVLLGQFVVRRFFKS _struct_ref.pdbx_align_begin 183 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7OFO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 30 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16611 _struct_ref_seq.db_align_beg 183 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 211 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 30 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7OFO _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q16611 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3170 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 6 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 30 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 6 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 30 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 2 ? ? 55.12 97.47 2 5 PHE A 28 ? ? 58.44 73.99 3 9 PRO A 6 ? ? -45.94 160.29 4 10 PRO A 6 ? ? -53.84 176.32 5 12 LEU A 2 ? ? 55.13 83.69 6 13 PHE A 28 ? ? -176.86 -66.53 7 14 PHE A 28 ? ? -174.89 130.71 8 15 PHE A 28 ? ? 41.39 75.96 9 17 PHE A 27 ? ? -178.27 69.29 10 18 PHE A 28 ? ? 64.70 119.18 # _pdbx_nmr_ensemble.entry_id 7OFO _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7OFO _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '400 uM [U-13C; U-15N; U-2H] Bak transmembrane helix, 20 mM sodium phosphate, 50 mM sodium chloride, 1 mM EDTA, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 2H15N-sample _pdbx_nmr_sample_details.type membrane _pdbx_nmr_sample_details.details 'Bak TMH in lipid nanodiscs' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Bak transmembrane helix' 400 ? uM '[U-13C; U-15N; U-2H]' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'sodium chloride' 50 ? mM 'natural abundance' 1 EDTA 1 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 315 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D 1H-15N NOESY' 1 isotropic 3 1 1 '3D 1H-15N-NNH-NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 7OFO _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 6 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing TopSpin ? 'Bruker Biospin' 3 'peak picking' NMRFAM-SPARKY ? 'U of Wisconsin Madison' 4 'chemical shift assignment' NMRFAM-SPARKY ? 'U of Wisconsin Madison' 5 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 6 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 GLN N N N N 45 GLN CA C N S 46 GLN C C N N 47 GLN O O N N 48 GLN CB C N N 49 GLN CG C N N 50 GLN CD C N N 51 GLN OE1 O N N 52 GLN NE2 N N N 53 GLN OXT O N N 54 GLN H H N N 55 GLN H2 H N N 56 GLN HA H N N 57 GLN HB2 H N N 58 GLN HB3 H N N 59 GLN HG2 H N N 60 GLN HG3 H N N 61 GLN HE21 H N N 62 GLN HE22 H N N 63 GLN HXT H N N 64 GLY N N N N 65 GLY CA C N N 66 GLY C C N N 67 GLY O O N N 68 GLY OXT O N N 69 GLY H H N N 70 GLY H2 H N N 71 GLY HA2 H N N 72 GLY HA3 H N N 73 GLY HXT H N N 74 ILE N N N N 75 ILE CA C N S 76 ILE C C N N 77 ILE O O N N 78 ILE CB C N S 79 ILE CG1 C N N 80 ILE CG2 C N N 81 ILE CD1 C N N 82 ILE OXT O N N 83 ILE H H N N 84 ILE H2 H N N 85 ILE HA H N N 86 ILE HB H N N 87 ILE HG12 H N N 88 ILE HG13 H N N 89 ILE HG21 H N N 90 ILE HG22 H N N 91 ILE HG23 H N N 92 ILE HD11 H N N 93 ILE HD12 H N N 94 ILE HD13 H N N 95 ILE HXT H N N 96 LEU N N N N 97 LEU CA C N S 98 LEU C C N N 99 LEU O O N N 100 LEU CB C N N 101 LEU CG C N N 102 LEU CD1 C N N 103 LEU CD2 C N N 104 LEU OXT O N N 105 LEU H H N N 106 LEU H2 H N N 107 LEU HA H N N 108 LEU HB2 H N N 109 LEU HB3 H N N 110 LEU HG H N N 111 LEU HD11 H N N 112 LEU HD12 H N N 113 LEU HD13 H N N 114 LEU HD21 H N N 115 LEU HD22 H N N 116 LEU HD23 H N N 117 LEU HXT H N N 118 LYS N N N N 119 LYS CA C N S 120 LYS C C N N 121 LYS O O N N 122 LYS CB C N N 123 LYS CG C N N 124 LYS CD C N N 125 LYS CE C N N 126 LYS NZ N N N 127 LYS OXT O N N 128 LYS H H N N 129 LYS H2 H N N 130 LYS HA H N N 131 LYS HB2 H N N 132 LYS HB3 H N N 133 LYS HG2 H N N 134 LYS HG3 H N N 135 LYS HD2 H N N 136 LYS HD3 H N N 137 LYS HE2 H N N 138 LYS HE3 H N N 139 LYS HZ1 H N N 140 LYS HZ2 H N N 141 LYS HZ3 H N N 142 LYS HXT H N N 143 PHE N N N N 144 PHE CA C N S 145 PHE C C N N 146 PHE O O N N 147 PHE CB C N N 148 PHE CG C Y N 149 PHE CD1 C Y N 150 PHE CD2 C Y N 151 PHE CE1 C Y N 152 PHE CE2 C Y N 153 PHE CZ C Y N 154 PHE OXT O N N 155 PHE H H N N 156 PHE H2 H N N 157 PHE HA H N N 158 PHE HB2 H N N 159 PHE HB3 H N N 160 PHE HD1 H N N 161 PHE HD2 H N N 162 PHE HE1 H N N 163 PHE HE2 H N N 164 PHE HZ H N N 165 PHE HXT H N N 166 PRO N N N N 167 PRO CA C N S 168 PRO C C N N 169 PRO O O N N 170 PRO CB C N N 171 PRO CG C N N 172 PRO CD C N N 173 PRO OXT O N N 174 PRO H H N N 175 PRO HA H N N 176 PRO HB2 H N N 177 PRO HB3 H N N 178 PRO HG2 H N N 179 PRO HG3 H N N 180 PRO HD2 H N N 181 PRO HD3 H N N 182 PRO HXT H N N 183 SER N N N N 184 SER CA C N S 185 SER C C N N 186 SER O O N N 187 SER CB C N N 188 SER OG O N N 189 SER OXT O N N 190 SER H H N N 191 SER H2 H N N 192 SER HA H N N 193 SER HB2 H N N 194 SER HB3 H N N 195 SER HG H N N 196 SER HXT H N N 197 VAL N N N N 198 VAL CA C N S 199 VAL C C N N 200 VAL O O N N 201 VAL CB C N N 202 VAL CG1 C N N 203 VAL CG2 C N N 204 VAL OXT O N N 205 VAL H H N N 206 VAL H2 H N N 207 VAL HA H N N 208 VAL HB H N N 209 VAL HG11 H N N 210 VAL HG12 H N N 211 VAL HG13 H N N 212 VAL HG21 H N N 213 VAL HG22 H N N 214 VAL HG23 H N N 215 VAL HXT H N N 216 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 GLN N CA sing N N 43 GLN N H sing N N 44 GLN N H2 sing N N 45 GLN CA C sing N N 46 GLN CA CB sing N N 47 GLN CA HA sing N N 48 GLN C O doub N N 49 GLN C OXT sing N N 50 GLN CB CG sing N N 51 GLN CB HB2 sing N N 52 GLN CB HB3 sing N N 53 GLN CG CD sing N N 54 GLN CG HG2 sing N N 55 GLN CG HG3 sing N N 56 GLN CD OE1 doub N N 57 GLN CD NE2 sing N N 58 GLN NE2 HE21 sing N N 59 GLN NE2 HE22 sing N N 60 GLN OXT HXT sing N N 61 GLY N CA sing N N 62 GLY N H sing N N 63 GLY N H2 sing N N 64 GLY CA C sing N N 65 GLY CA HA2 sing N N 66 GLY CA HA3 sing N N 67 GLY C O doub N N 68 GLY C OXT sing N N 69 GLY OXT HXT sing N N 70 ILE N CA sing N N 71 ILE N H sing N N 72 ILE N H2 sing N N 73 ILE CA C sing N N 74 ILE CA CB sing N N 75 ILE CA HA sing N N 76 ILE C O doub N N 77 ILE C OXT sing N N 78 ILE CB CG1 sing N N 79 ILE CB CG2 sing N N 80 ILE CB HB sing N N 81 ILE CG1 CD1 sing N N 82 ILE CG1 HG12 sing N N 83 ILE CG1 HG13 sing N N 84 ILE CG2 HG21 sing N N 85 ILE CG2 HG22 sing N N 86 ILE CG2 HG23 sing N N 87 ILE CD1 HD11 sing N N 88 ILE CD1 HD12 sing N N 89 ILE CD1 HD13 sing N N 90 ILE OXT HXT sing N N 91 LEU N CA sing N N 92 LEU N H sing N N 93 LEU N H2 sing N N 94 LEU CA C sing N N 95 LEU CA CB sing N N 96 LEU CA HA sing N N 97 LEU C O doub N N 98 LEU C OXT sing N N 99 LEU CB CG sing N N 100 LEU CB HB2 sing N N 101 LEU CB HB3 sing N N 102 LEU CG CD1 sing N N 103 LEU CG CD2 sing N N 104 LEU CG HG sing N N 105 LEU CD1 HD11 sing N N 106 LEU CD1 HD12 sing N N 107 LEU CD1 HD13 sing N N 108 LEU CD2 HD21 sing N N 109 LEU CD2 HD22 sing N N 110 LEU CD2 HD23 sing N N 111 LEU OXT HXT sing N N 112 LYS N CA sing N N 113 LYS N H sing N N 114 LYS N H2 sing N N 115 LYS CA C sing N N 116 LYS CA CB sing N N 117 LYS CA HA sing N N 118 LYS C O doub N N 119 LYS C OXT sing N N 120 LYS CB CG sing N N 121 LYS CB HB2 sing N N 122 LYS CB HB3 sing N N 123 LYS CG CD sing N N 124 LYS CG HG2 sing N N 125 LYS CG HG3 sing N N 126 LYS CD CE sing N N 127 LYS CD HD2 sing N N 128 LYS CD HD3 sing N N 129 LYS CE NZ sing N N 130 LYS CE HE2 sing N N 131 LYS CE HE3 sing N N 132 LYS NZ HZ1 sing N N 133 LYS NZ HZ2 sing N N 134 LYS NZ HZ3 sing N N 135 LYS OXT HXT sing N N 136 PHE N CA sing N N 137 PHE N H sing N N 138 PHE N H2 sing N N 139 PHE CA C sing N N 140 PHE CA CB sing N N 141 PHE CA HA sing N N 142 PHE C O doub N N 143 PHE C OXT sing N N 144 PHE CB CG sing N N 145 PHE CB HB2 sing N N 146 PHE CB HB3 sing N N 147 PHE CG CD1 doub Y N 148 PHE CG CD2 sing Y N 149 PHE CD1 CE1 sing Y N 150 PHE CD1 HD1 sing N N 151 PHE CD2 CE2 doub Y N 152 PHE CD2 HD2 sing N N 153 PHE CE1 CZ doub Y N 154 PHE CE1 HE1 sing N N 155 PHE CE2 CZ sing Y N 156 PHE CE2 HE2 sing N N 157 PHE CZ HZ sing N N 158 PHE OXT HXT sing N N 159 PRO N CA sing N N 160 PRO N CD sing N N 161 PRO N H sing N N 162 PRO CA C sing N N 163 PRO CA CB sing N N 164 PRO CA HA sing N N 165 PRO C O doub N N 166 PRO C OXT sing N N 167 PRO CB CG sing N N 168 PRO CB HB2 sing N N 169 PRO CB HB3 sing N N 170 PRO CG CD sing N N 171 PRO CG HG2 sing N N 172 PRO CG HG3 sing N N 173 PRO CD HD2 sing N N 174 PRO CD HD3 sing N N 175 PRO OXT HXT sing N N 176 SER N CA sing N N 177 SER N H sing N N 178 SER N H2 sing N N 179 SER CA C sing N N 180 SER CA CB sing N N 181 SER CA HA sing N N 182 SER C O doub N N 183 SER C OXT sing N N 184 SER CB OG sing N N 185 SER CB HB2 sing N N 186 SER CB HB3 sing N N 187 SER OG HG sing N N 188 SER OXT HXT sing N N 189 VAL N CA sing N N 190 VAL N H sing N N 191 VAL N H2 sing N N 192 VAL CA C sing N N 193 VAL CA CB sing N N 194 VAL CA HA sing N N 195 VAL C O doub N N 196 VAL C OXT sing N N 197 VAL CB CG1 sing N N 198 VAL CB CG2 sing N N 199 VAL CB HB sing N N 200 VAL CG1 HG11 sing N N 201 VAL CG1 HG12 sing N N 202 VAL CG1 HG13 sing N N 203 VAL CG2 HG21 sing N N 204 VAL CG2 HG22 sing N N 205 VAL CG2 HG23 sing N N 206 VAL OXT HXT sing N N 207 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 'CRC1035, B13' _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7OFO _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_