data_7OQ8 # _entry.id 7OQ8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.359 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7OQ8 pdb_00007oq8 10.2210/pdb7oq8/pdb WWPDB D_1292116220 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7OQ8 _pdbx_database_status.recvd_initial_deposition_date 2021-06-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Centorrino, F.' 1 ? 'Ottmann, C.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'A crystallography-based study of fragment extensions into the 14-3-3 binding groove' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Centorrino, F.' 1 ? primary 'Wu, Q.' 2 ? primary 'Cossar, P.' 3 ? primary 'Brunsveld, L.' 4 ? primary 'Ottmann, C.' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7OQ8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 82.018 _cell.length_a_esd ? _cell.length_b 110.832 _cell.length_b_esd ? _cell.length_c 60.932 _cell.length_c_esd ? _cell.volume 553889.300 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7OQ8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '14-3-3 protein sigma' 28210.518 1 ? ? ? ? 2 polymer syn 'Estrogen receptor' 1726.794 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 3 ? ? ? ? 4 non-polymer syn BETA-MERCAPTOETHANOL 78.133 1 ? ? ? ? 5 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 6 non-polymer syn '~{N}-[(5-carbamimidoyl-3-phenyl-thiophen-2-yl)methyl]-1~{H}-indole-6-carboxamide' 374.459 2 ? ? ? ? 7 water nat water 18.015 265 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Epithelial cell marker protein 1,Stratifin' 2 'ER,ER-alpha,Estradiol receptor,Nuclear receptor subfamily 3 group A member 1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM DISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNA GEEGGEAPQEPQS ; ;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM DISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNA GEEGGEAPQEPQS ; A ? 2 'polypeptide(L)' no yes 'KYYITGEAEGFPA(TPO)V' KYYITGEAEGFPATV B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 GLU n 1 8 ARG n 1 9 ALA n 1 10 SER n 1 11 LEU n 1 12 ILE n 1 13 GLN n 1 14 LYS n 1 15 ALA n 1 16 LYS n 1 17 LEU n 1 18 ALA n 1 19 GLU n 1 20 GLN n 1 21 ALA n 1 22 GLU n 1 23 ARG n 1 24 TYR n 1 25 GLU n 1 26 ASP n 1 27 MET n 1 28 ALA n 1 29 ALA n 1 30 PHE n 1 31 MET n 1 32 LYS n 1 33 GLY n 1 34 ALA n 1 35 VAL n 1 36 GLU n 1 37 LYS n 1 38 GLY n 1 39 GLU n 1 40 GLU n 1 41 LEU n 1 42 SER n 1 43 CYS n 1 44 GLU n 1 45 GLU n 1 46 ARG n 1 47 ASN n 1 48 LEU n 1 49 LEU n 1 50 SER n 1 51 VAL n 1 52 ALA n 1 53 TYR n 1 54 LYS n 1 55 ASN n 1 56 VAL n 1 57 VAL n 1 58 GLY n 1 59 GLY n 1 60 GLN n 1 61 ARG n 1 62 ALA n 1 63 ALA n 1 64 TRP n 1 65 ARG n 1 66 VAL n 1 67 LEU n 1 68 SER n 1 69 SER n 1 70 ILE n 1 71 GLU n 1 72 GLN n 1 73 LYS n 1 74 SER n 1 75 ASN n 1 76 GLU n 1 77 GLU n 1 78 GLY n 1 79 SER n 1 80 GLU n 1 81 GLU n 1 82 LYS n 1 83 GLY n 1 84 PRO n 1 85 GLU n 1 86 VAL n 1 87 ARG n 1 88 GLU n 1 89 TYR n 1 90 ARG n 1 91 GLU n 1 92 LYS n 1 93 VAL n 1 94 GLU n 1 95 THR n 1 96 GLU n 1 97 LEU n 1 98 GLN n 1 99 GLY n 1 100 VAL n 1 101 CYS n 1 102 ASP n 1 103 THR n 1 104 VAL n 1 105 LEU n 1 106 GLY n 1 107 LEU n 1 108 LEU n 1 109 ASP n 1 110 SER n 1 111 HIS n 1 112 LEU n 1 113 ILE n 1 114 LYS n 1 115 GLU n 1 116 ALA n 1 117 GLY n 1 118 ASP n 1 119 ALA n 1 120 GLU n 1 121 SER n 1 122 ARG n 1 123 VAL n 1 124 PHE n 1 125 TYR n 1 126 LEU n 1 127 LYS n 1 128 MET n 1 129 LYS n 1 130 GLY n 1 131 ASP n 1 132 TYR n 1 133 TYR n 1 134 ARG n 1 135 TYR n 1 136 LEU n 1 137 ALA n 1 138 GLU n 1 139 VAL n 1 140 ALA n 1 141 THR n 1 142 GLY n 1 143 ASP n 1 144 ASP n 1 145 LYS n 1 146 LYS n 1 147 ARG n 1 148 ILE n 1 149 ILE n 1 150 ASP n 1 151 SER n 1 152 ALA n 1 153 ARG n 1 154 SER n 1 155 ALA n 1 156 TYR n 1 157 GLN n 1 158 GLU n 1 159 ALA n 1 160 MET n 1 161 ASP n 1 162 ILE n 1 163 SER n 1 164 LYS n 1 165 LYS n 1 166 GLU n 1 167 MET n 1 168 PRO n 1 169 PRO n 1 170 THR n 1 171 ASN n 1 172 PRO n 1 173 ILE n 1 174 ARG n 1 175 LEU n 1 176 GLY n 1 177 LEU n 1 178 ALA n 1 179 LEU n 1 180 ASN n 1 181 PHE n 1 182 SER n 1 183 VAL n 1 184 PHE n 1 185 HIS n 1 186 TYR n 1 187 GLU n 1 188 ILE n 1 189 ALA n 1 190 ASN n 1 191 SER n 1 192 PRO n 1 193 GLU n 1 194 GLU n 1 195 ALA n 1 196 ILE n 1 197 SER n 1 198 LEU n 1 199 ALA n 1 200 LYS n 1 201 THR n 1 202 THR n 1 203 PHE n 1 204 ASP n 1 205 GLU n 1 206 ALA n 1 207 MET n 1 208 ALA n 1 209 ASP n 1 210 LEU n 1 211 HIS n 1 212 THR n 1 213 LEU n 1 214 SER n 1 215 GLU n 1 216 ASP n 1 217 SER n 1 218 TYR n 1 219 LYS n 1 220 ASP n 1 221 SER n 1 222 THR n 1 223 LEU n 1 224 ILE n 1 225 MET n 1 226 GLN n 1 227 LEU n 1 228 LEU n 1 229 ARG n 1 230 ASP n 1 231 ASN n 1 232 LEU n 1 233 THR n 1 234 LEU n 1 235 TRP n 1 236 THR n 1 237 ALA n 1 238 ASP n 1 239 ASN n 1 240 ALA n 1 241 GLY n 1 242 GLU n 1 243 GLU n 1 244 GLY n 1 245 GLY n 1 246 GLU n 1 247 ALA n 1 248 PRO n 1 249 GLN n 1 250 GLU n 1 251 PRO n 1 252 GLN n 1 253 SER n 2 1 LYS n 2 2 TYR n 2 3 TYR n 2 4 ILE n 2 5 THR n 2 6 GLY n 2 7 GLU n 2 8 ALA n 2 9 GLU n 2 10 GLY n 2 11 PHE n 2 12 PRO n 2 13 ALA n 2 14 TPO n 2 15 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 253 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SFN, HME1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 15 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP 1433S_HUMAN P31947 ? 1 ;MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPE VREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKK EMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGG EAPQEPQS ; 1 2 UNP ESR1_HUMAN P03372 ? 2 KYYITGEAEGFPATV 581 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7OQ8 A 6 ? 253 ? P31947 1 ? 248 ? 1 248 2 2 7OQ8 B 1 ? 15 ? P03372 581 ? 595 ? 581 595 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7OQ8 GLY A 1 ? UNP P31947 ? ? 'expression tag' -4 1 1 7OQ8 ALA A 2 ? UNP P31947 ? ? 'expression tag' -3 2 1 7OQ8 MET A 3 ? UNP P31947 ? ? 'expression tag' -2 3 1 7OQ8 GLY A 4 ? UNP P31947 ? ? 'expression tag' -1 4 1 7OQ8 SER A 5 ? UNP P31947 ? ? 'expression tag' 0 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0B7 non-polymer . '~{N}-[(5-carbamimidoyl-3-phenyl-thiophen-2-yl)methyl]-1~{H}-indole-6-carboxamide' ? 'C21 H18 N4 O S' 374.459 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BME non-polymer . BETA-MERCAPTOETHANOL ? 'C2 H6 O S' 78.133 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7OQ8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.31 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.82 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.095 M Hepes pH7.5, 26%PEG 400, 0.19 M CaCl2, and 5 % Glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-27 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.96546 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.96546 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 16.39 _reflns.entry_id 7OQ8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.43 _reflns.d_resolution_low 65.93 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 51452 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.3 _reflns.pdbx_Rmerge_I_obs 0.058 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.983 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.43 _reflns_shell.d_res_low 1.45 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2542 _reflns_shell.percent_possible_all 99.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.896 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.467 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 22.63 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7OQ8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.43 _refine.ls_d_res_low 65.93 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 51437 _refine.ls_number_reflns_R_free 3688 _refine.ls_number_reflns_R_work 91297 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.71 _refine.ls_percent_reflns_R_free 3.88 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1807 _refine.ls_R_factor_R_free 0.2056 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1797 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4JC3 _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.1369 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1763 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.43 _refine_hist.d_res_low 65.93 _refine_hist.number_atoms_solvent 265 _refine_hist.number_atoms_total 2119 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1792 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 62 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0079 ? 1943 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.2019 ? 2637 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0609 ? 287 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0056 ? 344 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 20.9671 ? 711 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.43 1.45 . . 145 3609 97.96 . . . 0.3805 . 0.3291 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.45 1.47 . . 143 3588 97.24 . . . 0.3223 . 0.3187 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.47 1.49 . . 143 3574 97.00 . . . 0.3440 . 0.2911 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.49 1.51 . . 143 3514 96.16 . . . 0.2783 . 0.2783 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.51 1.54 . . 138 3466 94.30 . . . 0.3192 . 0.2781 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.54 1.56 . . 137 3405 93.06 . . . 0.2878 . 0.2712 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.56 1.59 . . 131 3199 87.61 . . . 0.2780 . 0.2581 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.59 1.62 . . 138 3275 89.67 . . . 0.2303 . 0.2303 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.62 1.65 . . 140 3495 93.81 . . . 0.2285 . 0.2285 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.65 1.68 . . 144 3600 98.60 . . . 0.2708 . 0.2213 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.68 1.72 . . 144 3562 98.67 . . . 0.2220 . 0.2167 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.72 1.76 . . 145 3618 98.77 . . . 0.2257 . 0.2170 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.76 1.80 . . 153 3659 98.76 . . . 0.2185 . 0.2031 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.80 1.85 . . 151 3587 98.37 . . . 0.2152 . 0.2025 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.85 1.90 . . 146 3606 97.91 . . . 0.2228 . 0.1916 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.90 1.97 . . 137 3587 97.64 . . . 0.2380 . 0.1841 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.97 2.04 . . 148 3544 96.67 . . . 0.1904 . 0.1771 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.04 2.12 . . 138 3400 93.52 . . . 0.1862 . 0.1674 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.12 2.21 . . 119 3207 86.52 . . . 0.1735 . 0.1588 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.21 2.33 . . 134 3352 91.42 . . . 0.1840 . 0.1454 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.33 2.48 . . 149 3615 98.92 . . . 0.1762 . 0.1513 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.48 2.67 . . 150 3641 99.29 . . . 0.1687 . 0.1570 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.67 2.94 . . 144 3627 99.11 . . . 0.2009 . 0.1557 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.94 3.36 . . 144 3640 99.03 . . . 0.1766 . 0.1602 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.36 4.24 . . 138 3364 91.53 . . . 0.1766 . 0.1466 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.24 65.93 . . 146 3563 96.99 . . . 0.2160 . 0.1740 . . . . . . . . . . . # _struct.entry_id 7OQ8 _struct.title 'Ternary complex of 14-3-3 sigma, Estrogen Receptor alfa phosphopeptide, and WQ178' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7OQ8 _struct_keywords.text 'protein-peptide complex small-molecule, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 5 ? H N N 6 ? I N N 6 ? J N N 7 ? K N N 7 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 7 ? ALA A 21 ? GLU A 2 ALA A 16 1 ? 15 HELX_P HELX_P2 AA2 ARG A 23 ? GLU A 36 ? ARG A 18 GLU A 31 1 ? 14 HELX_P HELX_P3 AA3 SER A 42 ? SER A 74 ? SER A 37 SER A 69 1 ? 33 HELX_P HELX_P4 AA4 PRO A 84 ? SER A 110 ? PRO A 79 SER A 105 1 ? 27 HELX_P HELX_P5 AA5 HIS A 111 ? ALA A 116 ? HIS A 106 ALA A 111 1 ? 6 HELX_P HELX_P6 AA6 ASP A 118 ? ALA A 140 ? ASP A 113 ALA A 135 1 ? 23 HELX_P HELX_P7 AA7 LYS A 145 ? MET A 167 ? LYS A 140 MET A 162 1 ? 23 HELX_P HELX_P8 AA8 ASN A 171 ? ILE A 188 ? ASN A 166 ILE A 183 1 ? 18 HELX_P HELX_P9 AA9 SER A 191 ? ALA A 208 ? SER A 186 ALA A 203 1 ? 18 HELX_P HELX_P10 AB1 ASP A 209 ? LEU A 213 ? ASP A 204 LEU A 208 5 ? 5 HELX_P HELX_P11 AB2 SER A 214 ? THR A 236 ? SER A 209 THR A 231 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 43 SG ? ? ? 1_555 F BME . S2 ? ? A CYS 38 A BME 304 1_555 ? ? ? ? ? ? ? 2.011 ? ? covale2 covale both ? B ALA 13 C ? ? ? 1_555 B TPO 14 N ? ? B ALA 593 B TPO 594 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale3 covale both ? B TPO 14 C ? ? ? 1_555 B VAL 15 N ? ? B TPO 594 B VAL 595 1_555 ? ? ? ? ? ? ? 1.323 ? ? metalc1 metalc ? ? A GLU 7 OE1 ? ? ? 1_555 C MG . MG ? ? A GLU 2 A MG 301 1_555 ? ? ? ? ? ? ? 2.491 ? ? metalc2 metalc ? ? A GLU 7 OE1 ? ? ? 1_555 C MG . MG ? ? A GLU 2 A MG 301 3_654 ? ? ? ? ? ? ? 2.491 ? ? metalc3 metalc ? ? A GLU 40 OE2 ? ? ? 1_555 E MG . MG ? ? A GLU 35 A MG 303 1_555 ? ? ? ? ? ? ? 2.012 ? ? metalc4 metalc ? ? A GLU 94 OE2 ? ? ? 1_555 D MG . MG ? ? A GLU 89 A MG 302 1_555 ? ? ? ? ? ? ? 2.372 ? ? metalc5 metalc ? ? A GLU 115 O ? ? ? 1_555 E MG . MG ? ? A GLU 110 A MG 303 1_555 ? ? ? ? ? ? ? 2.400 ? ? metalc6 metalc ? ? A GLU 193 OE2 ? ? ? 1_555 E MG . MG ? ? A GLU 188 A MG 303 6_555 ? ? ? ? ? ? ? 2.330 ? ? metalc7 metalc ? ? C MG . MG ? ? ? 1_555 J HOH . O ? ? A MG 301 A HOH 441 1_555 ? ? ? ? ? ? ? 2.477 ? ? metalc8 metalc ? ? C MG . MG ? ? ? 1_555 J HOH . O ? ? A MG 301 A HOH 441 3_654 ? ? ? ? ? ? ? 2.478 ? ? metalc9 metalc ? ? C MG . MG ? ? ? 1_555 J HOH . O ? ? A MG 301 A HOH 589 1_555 ? ? ? ? ? ? ? 2.456 ? ? metalc10 metalc ? ? C MG . MG ? ? ? 1_555 J HOH . O ? ? A MG 301 A HOH 589 3_654 ? ? ? ? ? ? ? 2.456 ? ? metalc11 metalc ? ? D MG . MG ? ? ? 1_555 J HOH . O ? ? A MG 302 A HOH 444 1_555 ? ? ? ? ? ? ? 2.035 ? ? metalc12 metalc ? ? D MG . MG ? ? ? 1_555 J HOH . O ? ? A MG 302 A HOH 448 1_555 ? ? ? ? ? ? ? 2.149 ? ? metalc13 metalc ? ? E MG . MG ? ? ? 1_555 J HOH . O ? ? A MG 303 A HOH 479 1_555 ? ? ? ? ? ? ? 2.143 ? ? metalc14 metalc ? ? E MG . MG ? ? ? 1_555 J HOH . O ? ? A MG 303 A HOH 601 6_554 ? ? ? ? ? ? ? 2.563 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 110 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 105 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 HIS _struct_mon_prot_cis.pdbx_label_seq_id_2 111 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 HIS _struct_mon_prot_cis.pdbx_auth_seq_id_2 106 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.98 # _atom_sites.entry_id 7OQ8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012192 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009023 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016412 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? ? ? ? ? ? ? ? CL1- ? ? 10.45091 7.48833 1.54457 31.67128 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 24.73122 6.32584 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 2.59044 63.03566 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 15.80542 1.70748 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 1.42069 35.72801 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 -4 GLY GLY A . n A 1 2 ALA 2 -3 -3 ALA ALA A . n A 1 3 MET 3 -2 -2 MET MET A . n A 1 4 GLY 4 -1 -1 GLY GLY A . n A 1 5 SER 5 0 0 SER SER A . n A 1 6 MET 6 1 1 MET MET A . n A 1 7 GLU 7 2 2 GLU GLU A . n A 1 8 ARG 8 3 3 ARG ARG A . n A 1 9 ALA 9 4 4 ALA ALA A . n A 1 10 SER 10 5 5 SER SER A . n A 1 11 LEU 11 6 6 LEU LEU A . n A 1 12 ILE 12 7 7 ILE ILE A . n A 1 13 GLN 13 8 8 GLN GLN A . n A 1 14 LYS 14 9 9 LYS LYS A . n A 1 15 ALA 15 10 10 ALA ALA A . n A 1 16 LYS 16 11 11 LYS LYS A . n A 1 17 LEU 17 12 12 LEU LEU A . n A 1 18 ALA 18 13 13 ALA ALA A . n A 1 19 GLU 19 14 14 GLU GLU A . n A 1 20 GLN 20 15 15 GLN GLN A . n A 1 21 ALA 21 16 16 ALA ALA A . n A 1 22 GLU 22 17 17 GLU GLU A . n A 1 23 ARG 23 18 18 ARG ARG A . n A 1 24 TYR 24 19 19 TYR TYR A . n A 1 25 GLU 25 20 20 GLU GLU A . n A 1 26 ASP 26 21 21 ASP ASP A . n A 1 27 MET 27 22 22 MET MET A . n A 1 28 ALA 28 23 23 ALA ALA A . n A 1 29 ALA 29 24 24 ALA ALA A . n A 1 30 PHE 30 25 25 PHE PHE A . n A 1 31 MET 31 26 26 MET MET A . n A 1 32 LYS 32 27 27 LYS LYS A . n A 1 33 GLY 33 28 28 GLY GLY A . n A 1 34 ALA 34 29 29 ALA ALA A . n A 1 35 VAL 35 30 30 VAL VAL A . n A 1 36 GLU 36 31 31 GLU GLU A . n A 1 37 LYS 37 32 32 LYS LYS A . n A 1 38 GLY 38 33 33 GLY GLY A . n A 1 39 GLU 39 34 34 GLU GLU A . n A 1 40 GLU 40 35 35 GLU GLU A . n A 1 41 LEU 41 36 36 LEU LEU A . n A 1 42 SER 42 37 37 SER SER A . n A 1 43 CYS 43 38 38 CYS CYS A . n A 1 44 GLU 44 39 39 GLU GLU A . n A 1 45 GLU 45 40 40 GLU GLU A . n A 1 46 ARG 46 41 41 ARG ARG A . n A 1 47 ASN 47 42 42 ASN ASN A . n A 1 48 LEU 48 43 43 LEU LEU A . n A 1 49 LEU 49 44 44 LEU LEU A . n A 1 50 SER 50 45 45 SER SER A . n A 1 51 VAL 51 46 46 VAL VAL A . n A 1 52 ALA 52 47 47 ALA ALA A . n A 1 53 TYR 53 48 48 TYR TYR A . n A 1 54 LYS 54 49 49 LYS LYS A . n A 1 55 ASN 55 50 50 ASN ASN A . n A 1 56 VAL 56 51 51 VAL VAL A . n A 1 57 VAL 57 52 52 VAL VAL A . n A 1 58 GLY 58 53 53 GLY GLY A . n A 1 59 GLY 59 54 54 GLY GLY A . n A 1 60 GLN 60 55 55 GLN GLN A . n A 1 61 ARG 61 56 56 ARG ARG A . n A 1 62 ALA 62 57 57 ALA ALA A . n A 1 63 ALA 63 58 58 ALA ALA A . n A 1 64 TRP 64 59 59 TRP TRP A . n A 1 65 ARG 65 60 60 ARG ARG A . n A 1 66 VAL 66 61 61 VAL VAL A . n A 1 67 LEU 67 62 62 LEU LEU A . n A 1 68 SER 68 63 63 SER SER A . n A 1 69 SER 69 64 64 SER SER A . n A 1 70 ILE 70 65 65 ILE ILE A . n A 1 71 GLU 71 66 66 GLU GLU A . n A 1 72 GLN 72 67 67 GLN GLN A . n A 1 73 LYS 73 68 68 LYS LYS A . n A 1 74 SER 74 69 69 SER SER A . n A 1 75 ASN 75 70 70 ASN ASN A . n A 1 76 GLU 76 71 ? ? ? A . n A 1 77 GLU 77 72 ? ? ? A . n A 1 78 GLY 78 73 ? ? ? A . n A 1 79 SER 79 74 ? ? ? A . n A 1 80 GLU 80 75 ? ? ? A . n A 1 81 GLU 81 76 ? ? ? A . n A 1 82 LYS 82 77 ? ? ? A . n A 1 83 GLY 83 78 78 GLY GLY A . n A 1 84 PRO 84 79 79 PRO PRO A . n A 1 85 GLU 85 80 80 GLU GLU A . n A 1 86 VAL 86 81 81 VAL VAL A . n A 1 87 ARG 87 82 82 ARG ARG A . n A 1 88 GLU 88 83 83 GLU GLU A . n A 1 89 TYR 89 84 84 TYR TYR A . n A 1 90 ARG 90 85 85 ARG ARG A . n A 1 91 GLU 91 86 86 GLU GLU A . n A 1 92 LYS 92 87 87 LYS LYS A . n A 1 93 VAL 93 88 88 VAL VAL A . n A 1 94 GLU 94 89 89 GLU GLU A . n A 1 95 THR 95 90 90 THR THR A . n A 1 96 GLU 96 91 91 GLU GLU A . n A 1 97 LEU 97 92 92 LEU LEU A . n A 1 98 GLN 98 93 93 GLN GLN A . n A 1 99 GLY 99 94 94 GLY GLY A . n A 1 100 VAL 100 95 95 VAL VAL A . n A 1 101 CYS 101 96 96 CYS CYS A . n A 1 102 ASP 102 97 97 ASP ASP A . n A 1 103 THR 103 98 98 THR THR A . n A 1 104 VAL 104 99 99 VAL VAL A . n A 1 105 LEU 105 100 100 LEU LEU A . n A 1 106 GLY 106 101 101 GLY GLY A . n A 1 107 LEU 107 102 102 LEU LEU A . n A 1 108 LEU 108 103 103 LEU LEU A . n A 1 109 ASP 109 104 104 ASP ASP A . n A 1 110 SER 110 105 105 SER SER A . n A 1 111 HIS 111 106 106 HIS HIS A . n A 1 112 LEU 112 107 107 LEU LEU A . n A 1 113 ILE 113 108 108 ILE ILE A . n A 1 114 LYS 114 109 109 LYS LYS A . n A 1 115 GLU 115 110 110 GLU GLU A . n A 1 116 ALA 116 111 111 ALA ALA A . n A 1 117 GLY 117 112 112 GLY GLY A . n A 1 118 ASP 118 113 113 ASP ASP A . n A 1 119 ALA 119 114 114 ALA ALA A . n A 1 120 GLU 120 115 115 GLU GLU A . n A 1 121 SER 121 116 116 SER SER A . n A 1 122 ARG 122 117 117 ARG ARG A . n A 1 123 VAL 123 118 118 VAL VAL A . n A 1 124 PHE 124 119 119 PHE PHE A . n A 1 125 TYR 125 120 120 TYR TYR A . n A 1 126 LEU 126 121 121 LEU LEU A . n A 1 127 LYS 127 122 122 LYS LYS A . n A 1 128 MET 128 123 123 MET MET A . n A 1 129 LYS 129 124 124 LYS LYS A . n A 1 130 GLY 130 125 125 GLY GLY A . n A 1 131 ASP 131 126 126 ASP ASP A . n A 1 132 TYR 132 127 127 TYR TYR A . n A 1 133 TYR 133 128 128 TYR TYR A . n A 1 134 ARG 134 129 129 ARG ARG A . n A 1 135 TYR 135 130 130 TYR TYR A . n A 1 136 LEU 136 131 131 LEU LEU A . n A 1 137 ALA 137 132 132 ALA ALA A . n A 1 138 GLU 138 133 133 GLU GLU A . n A 1 139 VAL 139 134 134 VAL VAL A . n A 1 140 ALA 140 135 135 ALA ALA A . n A 1 141 THR 141 136 136 THR THR A . n A 1 142 GLY 142 137 137 GLY GLY A . n A 1 143 ASP 143 138 ? ? ? A . n A 1 144 ASP 144 139 139 ASP ASP A . n A 1 145 LYS 145 140 140 LYS LYS A . n A 1 146 LYS 146 141 141 LYS LYS A . n A 1 147 ARG 147 142 142 ARG ARG A . n A 1 148 ILE 148 143 143 ILE ILE A . n A 1 149 ILE 149 144 144 ILE ILE A . n A 1 150 ASP 150 145 145 ASP ASP A . n A 1 151 SER 151 146 146 SER SER A . n A 1 152 ALA 152 147 147 ALA ALA A . n A 1 153 ARG 153 148 148 ARG ARG A . n A 1 154 SER 154 149 149 SER SER A . n A 1 155 ALA 155 150 150 ALA ALA A . n A 1 156 TYR 156 151 151 TYR TYR A . n A 1 157 GLN 157 152 152 GLN GLN A . n A 1 158 GLU 158 153 153 GLU GLU A . n A 1 159 ALA 159 154 154 ALA ALA A . n A 1 160 MET 160 155 155 MET MET A . n A 1 161 ASP 161 156 156 ASP ASP A . n A 1 162 ILE 162 157 157 ILE ILE A . n A 1 163 SER 163 158 158 SER SER A . n A 1 164 LYS 164 159 159 LYS LYS A . n A 1 165 LYS 165 160 160 LYS LYS A . n A 1 166 GLU 166 161 161 GLU GLU A . n A 1 167 MET 167 162 162 MET MET A . n A 1 168 PRO 168 163 163 PRO PRO A . n A 1 169 PRO 169 164 164 PRO PRO A . n A 1 170 THR 170 165 165 THR THR A . n A 1 171 ASN 171 166 166 ASN ASN A . n A 1 172 PRO 172 167 167 PRO PRO A . n A 1 173 ILE 173 168 168 ILE ILE A . n A 1 174 ARG 174 169 169 ARG ARG A . n A 1 175 LEU 175 170 170 LEU LEU A . n A 1 176 GLY 176 171 171 GLY GLY A . n A 1 177 LEU 177 172 172 LEU LEU A . n A 1 178 ALA 178 173 173 ALA ALA A . n A 1 179 LEU 179 174 174 LEU LEU A . n A 1 180 ASN 180 175 175 ASN ASN A . n A 1 181 PHE 181 176 176 PHE PHE A . n A 1 182 SER 182 177 177 SER SER A . n A 1 183 VAL 183 178 178 VAL VAL A . n A 1 184 PHE 184 179 179 PHE PHE A . n A 1 185 HIS 185 180 180 HIS HIS A . n A 1 186 TYR 186 181 181 TYR TYR A . n A 1 187 GLU 187 182 182 GLU GLU A . n A 1 188 ILE 188 183 183 ILE ILE A . n A 1 189 ALA 189 184 184 ALA ALA A . n A 1 190 ASN 190 185 185 ASN ASN A . n A 1 191 SER 191 186 186 SER SER A . n A 1 192 PRO 192 187 187 PRO PRO A . n A 1 193 GLU 193 188 188 GLU GLU A . n A 1 194 GLU 194 189 189 GLU GLU A . n A 1 195 ALA 195 190 190 ALA ALA A . n A 1 196 ILE 196 191 191 ILE ILE A . n A 1 197 SER 197 192 192 SER SER A . n A 1 198 LEU 198 193 193 LEU LEU A . n A 1 199 ALA 199 194 194 ALA ALA A . n A 1 200 LYS 200 195 195 LYS LYS A . n A 1 201 THR 201 196 196 THR THR A . n A 1 202 THR 202 197 197 THR THR A . n A 1 203 PHE 203 198 198 PHE PHE A . n A 1 204 ASP 204 199 199 ASP ASP A . n A 1 205 GLU 205 200 200 GLU GLU A . n A 1 206 ALA 206 201 201 ALA ALA A . n A 1 207 MET 207 202 202 MET MET A . n A 1 208 ALA 208 203 203 ALA ALA A . n A 1 209 ASP 209 204 204 ASP ASP A . n A 1 210 LEU 210 205 205 LEU LEU A . n A 1 211 HIS 211 206 206 HIS HIS A . n A 1 212 THR 212 207 207 THR THR A . n A 1 213 LEU 213 208 208 LEU LEU A . n A 1 214 SER 214 209 209 SER SER A . n A 1 215 GLU 215 210 210 GLU GLU A . n A 1 216 ASP 216 211 211 ASP ASP A . n A 1 217 SER 217 212 212 SER SER A . n A 1 218 TYR 218 213 213 TYR TYR A . n A 1 219 LYS 219 214 214 LYS LYS A . n A 1 220 ASP 220 215 215 ASP ASP A . n A 1 221 SER 221 216 216 SER SER A . n A 1 222 THR 222 217 217 THR THR A . n A 1 223 LEU 223 218 218 LEU LEU A . n A 1 224 ILE 224 219 219 ILE ILE A . n A 1 225 MET 225 220 220 MET MET A . n A 1 226 GLN 226 221 221 GLN GLN A . n A 1 227 LEU 227 222 222 LEU LEU A . n A 1 228 LEU 228 223 223 LEU LEU A . n A 1 229 ARG 229 224 224 ARG ARG A . n A 1 230 ASP 230 225 225 ASP ASP A . n A 1 231 ASN 231 226 226 ASN ASN A . n A 1 232 LEU 232 227 227 LEU LEU A . n A 1 233 THR 233 228 228 THR THR A . n A 1 234 LEU 234 229 229 LEU LEU A . n A 1 235 TRP 235 230 230 TRP TRP A . n A 1 236 THR 236 231 231 THR THR A . n A 1 237 ALA 237 232 ? ? ? A . n A 1 238 ASP 238 233 ? ? ? A . n A 1 239 ASN 239 234 ? ? ? A . n A 1 240 ALA 240 235 ? ? ? A . n A 1 241 GLY 241 236 ? ? ? A . n A 1 242 GLU 242 237 ? ? ? A . n A 1 243 GLU 243 238 ? ? ? A . n A 1 244 GLY 244 239 ? ? ? A . n A 1 245 GLY 245 240 ? ? ? A . n A 1 246 GLU 246 241 ? ? ? A . n A 1 247 ALA 247 242 ? ? ? A . n A 1 248 PRO 248 243 ? ? ? A . n A 1 249 GLN 249 244 ? ? ? A . n A 1 250 GLU 250 245 ? ? ? A . n A 1 251 PRO 251 246 ? ? ? A . n A 1 252 GLN 252 247 ? ? ? A . n A 1 253 SER 253 248 ? ? ? A . n B 2 1 LYS 1 581 ? ? ? B . n B 2 2 TYR 2 582 ? ? ? B . n B 2 3 TYR 3 583 ? ? ? B . n B 2 4 ILE 4 584 ? ? ? B . n B 2 5 THR 5 585 ? ? ? B . n B 2 6 GLY 6 586 ? ? ? B . n B 2 7 GLU 7 587 ? ? ? B . n B 2 8 ALA 8 588 ? ? ? B . n B 2 9 GLU 9 589 ? ? ? B . n B 2 10 GLY 10 590 ? ? ? B . n B 2 11 PHE 11 591 591 PHE PHE B . n B 2 12 PRO 12 592 592 PRO PRO B . n B 2 13 ALA 13 593 593 ALA ALA B . n B 2 14 TPO 14 594 594 TPO TPO B . n B 2 15 VAL 15 595 595 VAL VAL B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 MG 1 301 1 MG MG A . D 3 MG 1 302 2 MG MG A . E 3 MG 1 303 3 MG MG A . F 4 BME 1 304 1 BME BME A . G 5 CL 1 305 1 CL CL A . H 6 0B7 1 306 1 0B7 WQ1 A . I 6 0B7 1 307 2 0B7 WQ1 A . J 7 HOH 1 401 106 HOH HOH A . J 7 HOH 2 402 75 HOH HOH A . J 7 HOH 3 403 71 HOH HOH A . J 7 HOH 4 404 169 HOH HOH A . J 7 HOH 5 405 114 HOH HOH A . J 7 HOH 6 406 97 HOH HOH A . J 7 HOH 7 407 88 HOH HOH A . J 7 HOH 8 408 73 HOH HOH A . J 7 HOH 9 409 203 HOH HOH A . J 7 HOH 10 410 242 HOH HOH A . J 7 HOH 11 411 192 HOH HOH A . J 7 HOH 12 412 162 HOH HOH A . J 7 HOH 13 413 143 HOH HOH A . J 7 HOH 14 414 238 HOH HOH A . J 7 HOH 15 415 191 HOH HOH A . J 7 HOH 16 416 59 HOH HOH A . J 7 HOH 17 417 64 HOH HOH A . J 7 HOH 18 418 103 HOH HOH A . J 7 HOH 19 419 65 HOH HOH A . J 7 HOH 20 420 99 HOH HOH A . J 7 HOH 21 421 180 HOH HOH A . J 7 HOH 22 422 287 HOH HOH A . J 7 HOH 23 423 134 HOH HOH A . J 7 HOH 24 424 95 HOH HOH A . J 7 HOH 25 425 229 HOH HOH A . J 7 HOH 26 426 174 HOH HOH A . J 7 HOH 27 427 219 HOH HOH A . J 7 HOH 28 428 172 HOH HOH A . J 7 HOH 29 429 133 HOH HOH A . J 7 HOH 30 430 50 HOH HOH A . J 7 HOH 31 431 107 HOH HOH A . J 7 HOH 32 432 36 HOH HOH A . J 7 HOH 33 433 237 HOH HOH A . J 7 HOH 34 434 153 HOH HOH A . J 7 HOH 35 435 220 HOH HOH A . J 7 HOH 36 436 267 HOH HOH A . J 7 HOH 37 437 9 HOH HOH A . J 7 HOH 38 438 250 HOH HOH A . J 7 HOH 39 439 4 HOH HOH A . J 7 HOH 40 440 43 HOH HOH A . J 7 HOH 41 441 22 HOH HOH A . J 7 HOH 42 442 26 HOH HOH A . J 7 HOH 43 443 141 HOH HOH A . J 7 HOH 44 444 151 HOH HOH A . J 7 HOH 45 445 7 HOH HOH A . J 7 HOH 46 446 37 HOH HOH A . J 7 HOH 47 447 76 HOH HOH A . J 7 HOH 48 448 147 HOH HOH A . J 7 HOH 49 449 183 HOH HOH A . J 7 HOH 50 450 167 HOH HOH A . J 7 HOH 51 451 89 HOH HOH A . J 7 HOH 52 452 30 HOH HOH A . J 7 HOH 53 453 72 HOH HOH A . J 7 HOH 54 454 11 HOH HOH A . J 7 HOH 55 455 254 HOH HOH A . J 7 HOH 56 456 21 HOH HOH A . J 7 HOH 57 457 149 HOH HOH A . J 7 HOH 58 458 3 HOH HOH A . J 7 HOH 59 459 10 HOH HOH A . J 7 HOH 60 460 31 HOH HOH A . J 7 HOH 61 461 66 HOH HOH A . J 7 HOH 62 462 42 HOH HOH A . J 7 HOH 63 463 224 HOH HOH A . J 7 HOH 64 464 150 HOH HOH A . J 7 HOH 65 465 38 HOH HOH A . J 7 HOH 66 466 46 HOH HOH A . J 7 HOH 67 467 175 HOH HOH A . J 7 HOH 68 468 18 HOH HOH A . J 7 HOH 69 469 98 HOH HOH A . J 7 HOH 70 470 196 HOH HOH A . J 7 HOH 71 471 17 HOH HOH A . J 7 HOH 72 472 5 HOH HOH A . J 7 HOH 73 473 92 HOH HOH A . J 7 HOH 74 474 86 HOH HOH A . J 7 HOH 75 475 288 HOH HOH A . J 7 HOH 76 476 145 HOH HOH A . J 7 HOH 77 477 243 HOH HOH A . J 7 HOH 78 478 2 HOH HOH A . J 7 HOH 79 479 265 HOH HOH A . J 7 HOH 80 480 51 HOH HOH A . J 7 HOH 81 481 236 HOH HOH A . J 7 HOH 82 482 269 HOH HOH A . J 7 HOH 83 483 84 HOH HOH A . J 7 HOH 84 484 12 HOH HOH A . J 7 HOH 85 485 40 HOH HOH A . J 7 HOH 86 486 53 HOH HOH A . J 7 HOH 87 487 118 HOH HOH A . J 7 HOH 88 488 93 HOH HOH A . J 7 HOH 89 489 263 HOH HOH A . J 7 HOH 90 490 16 HOH HOH A . J 7 HOH 91 491 176 HOH HOH A . J 7 HOH 92 492 62 HOH HOH A . J 7 HOH 93 493 91 HOH HOH A . J 7 HOH 94 494 104 HOH HOH A . J 7 HOH 95 495 15 HOH HOH A . J 7 HOH 96 496 217 HOH HOH A . J 7 HOH 97 497 45 HOH HOH A . J 7 HOH 98 498 63 HOH HOH A . J 7 HOH 99 499 94 HOH HOH A . J 7 HOH 100 500 13 HOH HOH A . J 7 HOH 101 501 83 HOH HOH A . J 7 HOH 102 502 82 HOH HOH A . J 7 HOH 103 503 1 HOH HOH A . J 7 HOH 104 504 6 HOH HOH A . J 7 HOH 105 505 69 HOH HOH A . J 7 HOH 106 506 235 HOH HOH A . J 7 HOH 107 507 193 HOH HOH A . J 7 HOH 108 508 54 HOH HOH A . J 7 HOH 109 509 253 HOH HOH A . J 7 HOH 110 510 144 HOH HOH A . J 7 HOH 111 511 39 HOH HOH A . J 7 HOH 112 512 28 HOH HOH A . J 7 HOH 113 513 135 HOH HOH A . J 7 HOH 114 514 171 HOH HOH A . J 7 HOH 115 515 60 HOH HOH A . J 7 HOH 116 516 8 HOH HOH A . J 7 HOH 117 517 47 HOH HOH A . J 7 HOH 118 518 85 HOH HOH A . J 7 HOH 119 519 29 HOH HOH A . J 7 HOH 120 520 268 HOH HOH A . J 7 HOH 121 521 35 HOH HOH A . J 7 HOH 122 522 116 HOH HOH A . J 7 HOH 123 523 80 HOH HOH A . J 7 HOH 124 524 207 HOH HOH A . J 7 HOH 125 525 146 HOH HOH A . J 7 HOH 126 526 125 HOH HOH A . J 7 HOH 127 527 56 HOH HOH A . J 7 HOH 128 528 44 HOH HOH A . J 7 HOH 129 529 194 HOH HOH A . J 7 HOH 130 530 81 HOH HOH A . J 7 HOH 131 531 68 HOH HOH A . J 7 HOH 132 532 126 HOH HOH A . J 7 HOH 133 533 78 HOH HOH A . J 7 HOH 134 534 293 HOH HOH A . J 7 HOH 135 535 223 HOH HOH A . J 7 HOH 136 536 130 HOH HOH A . J 7 HOH 137 537 202 HOH HOH A . J 7 HOH 138 538 33 HOH HOH A . J 7 HOH 139 539 61 HOH HOH A . J 7 HOH 140 540 138 HOH HOH A . J 7 HOH 141 541 210 HOH HOH A . J 7 HOH 142 542 117 HOH HOH A . J 7 HOH 143 543 168 HOH HOH A . J 7 HOH 144 544 23 HOH HOH A . J 7 HOH 145 545 109 HOH HOH A . J 7 HOH 146 546 161 HOH HOH A . J 7 HOH 147 547 279 HOH HOH A . J 7 HOH 148 548 264 HOH HOH A . J 7 HOH 149 549 177 HOH HOH A . J 7 HOH 150 550 24 HOH HOH A . J 7 HOH 151 551 245 HOH HOH A . J 7 HOH 152 552 20 HOH HOH A . J 7 HOH 153 553 142 HOH HOH A . J 7 HOH 154 554 211 HOH HOH A . J 7 HOH 155 555 139 HOH HOH A . J 7 HOH 156 556 27 HOH HOH A . J 7 HOH 157 557 115 HOH HOH A . J 7 HOH 158 558 123 HOH HOH A . J 7 HOH 159 559 14 HOH HOH A . J 7 HOH 160 560 55 HOH HOH A . J 7 HOH 161 561 25 HOH HOH A . J 7 HOH 162 562 127 HOH HOH A . J 7 HOH 163 563 189 HOH HOH A . J 7 HOH 164 564 277 HOH HOH A . J 7 HOH 165 565 154 HOH HOH A . J 7 HOH 166 566 105 HOH HOH A . J 7 HOH 167 567 128 HOH HOH A . J 7 HOH 168 568 119 HOH HOH A . J 7 HOH 169 569 248 HOH HOH A . J 7 HOH 170 570 274 HOH HOH A . J 7 HOH 171 571 187 HOH HOH A . J 7 HOH 172 572 58 HOH HOH A . J 7 HOH 173 573 252 HOH HOH A . J 7 HOH 174 574 156 HOH HOH A . J 7 HOH 175 575 77 HOH HOH A . J 7 HOH 176 576 113 HOH HOH A . J 7 HOH 177 577 234 HOH HOH A . J 7 HOH 178 578 206 HOH HOH A . J 7 HOH 179 579 111 HOH HOH A . J 7 HOH 180 580 57 HOH HOH A . J 7 HOH 181 581 270 HOH HOH A . J 7 HOH 182 582 246 HOH HOH A . J 7 HOH 183 583 74 HOH HOH A . J 7 HOH 184 584 96 HOH HOH A . J 7 HOH 185 585 214 HOH HOH A . J 7 HOH 186 586 165 HOH HOH A . J 7 HOH 187 587 87 HOH HOH A . J 7 HOH 188 588 129 HOH HOH A . J 7 HOH 189 589 124 HOH HOH A . J 7 HOH 190 590 178 HOH HOH A . J 7 HOH 191 591 239 HOH HOH A . J 7 HOH 192 592 227 HOH HOH A . J 7 HOH 193 593 101 HOH HOH A . J 7 HOH 194 594 201 HOH HOH A . J 7 HOH 195 595 136 HOH HOH A . J 7 HOH 196 596 218 HOH HOH A . J 7 HOH 197 597 41 HOH HOH A . J 7 HOH 198 598 226 HOH HOH A . J 7 HOH 199 599 132 HOH HOH A . J 7 HOH 200 600 233 HOH HOH A . J 7 HOH 201 601 184 HOH HOH A . J 7 HOH 202 602 100 HOH HOH A . J 7 HOH 203 603 204 HOH HOH A . J 7 HOH 204 604 221 HOH HOH A . J 7 HOH 205 605 228 HOH HOH A . J 7 HOH 206 606 131 HOH HOH A . J 7 HOH 207 607 280 HOH HOH A . J 7 HOH 208 608 179 HOH HOH A . J 7 HOH 209 609 212 HOH HOH A . J 7 HOH 210 610 260 HOH HOH A . J 7 HOH 211 611 108 HOH HOH A . J 7 HOH 212 612 255 HOH HOH A . J 7 HOH 213 613 205 HOH HOH A . J 7 HOH 214 614 181 HOH HOH A . J 7 HOH 215 615 241 HOH HOH A . J 7 HOH 216 616 222 HOH HOH A . J 7 HOH 217 617 271 HOH HOH A . J 7 HOH 218 618 48 HOH HOH A . J 7 HOH 219 619 158 HOH HOH A . J 7 HOH 220 620 275 HOH HOH A . J 7 HOH 221 621 292 HOH HOH A . J 7 HOH 222 622 209 HOH HOH A . J 7 HOH 223 623 19 HOH HOH A . J 7 HOH 224 624 266 HOH HOH A . J 7 HOH 225 625 256 HOH HOH A . J 7 HOH 226 626 232 HOH HOH A . J 7 HOH 227 627 49 HOH HOH A . J 7 HOH 228 628 166 HOH HOH A . J 7 HOH 229 629 262 HOH HOH A . J 7 HOH 230 630 199 HOH HOH A . J 7 HOH 231 631 79 HOH HOH A . J 7 HOH 232 632 152 HOH HOH A . J 7 HOH 233 633 110 HOH HOH A . J 7 HOH 234 634 137 HOH HOH A . J 7 HOH 235 635 159 HOH HOH A . J 7 HOH 236 636 215 HOH HOH A . J 7 HOH 237 637 278 HOH HOH A . J 7 HOH 238 638 298 HOH HOH A . J 7 HOH 239 639 251 HOH HOH A . J 7 HOH 240 640 32 HOH HOH A . J 7 HOH 241 641 173 HOH HOH A . J 7 HOH 242 642 261 HOH HOH A . J 7 HOH 243 643 225 HOH HOH A . J 7 HOH 244 644 195 HOH HOH A . J 7 HOH 245 645 170 HOH HOH A . J 7 HOH 246 646 148 HOH HOH A . J 7 HOH 247 647 121 HOH HOH A . J 7 HOH 248 648 272 HOH HOH A . J 7 HOH 249 649 190 HOH HOH A . J 7 HOH 250 650 240 HOH HOH A . J 7 HOH 251 651 157 HOH HOH A . J 7 HOH 252 652 122 HOH HOH A . J 7 HOH 253 653 213 HOH HOH A . J 7 HOH 254 654 188 HOH HOH A . J 7 HOH 255 655 247 HOH HOH A . J 7 HOH 256 656 284 HOH HOH A . K 7 HOH 1 601 70 HOH HOH B . K 7 HOH 2 602 164 HOH HOH B . K 7 HOH 3 603 52 HOH HOH B . K 7 HOH 4 604 34 HOH HOH B . K 7 HOH 5 605 160 HOH HOH B . K 7 HOH 6 606 155 HOH HOH B . K 7 HOH 7 607 244 HOH HOH B . K 7 HOH 8 608 198 HOH HOH B . K 7 HOH 9 609 208 HOH HOH B . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id TPO _pdbx_struct_mod_residue.label_seq_id 14 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id TPO _pdbx_struct_mod_residue.auth_seq_id 594 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id THR _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5160 ? 1 MORE -72 ? 1 'SSA (A^2)' 21350 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A MG 301 ? C MG . 2 1 A HOH 655 ? J HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 0.0 ? 2 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? J HOH . ? A HOH 441 ? 1_555 77.9 ? 3 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? J HOH . ? A HOH 441 ? 1_555 77.9 ? 4 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? J HOH . ? A HOH 441 ? 3_654 81.4 ? 5 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? J HOH . ? A HOH 441 ? 3_654 81.4 ? 6 O ? J HOH . ? A HOH 441 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? J HOH . ? A HOH 441 ? 3_654 150.7 ? 7 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? J HOH . ? A HOH 589 ? 1_555 80.1 ? 8 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? J HOH . ? A HOH 589 ? 1_555 80.1 ? 9 O ? J HOH . ? A HOH 441 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? J HOH . ? A HOH 589 ? 1_555 94.4 ? 10 O ? J HOH . ? A HOH 441 ? 3_654 MG ? C MG . ? A MG 301 ? 1_555 O ? J HOH . ? A HOH 589 ? 1_555 102.3 ? 11 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? J HOH . ? A HOH 589 ? 3_654 169.5 ? 12 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? J HOH . ? A HOH 589 ? 3_654 169.5 ? 13 O ? J HOH . ? A HOH 441 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? J HOH . ? A HOH 589 ? 3_654 102.3 ? 14 O ? J HOH . ? A HOH 441 ? 3_654 MG ? C MG . ? A MG 301 ? 1_555 O ? J HOH . ? A HOH 589 ? 3_654 94.4 ? 15 O ? J HOH . ? A HOH 589 ? 1_555 MG ? C MG . ? A MG 301 ? 1_555 O ? J HOH . ? A HOH 589 ? 3_654 110.2 ? 16 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? A GLU 115 ? A GLU 110 ? 1_555 78.4 ? 17 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 107.2 ? 18 O ? A GLU 115 ? A GLU 110 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 41.0 ? 19 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? J HOH . ? A HOH 479 ? 1_555 82.7 ? 20 O ? A GLU 115 ? A GLU 110 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? J HOH . ? A HOH 479 ? 1_555 160.0 ? 21 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? J HOH . ? A HOH 479 ? 1_555 143.3 ? 22 OE2 ? A GLU 40 ? A GLU 35 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? J HOH . ? A HOH 601 ? 6_554 162.1 ? 23 O ? A GLU 115 ? A GLU 110 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? J HOH . ? A HOH 601 ? 6_554 90.6 ? 24 OE2 ? A GLU 193 ? A GLU 188 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? J HOH . ? A HOH 601 ? 6_554 71.4 ? 25 O ? J HOH . ? A HOH 479 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? J HOH . ? A HOH 601 ? 6_554 109.3 ? 26 OE2 ? A GLU 94 ? A GLU 89 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? J HOH . ? A HOH 444 ? 1_555 74.4 ? 27 OE2 ? A GLU 94 ? A GLU 89 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? J HOH . ? A HOH 448 ? 1_555 90.9 ? 28 O ? J HOH . ? A HOH 444 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? J HOH . ? A HOH 448 ? 1_555 136.8 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2022-06-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 7OQ8 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 596 ? ? O A HOH 608 ? ? 1.96 2 1 O A THR 231 ? ? O A HOH 401 ? ? 2.10 3 1 O A HOH 405 ? ? O A HOH 569 ? ? 2.10 4 1 OE1 A GLU 182 ? A O A HOH 402 ? ? 2.11 5 1 O A HOH 460 ? ? O A HOH 584 ? ? 2.11 6 1 O A HOH 481 ? ? O A HOH 619 ? ? 2.13 7 1 O A HOH 617 ? ? O A HOH 626 ? ? 2.16 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 403 ? ? 1_555 O A HOH 567 ? ? 6_555 2.09 2 1 O A HOH 614 ? ? 1_555 O A HOH 615 ? ? 7_545 2.12 3 1 O A HOH 506 ? ? 1_555 O A HOH 582 ? ? 6_554 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 18 ? ? -105.05 74.09 2 1 HIS A 106 ? ? -145.23 41.29 3 1 THR A 136 ? ? -141.78 49.01 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 655 ? 6.67 . 2 1 O ? A HOH 656 ? 6.77 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 67 ? CG ? A GLN 72 CG 2 1 Y 1 A GLN 67 ? CD ? A GLN 72 CD 3 1 Y 1 A GLN 67 ? OE1 ? A GLN 72 OE1 4 1 Y 1 A GLN 67 ? NE2 ? A GLN 72 NE2 5 1 Y 1 A LYS 68 ? CG ? A LYS 73 CG 6 1 Y 1 A LYS 68 ? CD ? A LYS 73 CD 7 1 Y 1 A LYS 68 ? CE ? A LYS 73 CE 8 1 Y 1 A LYS 68 ? NZ ? A LYS 73 NZ 9 1 Y 1 A GLU 115 ? CG ? A GLU 120 CG 10 1 Y 1 A GLU 115 ? CD ? A GLU 120 CD 11 1 Y 1 A GLU 115 ? OE1 ? A GLU 120 OE1 12 1 Y 1 A GLU 115 ? OE2 ? A GLU 120 OE2 13 1 Y 1 A ASP 139 ? CG ? A ASP 144 CG 14 1 Y 1 A ASP 139 ? OD1 ? A ASP 144 OD1 15 1 Y 1 A ASP 139 ? OD2 ? A ASP 144 OD2 16 1 Y 1 A LYS 141 ? CG ? A LYS 146 CG 17 1 Y 1 A LYS 141 ? CD ? A LYS 146 CD 18 1 Y 1 A LYS 141 ? CE ? A LYS 146 CE 19 1 Y 1 A LYS 141 ? NZ ? A LYS 146 NZ 20 1 Y 1 A LYS 160 ? CG ? A LYS 165 CG 21 1 Y 1 A LYS 160 ? CD ? A LYS 165 CD 22 1 Y 1 A LYS 160 ? CE ? A LYS 165 CE 23 1 Y 1 A LYS 160 ? NZ ? A LYS 165 NZ 24 1 Y 1 A ASN 185 ? CG ? A ASN 190 CG 25 1 Y 1 A ASN 185 ? OD1 ? A ASN 190 OD1 26 1 Y 1 A ASN 185 ? ND2 ? A ASN 190 ND2 27 1 Y 1 A LYS 195 ? CD ? A LYS 200 CD 28 1 Y 1 A LYS 195 ? CE ? A LYS 200 CE 29 1 Y 1 A LYS 195 ? NZ ? A LYS 200 NZ 30 1 Y 1 A GLU 210 ? CG ? A GLU 215 CG 31 1 Y 1 A GLU 210 ? CD ? A GLU 215 CD 32 1 Y 1 A GLU 210 ? OE1 ? A GLU 215 OE1 33 1 Y 1 A GLU 210 ? OE2 ? A GLU 215 OE2 34 1 Y 1 A LYS 214 ? CG ? A LYS 219 CG 35 1 Y 1 A LYS 214 ? CD ? A LYS 219 CD 36 1 Y 1 A LYS 214 ? CE ? A LYS 219 CE 37 1 Y 1 A LYS 214 ? NZ ? A LYS 219 NZ 38 1 Y 1 A ARG 224 ? CG ? A ARG 229 CG 39 1 Y 1 A ARG 224 ? CD ? A ARG 229 CD 40 1 Y 1 A ARG 224 ? NE ? A ARG 229 NE 41 1 Y 1 A ARG 224 ? CZ ? A ARG 229 CZ 42 1 Y 1 A ARG 224 ? NH1 ? A ARG 229 NH1 43 1 Y 1 A ARG 224 ? NH2 ? A ARG 229 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 71 ? A GLU 76 2 1 Y 1 A GLU 72 ? A GLU 77 3 1 Y 1 A GLY 73 ? A GLY 78 4 1 Y 1 A SER 74 ? A SER 79 5 1 Y 1 A GLU 75 ? A GLU 80 6 1 Y 1 A GLU 76 ? A GLU 81 7 1 Y 1 A LYS 77 ? A LYS 82 8 1 Y 1 A ASP 138 ? A ASP 143 9 1 Y 1 A ALA 232 ? A ALA 237 10 1 Y 1 A ASP 233 ? A ASP 238 11 1 Y 1 A ASN 234 ? A ASN 239 12 1 Y 1 A ALA 235 ? A ALA 240 13 1 Y 1 A GLY 236 ? A GLY 241 14 1 Y 1 A GLU 237 ? A GLU 242 15 1 Y 1 A GLU 238 ? A GLU 243 16 1 Y 1 A GLY 239 ? A GLY 244 17 1 Y 1 A GLY 240 ? A GLY 245 18 1 Y 1 A GLU 241 ? A GLU 246 19 1 Y 1 A ALA 242 ? A ALA 247 20 1 Y 1 A PRO 243 ? A PRO 248 21 1 Y 1 A GLN 244 ? A GLN 249 22 1 Y 1 A GLU 245 ? A GLU 250 23 1 Y 1 A PRO 246 ? A PRO 251 24 1 Y 1 A GLN 247 ? A GLN 252 25 1 Y 1 A SER 248 ? A SER 253 26 1 Y 1 B LYS 581 ? B LYS 1 27 1 Y 1 B TYR 582 ? B TYR 2 28 1 Y 1 B TYR 583 ? B TYR 3 29 1 Y 1 B ILE 584 ? B ILE 4 30 1 Y 1 B THR 585 ? B THR 5 31 1 Y 1 B GLY 586 ? B GLY 6 32 1 Y 1 B GLU 587 ? B GLU 7 33 1 Y 1 B ALA 588 ? B ALA 8 34 1 Y 1 B GLU 589 ? B GLU 9 35 1 Y 1 B GLY 590 ? B GLY 10 # _pdbx_audit_support.funding_organization 'H2020 Marie Curie Actions of the European Commission' _pdbx_audit_support.country 'European Union' _pdbx_audit_support.grant_number 675179 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 0B7 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 0B7 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'MAGNESIUM ION' MG 4 BETA-MERCAPTOETHANOL BME 5 'CHLORIDE ION' CL 6 '~{N}-[(5-carbamimidoyl-3-phenyl-thiophen-2-yl)methyl]-1~{H}-indole-6-carboxamide' 0B7 7 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 #