data_7OVI # _entry.id 7OVI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7OVI pdb_00007ovi 10.2210/pdb7ovi/pdb WWPDB D_1292116347 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-07-20 2 'Structure model' 1 1 2022-08-10 3 'Structure model' 1 2 2022-08-17 4 'Structure model' 1 3 2022-09-14 5 'Structure model' 1 4 2024-01-31 6 'Structure model' 1 5 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Structure summary' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Refinement description' 6 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' audit_author 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' pdbx_initial_refinement_model 8 6 'Structure model' pdbx_entry_details 9 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 6 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7OVI _pdbx_database_status.recvd_initial_deposition_date 2021-06-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kleinboelting, S.' 1 ? 'Buehrmann, M.' 2 ? 'Mueller, M.P.' 3 ? 'Rauh, D.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 10341 _citation.page_last 10356 _citation.title 'Optimization of Covalent MKK7 Inhibitors via Crude Nanomole-Scale Libraries.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.1c02206 _citation.pdbx_database_id_PubMed 35912476 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gehrtz, P.' 1 ? primary 'Marom, S.' 2 0000-0001-8339-7311 primary 'Buhrmann, M.' 3 ? primary 'Hardick, J.' 4 ? primary 'Kleinbolting, S.' 5 ? primary 'Shraga, A.' 6 ? primary 'Dubiella, C.' 7 ? primary 'Gabizon, R.' 8 0000-0002-3626-5073 primary 'Wiese, J.N.' 9 ? primary 'Muller, M.P.' 10 0000-0002-1529-8933 primary 'Cohen, G.' 11 ? primary 'Babaev, I.' 12 ? primary 'Shurrush, K.' 13 ? primary 'Avram, L.' 14 0000-0001-6535-3470 primary 'Resnick, E.' 15 ? primary 'Barr, H.' 16 ? primary 'Rauh, D.' 17 0000-0002-1970-7642 primary 'London, N.' 18 0000-0003-2687-0699 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Dual specificity mitogen-activated protein kinase kinase 7' 36146.859 1 2.7.12.2 ? ? ? 2 non-polymer syn '1-[(3~{R})-3-[4-azanyl-3-[1-(2-phenylethyl)-1,2,3-triazol-4-yl]pyrazolo[3,4-d]pyrimidin-1-yl]piperidin-1-yl]propan-1-one' 445.520 1 ? ? ? ? 3 water nat water 18.015 83 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;MAPKK 7,JNK-activating kinase 2,MAPK/ERK kinase 7,MEK 7,Stress-activated protein kinase kinase 4,SAPKK4,c-Jun N-terminal kinase kinase 2,JNKK 2 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHSAKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVV LKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNIL LDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFE VLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSG ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHSAKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVV LKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNIL LDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFE VLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-[(3~{R})-3-[4-azanyl-3-[1-(2-phenylethyl)-1,2,3-triazol-4-yl]pyrazolo[3,4-d]pyrimidin-1-yl]piperidin-1-yl]propan-1-one' 2GI 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 ALA n 1 11 LYS n 1 12 GLN n 1 13 THR n 1 14 GLY n 1 15 TYR n 1 16 LEU n 1 17 THR n 1 18 ILE n 1 19 GLY n 1 20 GLY n 1 21 GLN n 1 22 ARG n 1 23 TYR n 1 24 GLN n 1 25 ALA n 1 26 GLU n 1 27 ILE n 1 28 ASN n 1 29 ASP n 1 30 LEU n 1 31 GLU n 1 32 ASN n 1 33 LEU n 1 34 GLY n 1 35 GLU n 1 36 MET n 1 37 GLY n 1 38 SER n 1 39 GLY n 1 40 THR n 1 41 CYS n 1 42 GLY n 1 43 GLN n 1 44 VAL n 1 45 TRP n 1 46 LYS n 1 47 MET n 1 48 ARG n 1 49 PHE n 1 50 ARG n 1 51 LYS n 1 52 THR n 1 53 GLY n 1 54 HIS n 1 55 VAL n 1 56 ILE n 1 57 ALA n 1 58 VAL n 1 59 LYS n 1 60 GLN n 1 61 MET n 1 62 ARG n 1 63 ARG n 1 64 SER n 1 65 GLY n 1 66 ASN n 1 67 LYS n 1 68 GLU n 1 69 GLU n 1 70 ASN n 1 71 LYS n 1 72 ARG n 1 73 ILE n 1 74 LEU n 1 75 MET n 1 76 ASP n 1 77 LEU n 1 78 ASP n 1 79 VAL n 1 80 VAL n 1 81 LEU n 1 82 LYS n 1 83 SER n 1 84 HIS n 1 85 ASP n 1 86 CYS n 1 87 PRO n 1 88 TYR n 1 89 ILE n 1 90 VAL n 1 91 GLN n 1 92 CYS n 1 93 PHE n 1 94 GLY n 1 95 THR n 1 96 PHE n 1 97 ILE n 1 98 THR n 1 99 ASN n 1 100 THR n 1 101 ASP n 1 102 VAL n 1 103 PHE n 1 104 ILE n 1 105 ALA n 1 106 MET n 1 107 GLU n 1 108 LEU n 1 109 MET n 1 110 GLY n 1 111 THR n 1 112 CYS n 1 113 ALA n 1 114 GLU n 1 115 LYS n 1 116 LEU n 1 117 LYS n 1 118 LYS n 1 119 ARG n 1 120 MET n 1 121 GLN n 1 122 GLY n 1 123 PRO n 1 124 ILE n 1 125 PRO n 1 126 GLU n 1 127 ARG n 1 128 ILE n 1 129 LEU n 1 130 GLY n 1 131 LYS n 1 132 MET n 1 133 THR n 1 134 VAL n 1 135 ALA n 1 136 ILE n 1 137 VAL n 1 138 LYS n 1 139 ALA n 1 140 LEU n 1 141 TYR n 1 142 TYR n 1 143 LEU n 1 144 LYS n 1 145 GLU n 1 146 LYS n 1 147 HIS n 1 148 GLY n 1 149 VAL n 1 150 ILE n 1 151 HIS n 1 152 ARG n 1 153 ASP n 1 154 VAL n 1 155 LYS n 1 156 PRO n 1 157 SER n 1 158 ASN n 1 159 ILE n 1 160 LEU n 1 161 LEU n 1 162 ASP n 1 163 GLU n 1 164 ARG n 1 165 GLY n 1 166 GLN n 1 167 ILE n 1 168 LYS n 1 169 LEU n 1 170 CYS n 1 171 ASP n 1 172 PHE n 1 173 GLY n 1 174 ILE n 1 175 SER n 1 176 GLY n 1 177 ARG n 1 178 LEU n 1 179 VAL n 1 180 ASP n 1 181 SER n 1 182 LYS n 1 183 ALA n 1 184 LYS n 1 185 THR n 1 186 ARG n 1 187 SER n 1 188 ALA n 1 189 GLY n 1 190 CYS n 1 191 ALA n 1 192 ALA n 1 193 TYR n 1 194 MET n 1 195 ALA n 1 196 PRO n 1 197 GLU n 1 198 ARG n 1 199 ILE n 1 200 ASP n 1 201 PRO n 1 202 PRO n 1 203 ASP n 1 204 PRO n 1 205 THR n 1 206 LYS n 1 207 PRO n 1 208 ASP n 1 209 TYR n 1 210 ASP n 1 211 ILE n 1 212 ARG n 1 213 ALA n 1 214 ASP n 1 215 VAL n 1 216 TRP n 1 217 SER n 1 218 LEU n 1 219 GLY n 1 220 ILE n 1 221 SER n 1 222 LEU n 1 223 VAL n 1 224 GLU n 1 225 LEU n 1 226 ALA n 1 227 THR n 1 228 GLY n 1 229 GLN n 1 230 PHE n 1 231 PRO n 1 232 TYR n 1 233 LYS n 1 234 ASN n 1 235 CYS n 1 236 LYS n 1 237 THR n 1 238 ASP n 1 239 PHE n 1 240 GLU n 1 241 VAL n 1 242 LEU n 1 243 THR n 1 244 LYS n 1 245 VAL n 1 246 LEU n 1 247 GLN n 1 248 GLU n 1 249 GLU n 1 250 PRO n 1 251 PRO n 1 252 LEU n 1 253 LEU n 1 254 PRO n 1 255 GLY n 1 256 HIS n 1 257 MET n 1 258 GLY n 1 259 PHE n 1 260 SER n 1 261 GLY n 1 262 ASP n 1 263 PHE n 1 264 GLN n 1 265 SER n 1 266 PHE n 1 267 VAL n 1 268 LYS n 1 269 ASP n 1 270 CYS n 1 271 LEU n 1 272 THR n 1 273 LYS n 1 274 ASP n 1 275 HIS n 1 276 ARG n 1 277 LYS n 1 278 ARG n 1 279 PRO n 1 280 LYS n 1 281 TYR n 1 282 ASN n 1 283 LYS n 1 284 LEU n 1 285 LEU n 1 286 GLU n 1 287 HIS n 1 288 SER n 1 289 PHE n 1 290 ILE n 1 291 LYS n 1 292 ARG n 1 293 TYR n 1 294 GLU n 1 295 THR n 1 296 LEU n 1 297 GLU n 1 298 VAL n 1 299 ASP n 1 300 VAL n 1 301 ALA n 1 302 SER n 1 303 TRP n 1 304 PHE n 1 305 LYS n 1 306 ASP n 1 307 VAL n 1 308 MET n 1 309 ALA n 1 310 LYS n 1 311 THR n 1 312 GLU n 1 313 SER n 1 314 PRO n 1 315 ARG n 1 316 THR n 1 317 SER n 1 318 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 318 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MAP2K7, JNKK2, MEK7, MKK7, PRKMK7, SKK4' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2GI non-polymer . '1-[(3~{R})-3-[4-azanyl-3-[1-(2-phenylethyl)-1,2,3-triazol-4-yl]pyrazolo[3,4-d]pyrimidin-1-yl]piperidin-1-yl]propan-1-one' ? 'C23 H27 N9 O' 445.520 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 107 ? ? ? A . n A 1 2 GLY 2 108 ? ? ? A . n A 1 3 HIS 3 109 ? ? ? A . n A 1 4 HIS 4 110 ? ? ? A . n A 1 5 HIS 5 111 ? ? ? A . n A 1 6 HIS 6 112 ? ? ? A . n A 1 7 HIS 7 113 ? ? ? A . n A 1 8 HIS 8 114 ? ? ? A . n A 1 9 SER 9 115 ? ? ? A . n A 1 10 ALA 10 116 ? ? ? A . n A 1 11 LYS 11 117 ? ? ? A . n A 1 12 GLN 12 118 118 GLN GLN A . n A 1 13 THR 13 119 119 THR THR A . n A 1 14 GLY 14 120 120 GLY GLY A . n A 1 15 TYR 15 121 121 TYR TYR A . n A 1 16 LEU 16 122 122 LEU LEU A . n A 1 17 THR 17 123 123 THR THR A . n A 1 18 ILE 18 124 124 ILE ILE A . n A 1 19 GLY 19 125 125 GLY GLY A . n A 1 20 GLY 20 126 126 GLY GLY A . n A 1 21 GLN 21 127 127 GLN GLN A . n A 1 22 ARG 22 128 128 ARG ARG A . n A 1 23 TYR 23 129 129 TYR TYR A . n A 1 24 GLN 24 130 130 GLN GLN A . n A 1 25 ALA 25 131 131 ALA ALA A . n A 1 26 GLU 26 132 132 GLU GLU A . n A 1 27 ILE 27 133 133 ILE ILE A . n A 1 28 ASN 28 134 134 ASN ASN A . n A 1 29 ASP 29 135 135 ASP ASP A . n A 1 30 LEU 30 136 136 LEU LEU A . n A 1 31 GLU 31 137 137 GLU GLU A . n A 1 32 ASN 32 138 138 ASN ASN A . n A 1 33 LEU 33 139 139 LEU LEU A . n A 1 34 GLY 34 140 140 GLY GLY A . n A 1 35 GLU 35 141 141 GLU GLU A . n A 1 36 MET 36 142 142 MET MET A . n A 1 37 GLY 37 143 143 GLY GLY A . n A 1 38 SER 38 144 144 SER SER A . n A 1 39 GLY 39 145 145 GLY GLY A . n A 1 40 THR 40 146 ? ? ? A . n A 1 41 CYS 41 147 ? ? ? A . n A 1 42 GLY 42 148 148 GLY GLY A . n A 1 43 GLN 43 149 149 GLN GLN A . n A 1 44 VAL 44 150 150 VAL VAL A . n A 1 45 TRP 45 151 151 TRP TRP A . n A 1 46 LYS 46 152 152 LYS LYS A . n A 1 47 MET 47 153 153 MET MET A . n A 1 48 ARG 48 154 154 ARG ARG A . n A 1 49 PHE 49 155 155 PHE PHE A . n A 1 50 ARG 50 156 156 ARG ARG A . n A 1 51 LYS 51 157 157 LYS LYS A . n A 1 52 THR 52 158 158 THR THR A . n A 1 53 GLY 53 159 159 GLY GLY A . n A 1 54 HIS 54 160 160 HIS HIS A . n A 1 55 VAL 55 161 161 VAL VAL A . n A 1 56 ILE 56 162 162 ILE ILE A . n A 1 57 ALA 57 163 163 ALA ALA A . n A 1 58 VAL 58 164 164 VAL VAL A . n A 1 59 LYS 59 165 165 LYS LYS A . n A 1 60 GLN 60 166 166 GLN GLN A . n A 1 61 MET 61 167 167 MET MET A . n A 1 62 ARG 62 168 168 ARG ARG A . n A 1 63 ARG 63 169 169 ARG ARG A . n A 1 64 SER 64 170 170 SER SER A . n A 1 65 GLY 65 171 171 GLY GLY A . n A 1 66 ASN 66 172 172 ASN ASN A . n A 1 67 LYS 67 173 173 LYS LYS A . n A 1 68 GLU 68 174 174 GLU GLU A . n A 1 69 GLU 69 175 175 GLU GLU A . n A 1 70 ASN 70 176 176 ASN ASN A . n A 1 71 LYS 71 177 177 LYS LYS A . n A 1 72 ARG 72 178 178 ARG ARG A . n A 1 73 ILE 73 179 179 ILE ILE A . n A 1 74 LEU 74 180 180 LEU LEU A . n A 1 75 MET 75 181 181 MET MET A . n A 1 76 ASP 76 182 182 ASP ASP A . n A 1 77 LEU 77 183 183 LEU LEU A . n A 1 78 ASP 78 184 184 ASP ASP A . n A 1 79 VAL 79 185 185 VAL VAL A . n A 1 80 VAL 80 186 186 VAL VAL A . n A 1 81 LEU 81 187 187 LEU LEU A . n A 1 82 LYS 82 188 188 LYS LYS A . n A 1 83 SER 83 189 189 SER SER A . n A 1 84 HIS 84 190 190 HIS HIS A . n A 1 85 ASP 85 191 191 ASP ASP A . n A 1 86 CYS 86 192 192 CYS CYS A . n A 1 87 PRO 87 193 193 PRO PRO A . n A 1 88 TYR 88 194 194 TYR TYR A . n A 1 89 ILE 89 195 195 ILE ILE A . n A 1 90 VAL 90 196 196 VAL VAL A . n A 1 91 GLN 91 197 197 GLN GLN A . n A 1 92 CYS 92 198 198 CYS CYS A . n A 1 93 PHE 93 199 199 PHE PHE A . n A 1 94 GLY 94 200 200 GLY GLY A . n A 1 95 THR 95 201 201 THR THR A . n A 1 96 PHE 96 202 202 PHE PHE A . n A 1 97 ILE 97 203 203 ILE ILE A . n A 1 98 THR 98 204 204 THR THR A . n A 1 99 ASN 99 205 205 ASN ASN A . n A 1 100 THR 100 206 206 THR THR A . n A 1 101 ASP 101 207 207 ASP ASP A . n A 1 102 VAL 102 208 208 VAL VAL A . n A 1 103 PHE 103 209 209 PHE PHE A . n A 1 104 ILE 104 210 210 ILE ILE A . n A 1 105 ALA 105 211 211 ALA ALA A . n A 1 106 MET 106 212 212 MET MET A . n A 1 107 GLU 107 213 213 GLU GLU A . n A 1 108 LEU 108 214 214 LEU LEU A . n A 1 109 MET 109 215 215 MET MET A . n A 1 110 GLY 110 216 216 GLY GLY A . n A 1 111 THR 111 217 217 THR THR A . n A 1 112 CYS 112 218 218 CYS CYS A . n A 1 113 ALA 113 219 219 ALA ALA A . n A 1 114 GLU 114 220 220 GLU GLU A . n A 1 115 LYS 115 221 221 LYS LYS A . n A 1 116 LEU 116 222 222 LEU LEU A . n A 1 117 LYS 117 223 223 LYS LYS A . n A 1 118 LYS 118 224 224 LYS LYS A . n A 1 119 ARG 119 225 225 ARG ARG A . n A 1 120 MET 120 226 226 MET MET A . n A 1 121 GLN 121 227 227 GLN GLN A . n A 1 122 GLY 122 228 228 GLY GLY A . n A 1 123 PRO 123 229 229 PRO PRO A . n A 1 124 ILE 124 230 230 ILE ILE A . n A 1 125 PRO 125 231 231 PRO PRO A . n A 1 126 GLU 126 232 232 GLU GLU A . n A 1 127 ARG 127 233 233 ARG ARG A . n A 1 128 ILE 128 234 234 ILE ILE A . n A 1 129 LEU 129 235 235 LEU LEU A . n A 1 130 GLY 130 236 236 GLY GLY A . n A 1 131 LYS 131 237 237 LYS LYS A . n A 1 132 MET 132 238 238 MET MET A . n A 1 133 THR 133 239 239 THR THR A . n A 1 134 VAL 134 240 240 VAL VAL A . n A 1 135 ALA 135 241 241 ALA ALA A . n A 1 136 ILE 136 242 242 ILE ILE A . n A 1 137 VAL 137 243 243 VAL VAL A . n A 1 138 LYS 138 244 244 LYS LYS A . n A 1 139 ALA 139 245 245 ALA ALA A . n A 1 140 LEU 140 246 246 LEU LEU A . n A 1 141 TYR 141 247 247 TYR TYR A . n A 1 142 TYR 142 248 248 TYR TYR A . n A 1 143 LEU 143 249 249 LEU LEU A . n A 1 144 LYS 144 250 250 LYS LYS A . n A 1 145 GLU 145 251 251 GLU GLU A . n A 1 146 LYS 146 252 252 LYS LYS A . n A 1 147 HIS 147 253 253 HIS HIS A . n A 1 148 GLY 148 254 254 GLY GLY A . n A 1 149 VAL 149 255 255 VAL VAL A . n A 1 150 ILE 150 256 256 ILE ILE A . n A 1 151 HIS 151 257 257 HIS HIS A . n A 1 152 ARG 152 258 258 ARG ARG A . n A 1 153 ASP 153 259 259 ASP ASP A . n A 1 154 VAL 154 260 260 VAL VAL A . n A 1 155 LYS 155 261 261 LYS LYS A . n A 1 156 PRO 156 262 262 PRO PRO A . n A 1 157 SER 157 263 263 SER SER A . n A 1 158 ASN 158 264 264 ASN ASN A . n A 1 159 ILE 159 265 265 ILE ILE A . n A 1 160 LEU 160 266 266 LEU LEU A . n A 1 161 LEU 161 267 267 LEU LEU A . n A 1 162 ASP 162 268 268 ASP ASP A . n A 1 163 GLU 163 269 269 GLU GLU A . n A 1 164 ARG 164 270 270 ARG ARG A . n A 1 165 GLY 165 271 271 GLY GLY A . n A 1 166 GLN 166 272 272 GLN GLN A . n A 1 167 ILE 167 273 273 ILE ILE A . n A 1 168 LYS 168 274 274 LYS LYS A . n A 1 169 LEU 169 275 275 LEU LEU A . n A 1 170 CYS 170 276 276 CYS CYS A . n A 1 171 ASP 171 277 277 ASP ASP A . n A 1 172 PHE 172 278 278 PHE PHE A . n A 1 173 GLY 173 279 279 GLY GLY A . n A 1 174 ILE 174 280 280 ILE ILE A . n A 1 175 SER 175 281 ? ? ? A . n A 1 176 GLY 176 282 ? ? ? A . n A 1 177 ARG 177 283 ? ? ? A . n A 1 178 LEU 178 284 ? ? ? A . n A 1 179 VAL 179 285 ? ? ? A . n A 1 180 ASP 180 286 ? ? ? A . n A 1 181 SER 181 287 ? ? ? A . n A 1 182 LYS 182 288 ? ? ? A . n A 1 183 ALA 183 289 ? ? ? A . n A 1 184 LYS 184 290 ? ? ? A . n A 1 185 THR 185 291 ? ? ? A . n A 1 186 ARG 186 292 ? ? ? A . n A 1 187 SER 187 293 ? ? ? A . n A 1 188 ALA 188 294 ? ? ? A . n A 1 189 GLY 189 295 ? ? ? A . n A 1 190 CYS 190 296 ? ? ? A . n A 1 191 ALA 191 297 ? ? ? A . n A 1 192 ALA 192 298 ? ? ? A . n A 1 193 TYR 193 299 ? ? ? A . n A 1 194 MET 194 300 ? ? ? A . n A 1 195 ALA 195 301 ? ? ? A . n A 1 196 PRO 196 302 ? ? ? A . n A 1 197 GLU 197 303 ? ? ? A . n A 1 198 ARG 198 304 ? ? ? A . n A 1 199 ILE 199 305 ? ? ? A . n A 1 200 ASP 200 306 ? ? ? A . n A 1 201 PRO 201 307 ? ? ? A . n A 1 202 PRO 202 308 ? ? ? A . n A 1 203 ASP 203 309 ? ? ? A . n A 1 204 PRO 204 310 ? ? ? A . n A 1 205 THR 205 311 ? ? ? A . n A 1 206 LYS 206 312 ? ? ? A . n A 1 207 PRO 207 313 ? ? ? A . n A 1 208 ASP 208 314 ? ? ? A . n A 1 209 TYR 209 315 ? ? ? A . n A 1 210 ASP 210 316 ? ? ? A . n A 1 211 ILE 211 317 ? ? ? A . n A 1 212 ARG 212 318 318 ARG ARG A . n A 1 213 ALA 213 319 319 ALA ALA A . n A 1 214 ASP 214 320 320 ASP ASP A . n A 1 215 VAL 215 321 321 VAL VAL A . n A 1 216 TRP 216 322 322 TRP TRP A . n A 1 217 SER 217 323 323 SER SER A . n A 1 218 LEU 218 324 324 LEU LEU A . n A 1 219 GLY 219 325 325 GLY GLY A . n A 1 220 ILE 220 326 326 ILE ILE A . n A 1 221 SER 221 327 327 SER SER A . n A 1 222 LEU 222 328 328 LEU LEU A . n A 1 223 VAL 223 329 329 VAL VAL A . n A 1 224 GLU 224 330 330 GLU GLU A . n A 1 225 LEU 225 331 331 LEU LEU A . n A 1 226 ALA 226 332 332 ALA ALA A . n A 1 227 THR 227 333 333 THR THR A . n A 1 228 GLY 228 334 334 GLY GLY A . n A 1 229 GLN 229 335 335 GLN GLN A . n A 1 230 PHE 230 336 336 PHE PHE A . n A 1 231 PRO 231 337 337 PRO PRO A . n A 1 232 TYR 232 338 338 TYR TYR A . n A 1 233 LYS 233 339 339 LYS LYS A . n A 1 234 ASN 234 340 340 ASN ASN A . n A 1 235 CYS 235 341 341 CYS CYS A . n A 1 236 LYS 236 342 342 LYS LYS A . n A 1 237 THR 237 343 343 THR THR A . n A 1 238 ASP 238 344 344 ASP ASP A . n A 1 239 PHE 239 345 345 PHE PHE A . n A 1 240 GLU 240 346 346 GLU GLU A . n A 1 241 VAL 241 347 347 VAL VAL A . n A 1 242 LEU 242 348 348 LEU LEU A . n A 1 243 THR 243 349 349 THR THR A . n A 1 244 LYS 244 350 350 LYS LYS A . n A 1 245 VAL 245 351 351 VAL VAL A . n A 1 246 LEU 246 352 352 LEU LEU A . n A 1 247 GLN 247 353 353 GLN GLN A . n A 1 248 GLU 248 354 354 GLU GLU A . n A 1 249 GLU 249 355 355 GLU GLU A . n A 1 250 PRO 250 356 356 PRO PRO A . n A 1 251 PRO 251 357 357 PRO PRO A . n A 1 252 LEU 252 358 358 LEU LEU A . n A 1 253 LEU 253 359 359 LEU LEU A . n A 1 254 PRO 254 360 360 PRO PRO A . n A 1 255 GLY 255 361 361 GLY GLY A . n A 1 256 HIS 256 362 362 HIS HIS A . n A 1 257 MET 257 363 363 MET MET A . n A 1 258 GLY 258 364 364 GLY GLY A . n A 1 259 PHE 259 365 365 PHE PHE A . n A 1 260 SER 260 366 366 SER SER A . n A 1 261 GLY 261 367 367 GLY GLY A . n A 1 262 ASP 262 368 368 ASP ASP A . n A 1 263 PHE 263 369 369 PHE PHE A . n A 1 264 GLN 264 370 370 GLN GLN A . n A 1 265 SER 265 371 371 SER SER A . n A 1 266 PHE 266 372 372 PHE PHE A . n A 1 267 VAL 267 373 373 VAL VAL A . n A 1 268 LYS 268 374 374 LYS LYS A . n A 1 269 ASP 269 375 375 ASP ASP A . n A 1 270 CYS 270 376 376 CYS CYS A . n A 1 271 LEU 271 377 377 LEU LEU A . n A 1 272 THR 272 378 378 THR THR A . n A 1 273 LYS 273 379 379 LYS LYS A . n A 1 274 ASP 274 380 380 ASP ASP A . n A 1 275 HIS 275 381 381 HIS HIS A . n A 1 276 ARG 276 382 382 ARG ARG A . n A 1 277 LYS 277 383 383 LYS LYS A . n A 1 278 ARG 278 384 384 ARG ARG A . n A 1 279 PRO 279 385 385 PRO PRO A . n A 1 280 LYS 280 386 386 LYS LYS A . n A 1 281 TYR 281 387 387 TYR TYR A . n A 1 282 ASN 282 388 388 ASN ASN A . n A 1 283 LYS 283 389 389 LYS LYS A . n A 1 284 LEU 284 390 390 LEU LEU A . n A 1 285 LEU 285 391 391 LEU LEU A . n A 1 286 GLU 286 392 392 GLU GLU A . n A 1 287 HIS 287 393 393 HIS HIS A . n A 1 288 SER 288 394 394 SER SER A . n A 1 289 PHE 289 395 395 PHE PHE A . n A 1 290 ILE 290 396 396 ILE ILE A . n A 1 291 LYS 291 397 397 LYS LYS A . n A 1 292 ARG 292 398 398 ARG ARG A . n A 1 293 TYR 293 399 399 TYR TYR A . n A 1 294 GLU 294 400 400 GLU GLU A . n A 1 295 THR 295 401 401 THR THR A . n A 1 296 LEU 296 402 402 LEU LEU A . n A 1 297 GLU 297 403 403 GLU GLU A . n A 1 298 VAL 298 404 404 VAL VAL A . n A 1 299 ASP 299 405 405 ASP ASP A . n A 1 300 VAL 300 406 406 VAL VAL A . n A 1 301 ALA 301 407 407 ALA ALA A . n A 1 302 SER 302 408 408 SER SER A . n A 1 303 TRP 303 409 409 TRP TRP A . n A 1 304 PHE 304 410 410 PHE PHE A . n A 1 305 LYS 305 411 411 LYS LYS A . n A 1 306 ASP 306 412 412 ASP ASP A . n A 1 307 VAL 307 413 413 VAL VAL A . n A 1 308 MET 308 414 414 MET MET A . n A 1 309 ALA 309 415 415 ALA ALA A . n A 1 310 LYS 310 416 416 LYS LYS A . n A 1 311 THR 311 417 417 THR THR A . n A 1 312 GLU 312 418 418 GLU GLU A . n A 1 313 SER 313 419 ? ? ? A . n A 1 314 PRO 314 420 ? ? ? A . n A 1 315 ARG 315 421 ? ? ? A . n A 1 316 THR 316 422 ? ? ? A . n A 1 317 SER 317 423 ? ? ? A . n A 1 318 GLY 318 424 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 2GI _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 2GI _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 2GI 1 501 501 2GI 258 A . C 3 HOH 1 601 96 HOH HOH A . C 3 HOH 2 602 57 HOH HOH A . C 3 HOH 3 603 24 HOH HOH A . C 3 HOH 4 604 8 HOH HOH A . C 3 HOH 5 605 11 HOH HOH A . C 3 HOH 6 606 6 HOH HOH A . C 3 HOH 7 607 78 HOH HOH A . C 3 HOH 8 608 63 HOH HOH A . C 3 HOH 9 609 10 HOH HOH A . C 3 HOH 10 610 7 HOH HOH A . C 3 HOH 11 611 31 HOH HOH A . C 3 HOH 12 612 17 HOH HOH A . C 3 HOH 13 613 51 HOH HOH A . C 3 HOH 14 614 54 HOH HOH A . C 3 HOH 15 615 40 HOH HOH A . C 3 HOH 16 616 9 HOH HOH A . C 3 HOH 17 617 5 HOH HOH A . C 3 HOH 18 618 19 HOH HOH A . C 3 HOH 19 619 30 HOH HOH A . C 3 HOH 20 620 49 HOH HOH A . C 3 HOH 21 621 37 HOH HOH A . C 3 HOH 22 622 13 HOH HOH A . C 3 HOH 23 623 23 HOH HOH A . C 3 HOH 24 624 14 HOH HOH A . C 3 HOH 25 625 28 HOH HOH A . C 3 HOH 26 626 16 HOH HOH A . C 3 HOH 27 627 1 HOH HOH A . C 3 HOH 28 628 12 HOH HOH A . C 3 HOH 29 629 29 HOH HOH A . C 3 HOH 30 630 2 HOH HOH A . C 3 HOH 31 631 60 HOH HOH A . C 3 HOH 32 632 21 HOH HOH A . C 3 HOH 33 633 4 HOH HOH A . C 3 HOH 34 634 86 HOH HOH A . C 3 HOH 35 635 70 HOH HOH A . C 3 HOH 36 636 34 HOH HOH A . C 3 HOH 37 637 88 HOH HOH A . C 3 HOH 38 638 74 HOH HOH A . C 3 HOH 39 639 94 HOH HOH A . C 3 HOH 40 640 59 HOH HOH A . C 3 HOH 41 641 20 HOH HOH A . C 3 HOH 42 642 15 HOH HOH A . C 3 HOH 43 643 90 HOH HOH A . C 3 HOH 44 644 43 HOH HOH A . C 3 HOH 45 645 56 HOH HOH A . C 3 HOH 46 646 46 HOH HOH A . C 3 HOH 47 647 81 HOH HOH A . C 3 HOH 48 648 62 HOH HOH A . C 3 HOH 49 649 71 HOH HOH A . C 3 HOH 50 650 98 HOH HOH A . C 3 HOH 51 651 18 HOH HOH A . C 3 HOH 52 652 73 HOH HOH A . C 3 HOH 53 653 66 HOH HOH A . C 3 HOH 54 654 50 HOH HOH A . C 3 HOH 55 655 39 HOH HOH A . C 3 HOH 56 656 65 HOH HOH A . C 3 HOH 57 657 35 HOH HOH A . C 3 HOH 58 658 32 HOH HOH A . C 3 HOH 59 659 25 HOH HOH A . C 3 HOH 60 660 48 HOH HOH A . C 3 HOH 61 661 3 HOH HOH A . C 3 HOH 62 662 33 HOH HOH A . C 3 HOH 63 663 47 HOH HOH A . C 3 HOH 64 664 55 HOH HOH A . C 3 HOH 65 665 61 HOH HOH A . C 3 HOH 66 666 45 HOH HOH A . C 3 HOH 67 667 84 HOH HOH A . C 3 HOH 68 668 42 HOH HOH A . C 3 HOH 69 669 85 HOH HOH A . C 3 HOH 70 670 27 HOH HOH A . C 3 HOH 71 671 95 HOH HOH A . C 3 HOH 72 672 92 HOH HOH A . C 3 HOH 73 673 53 HOH HOH A . C 3 HOH 74 674 76 HOH HOH A . C 3 HOH 75 675 69 HOH HOH A . C 3 HOH 76 676 87 HOH HOH A . C 3 HOH 77 677 97 HOH HOH A . C 3 HOH 78 678 67 HOH HOH A . C 3 HOH 79 679 75 HOH HOH A . C 3 HOH 80 680 83 HOH HOH A . C 3 HOH 81 681 36 HOH HOH A . C 3 HOH 82 682 44 HOH HOH A . C 3 HOH 83 683 99 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 173 ? CG ? A LYS 67 CG 2 1 Y 1 A LYS 173 ? CD ? A LYS 67 CD 3 1 Y 1 A LYS 173 ? CE ? A LYS 67 CE 4 1 Y 1 A LYS 173 ? NZ ? A LYS 67 NZ 5 1 Y 1 A GLU 174 ? CG ? A GLU 68 CG 6 1 Y 1 A GLU 174 ? CD ? A GLU 68 CD 7 1 Y 1 A GLU 174 ? OE1 ? A GLU 68 OE1 8 1 Y 1 A GLU 174 ? OE2 ? A GLU 68 OE2 9 1 Y 1 A LYS 224 ? CG ? A LYS 118 CG 10 1 Y 1 A LYS 224 ? CD ? A LYS 118 CD 11 1 Y 1 A LYS 224 ? CE ? A LYS 118 CE 12 1 Y 1 A LYS 224 ? NZ ? A LYS 118 NZ 13 1 Y 1 A ARG 258 ? CG ? A ARG 152 CG 14 1 Y 1 A ARG 258 ? CD ? A ARG 152 CD 15 1 Y 1 A ARG 258 ? NE ? A ARG 152 NE 16 1 Y 1 A ARG 258 ? CZ ? A ARG 152 CZ 17 1 Y 1 A ARG 258 ? NH1 ? A ARG 152 NH1 18 1 Y 1 A ARG 258 ? NH2 ? A ARG 152 NH2 19 1 Y 1 A ARG 318 ? CG ? A ARG 212 CG 20 1 Y 1 A ARG 318 ? CD ? A ARG 212 CD 21 1 Y 1 A ARG 318 ? NE ? A ARG 212 NE 22 1 Y 1 A ARG 318 ? CZ ? A ARG 212 CZ 23 1 Y 1 A ARG 318 ? NH1 ? A ARG 212 NH1 24 1 Y 1 A ARG 318 ? NH2 ? A ARG 212 NH2 25 1 Y 1 A ASP 320 ? CG ? A ASP 214 CG 26 1 Y 1 A ASP 320 ? OD1 ? A ASP 214 OD1 27 1 Y 1 A ASP 320 ? OD2 ? A ASP 214 OD2 28 1 Y 1 A LYS 342 ? CG ? A LYS 236 CG 29 1 Y 1 A LYS 342 ? CD ? A LYS 236 CD 30 1 Y 1 A LYS 342 ? CE ? A LYS 236 CE 31 1 Y 1 A LYS 342 ? NZ ? A LYS 236 NZ 32 1 Y 1 A LYS 383 ? CG ? A LYS 277 CG 33 1 Y 1 A LYS 383 ? CD ? A LYS 277 CD 34 1 Y 1 A LYS 383 ? CE ? A LYS 277 CE 35 1 Y 1 A LYS 383 ? NZ ? A LYS 277 NZ 36 1 Y 1 A LYS 386 ? CG ? A LYS 280 CG 37 1 Y 1 A LYS 386 ? CD ? A LYS 280 CD 38 1 Y 1 A LYS 386 ? CE ? A LYS 280 CE 39 1 Y 1 A LYS 386 ? NZ ? A LYS 280 NZ 40 1 Y 1 A GLU 418 ? CG ? A GLU 312 CG 41 1 Y 1 A GLU 418 ? CD ? A GLU 312 CD 42 1 Y 1 A GLU 418 ? OE1 ? A GLU 312 OE1 43 1 Y 1 A GLU 418 ? OE2 ? A GLU 312 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7OVI _cell.details ? _cell.formula_units_Z ? _cell.length_a 61.720 _cell.length_a_esd ? _cell.length_b 68.490 _cell.length_b_esd ? _cell.length_c 83.990 _cell.length_c_esd ? _cell.volume 355042.763 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7OVI _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7OVI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;180-220 mM sodium citrate, 15-25 % PEG3350 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-08-31 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9999 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9999 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 51.05 _reflns.entry_id 7OVI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.95 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 26469 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.53 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.052 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.95 _reflns_shell.d_res_low 2.05 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.55 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3647 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.573 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 58.20 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7OVI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.95 _refine.ls_d_res_low 49.74 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 26461 _refine.ls_number_reflns_R_free 1323 _refine.ls_number_reflns_R_work 25138 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.50 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2112 _refine.ls_R_factor_R_free 0.2504 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2092 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6QFL _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.2513 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3110 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.95 _refine_hist.d_res_low 49.74 _refine_hist.number_atoms_solvent 83 _refine_hist.number_atoms_total 2178 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2062 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0092 ? 2138 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9448 ? 2880 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0670 ? 316 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0077 ? 363 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.1694 ? 793 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.95 2.03 . . 144 2728 99.90 . . . 0.3867 . 0.3846 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.03 2.12 . . 146 2775 100.00 . . . 0.3408 . 0.2742 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.12 2.23 . . 145 2759 99.90 . . . 0.2666 . 0.2394 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.23 2.37 . . 141 2677 96.05 . . . 0.3221 . 0.2794 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.37 2.56 . . 147 2783 100.00 . . . 0.2704 . 0.2589 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.56 2.81 . . 147 2795 100.00 . . . 0.2469 . 0.2406 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.81 3.22 . . 147 2803 100.00 . . . 0.2960 . 0.2437 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.22 4.05 . . 150 2847 99.93 . . . 0.2602 . 0.1986 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.06 49.74 . . 156 2971 99.81 . . . 0.2097 . 0.1713 . . . . . . . . . . . # _struct.entry_id 7OVI _struct.title 'Protein kinase MKK7 in complex with phenethyltriazole-substituted pyrazolopyrimidine' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7OVI _struct_keywords.text 'Inhibitor, Complex, MKK7, Kinase, Triazole, Click-Chemistry, CuACC, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MP2K7_HUMAN _struct_ref.pdbx_db_accession O14733 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLC DFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEP PLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSG ; _struct_ref.pdbx_align_begin 101 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7OVI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 11 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 318 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14733 _struct_ref_seq.db_align_beg 101 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 408 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 117 _struct_ref_seq.pdbx_auth_seq_align_end 424 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7OVI MET A 1 ? UNP O14733 ? ? 'initiating methionine' 107 1 1 7OVI GLY A 2 ? UNP O14733 ? ? 'expression tag' 108 2 1 7OVI HIS A 3 ? UNP O14733 ? ? 'expression tag' 109 3 1 7OVI HIS A 4 ? UNP O14733 ? ? 'expression tag' 110 4 1 7OVI HIS A 5 ? UNP O14733 ? ? 'expression tag' 111 5 1 7OVI HIS A 6 ? UNP O14733 ? ? 'expression tag' 112 6 1 7OVI HIS A 7 ? UNP O14733 ? ? 'expression tag' 113 7 1 7OVI HIS A 8 ? UNP O14733 ? ? 'expression tag' 114 8 1 7OVI SER A 9 ? UNP O14733 ? ? 'expression tag' 115 9 1 7OVI ALA A 10 ? UNP O14733 ? ? 'expression tag' 116 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13740 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 26 ? ASN A 28 ? GLU A 132 ASN A 134 5 ? 3 HELX_P HELX_P2 AA2 ASN A 66 ? LYS A 82 ? ASN A 172 LYS A 188 1 ? 17 HELX_P HELX_P3 AA3 ALA A 113 ? GLN A 121 ? ALA A 219 GLN A 227 1 ? 9 HELX_P HELX_P4 AA4 PRO A 125 ? GLY A 148 ? PRO A 231 GLY A 254 1 ? 24 HELX_P HELX_P5 AA5 LYS A 155 ? SER A 157 ? LYS A 261 SER A 263 5 ? 3 HELX_P HELX_P6 AA6 ALA A 213 ? GLY A 228 ? ALA A 319 GLY A 334 1 ? 16 HELX_P HELX_P7 AA7 THR A 237 ? GLU A 248 ? THR A 343 GLU A 354 1 ? 12 HELX_P HELX_P8 AA8 SER A 260 ? LEU A 271 ? SER A 366 LEU A 377 1 ? 12 HELX_P HELX_P9 AA9 LYS A 280 ? LEU A 285 ? LYS A 386 LEU A 391 1 ? 6 HELX_P HELX_P10 AB1 HIS A 287 ? LEU A 296 ? HIS A 393 LEU A 402 1 ? 10 HELX_P HELX_P11 AB2 ASP A 299 ? ALA A 309 ? ASP A 405 ALA A 415 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 112 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id 2GI _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C13 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 218 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id 2GI _struct_conn.ptnr2_auth_seq_id 501 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.767 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id 2GI _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 112 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id 2GI _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 501 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 218 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C13 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id 2GI _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 5 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 15 ? ILE A 18 ? TYR A 121 ILE A 124 AA1 2 GLN A 21 ? GLN A 24 ? GLN A 127 GLN A 130 AA2 1 LEU A 30 ? GLU A 35 ? LEU A 136 GLU A 141 AA2 2 VAL A 44 ? PHE A 49 ? VAL A 150 PHE A 155 AA2 3 VAL A 55 ? ARG A 62 ? VAL A 161 ARG A 168 AA2 4 ASP A 101 ? MET A 106 ? ASP A 207 MET A 212 AA2 5 CYS A 92 ? ILE A 97 ? CYS A 198 ILE A 203 AA3 1 THR A 111 ? CYS A 112 ? THR A 217 CYS A 218 AA3 2 ILE A 159 ? LEU A 161 ? ILE A 265 LEU A 267 AA3 3 ILE A 167 ? LEU A 169 ? ILE A 273 LEU A 275 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 16 ? N LEU A 122 O TYR A 23 ? O TYR A 129 AA2 1 2 N LEU A 33 ? N LEU A 139 O LYS A 46 ? O LYS A 152 AA2 2 3 N MET A 47 ? N MET A 153 O ILE A 56 ? O ILE A 162 AA2 3 4 N ALA A 57 ? N ALA A 163 O MET A 106 ? O MET A 212 AA2 4 5 O PHE A 103 ? O PHE A 209 N PHE A 96 ? N PHE A 202 AA3 1 2 N THR A 111 ? N THR A 217 O LEU A 161 ? O LEU A 267 AA3 2 3 N LEU A 160 ? N LEU A 266 O LYS A 168 ? O LYS A 274 # _pdbx_entry_details.entry_id 7OVI _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 66.8544665816 14.0452092529 16.1269972443 0.284410792869 ? 0.00149028655724 ? 0.00390672747314 ? 0.364066190963 ? 0.0245733386853 ? 0.439153471354 ? 2.96550795765 ? -0.636759147311 ? -1.21969216536 ? 4.45949423983 ? 1.21818719455 ? 7.97483184901 ? -0.12184246008 ? -0.230389019996 ? -0.111607786605 ? 0.401720375292 ? 0.0923884592256 ? 0.303162851728 ? 0.351249347121 ? -0.0402977703993 ? 0.037550493167 ? 2 'X-RAY DIFFRACTION' ? refined 94.744839252 -0.31974809621 0.75058599861 0.368451365534 ? 0.0773622741657 ? 0.0472986691937 ? 0.301290081477 ? -0.012650667755 ? 0.291923365934 ? 7.99664200125 ? 3.1512236301 ? 2.31293995419 ? 4.59603987017 ? -0.454898720354 ? 8.77310083231 ? 0.0381785484922 ? 0.0779934769436 ? -0.322995454843 ? 0.0574803433684 ? 0.00626645834769 ? -0.202350820248 ? 0.510131149793 ? 0.154989310498 ? -0.0224040487194 ? 3 'X-RAY DIFFRACTION' ? refined 82.6316280516 5.72450264461 11.5113230142 0.473823016167 ? 0.00442152762176 ? -0.00918486153797 ? 0.371978466508 ? -0.0126698313872 ? 0.377582260816 ? 6.03757067507 ? -2.71138340487 ? -0.718127179023 ? 1.96613849527 ? -0.0220987928965 ? 1.23056257558 ? -0.224942954865 ? -0.632417920976 ? -0.169596331167 ? 0.234969501979 ? 0.205398926742 ? 0.0871431100723 ? 0.197964244617 ? 0.168404763703 ? 0.0412899552696 ? 4 'X-RAY DIFFRACTION' ? refined 78.7264973957 22.5617904292 19.4493840503 0.372625090076 ? 0.00730196410402 ? -0.0111440524199 ? 0.435932110653 ? 0.0142917016448 ? 0.421177329241 ? 3.02760204839 ? 3.07472135254 ? 2.2213285395 ? 3.35929855495 ? 4.47178633957 ? 8.57143998241 ? -0.309191224136 ? -0.206360504526 ? 0.112187823783 ? 0.0185785026998 ? 0.25841645144 ? -0.379952075811 ? -0.253184582654 ? 0.401405024409 ? 0.123727930303 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 198 A 354 ? A 262 A 418 ? ? ;chain 'A' and (resid 354 through 418 ) ; 2 'X-RAY DIFFRACTION' 2 A 1 A 118 ? A 53 A 172 ? ? ;chain 'A' and (resid 118 through 172 ) ; 3 'X-RAY DIFFRACTION' 3 A 54 A 173 ? A 156 A 275 ? ? ;chain 'A' and (resid 173 through 275 ) ; 4 'X-RAY DIFFRACTION' 4 A 157 A 276 ? A 197 A 353 ? ? ;chain 'A' and (resid 276 through 353 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 107 ? A MET 1 2 1 Y 1 A GLY 108 ? A GLY 2 3 1 Y 1 A HIS 109 ? A HIS 3 4 1 Y 1 A HIS 110 ? A HIS 4 5 1 Y 1 A HIS 111 ? A HIS 5 6 1 Y 1 A HIS 112 ? A HIS 6 7 1 Y 1 A HIS 113 ? A HIS 7 8 1 Y 1 A HIS 114 ? A HIS 8 9 1 Y 1 A SER 115 ? A SER 9 10 1 Y 1 A ALA 116 ? A ALA 10 11 1 Y 1 A LYS 117 ? A LYS 11 12 1 Y 1 A THR 146 ? A THR 40 13 1 Y 1 A CYS 147 ? A CYS 41 14 1 Y 1 A SER 281 ? A SER 175 15 1 Y 1 A GLY 282 ? A GLY 176 16 1 Y 1 A ARG 283 ? A ARG 177 17 1 Y 1 A LEU 284 ? A LEU 178 18 1 Y 1 A VAL 285 ? A VAL 179 19 1 Y 1 A ASP 286 ? A ASP 180 20 1 Y 1 A SER 287 ? A SER 181 21 1 Y 1 A LYS 288 ? A LYS 182 22 1 Y 1 A ALA 289 ? A ALA 183 23 1 Y 1 A LYS 290 ? A LYS 184 24 1 Y 1 A THR 291 ? A THR 185 25 1 Y 1 A ARG 292 ? A ARG 186 26 1 Y 1 A SER 293 ? A SER 187 27 1 Y 1 A ALA 294 ? A ALA 188 28 1 Y 1 A GLY 295 ? A GLY 189 29 1 Y 1 A CYS 296 ? A CYS 190 30 1 Y 1 A ALA 297 ? A ALA 191 31 1 Y 1 A ALA 298 ? A ALA 192 32 1 Y 1 A TYR 299 ? A TYR 193 33 1 Y 1 A MET 300 ? A MET 194 34 1 Y 1 A ALA 301 ? A ALA 195 35 1 Y 1 A PRO 302 ? A PRO 196 36 1 Y 1 A GLU 303 ? A GLU 197 37 1 Y 1 A ARG 304 ? A ARG 198 38 1 Y 1 A ILE 305 ? A ILE 199 39 1 Y 1 A ASP 306 ? A ASP 200 40 1 Y 1 A PRO 307 ? A PRO 201 41 1 Y 1 A PRO 308 ? A PRO 202 42 1 Y 1 A ASP 309 ? A ASP 203 43 1 Y 1 A PRO 310 ? A PRO 204 44 1 Y 1 A THR 311 ? A THR 205 45 1 Y 1 A LYS 312 ? A LYS 206 46 1 Y 1 A PRO 313 ? A PRO 207 47 1 Y 1 A ASP 314 ? A ASP 208 48 1 Y 1 A TYR 315 ? A TYR 209 49 1 Y 1 A ASP 316 ? A ASP 210 50 1 Y 1 A ILE 317 ? A ILE 211 51 1 Y 1 A SER 419 ? A SER 313 52 1 Y 1 A PRO 420 ? A PRO 314 53 1 Y 1 A ARG 421 ? A ARG 315 54 1 Y 1 A THR 422 ? A THR 316 55 1 Y 1 A SER 423 ? A SER 317 56 1 Y 1 A GLY 424 ? A GLY 318 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 2GI C02 C Y N 1 2GI C03 C Y N 2 2GI C04 C Y N 3 2GI C06 C N R 4 2GI C07 C N N 5 2GI C08 C N N 6 2GI C09 C N N 7 2GI C11 C N N 8 2GI C12 C N N 9 2GI C13 C N N 10 2GI C15 C N N 11 2GI C17 C Y N 12 2GI C18 C Y N 13 2GI C19 C Y N 14 2GI C21 C N N 15 2GI C22 C N N 16 2GI C23 C Y N 17 2GI C24 C Y N 18 2GI C25 C Y N 19 2GI C26 C Y N 20 2GI C27 C Y N 21 2GI C28 C Y N 22 2GI C32 C Y N 23 2GI N01 N N N 24 2GI N05 N Y N 25 2GI N10 N N N 26 2GI N16 N Y N 27 2GI N20 N Y N 28 2GI N29 N Y N 29 2GI N30 N Y N 30 2GI N31 N Y N 31 2GI N33 N Y N 32 2GI O14 O N N 33 2GI H1 H N N 34 2GI H2 H N N 35 2GI H3 H N N 36 2GI H4 H N N 37 2GI H5 H N N 38 2GI H6 H N N 39 2GI H7 H N N 40 2GI H8 H N N 41 2GI H9 H N N 42 2GI H10 H N N 43 2GI H11 H N N 44 2GI H12 H N N 45 2GI H13 H N N 46 2GI H14 H N N 47 2GI H15 H N N 48 2GI H16 H N N 49 2GI H17 H N N 50 2GI H18 H N N 51 2GI H19 H N N 52 2GI H20 H N N 53 2GI H21 H N N 54 2GI H22 H N N 55 2GI H23 H N N 56 2GI H24 H N N 57 2GI H25 H N N 58 2GI H26 H N N 59 2GI H27 H N N 60 ALA N N N N 61 ALA CA C N S 62 ALA C C N N 63 ALA O O N N 64 ALA CB C N N 65 ALA OXT O N N 66 ALA H H N N 67 ALA H2 H N N 68 ALA HA H N N 69 ALA HB1 H N N 70 ALA HB2 H N N 71 ALA HB3 H N N 72 ALA HXT H N N 73 ARG N N N N 74 ARG CA C N S 75 ARG C C N N 76 ARG O O N N 77 ARG CB C N N 78 ARG CG C N N 79 ARG CD C N N 80 ARG NE N N N 81 ARG CZ C N N 82 ARG NH1 N N N 83 ARG NH2 N N N 84 ARG OXT O N N 85 ARG H H N N 86 ARG H2 H N N 87 ARG HA H N N 88 ARG HB2 H N N 89 ARG HB3 H N N 90 ARG HG2 H N N 91 ARG HG3 H N N 92 ARG HD2 H N N 93 ARG HD3 H N N 94 ARG HE H N N 95 ARG HH11 H N N 96 ARG HH12 H N N 97 ARG HH21 H N N 98 ARG HH22 H N N 99 ARG HXT H N N 100 ASN N N N N 101 ASN CA C N S 102 ASN C C N N 103 ASN O O N N 104 ASN CB C N N 105 ASN CG C N N 106 ASN OD1 O N N 107 ASN ND2 N N N 108 ASN OXT O N N 109 ASN H H N N 110 ASN H2 H N N 111 ASN HA H N N 112 ASN HB2 H N N 113 ASN HB3 H N N 114 ASN HD21 H N N 115 ASN HD22 H N N 116 ASN HXT H N N 117 ASP N N N N 118 ASP CA C N S 119 ASP C C N N 120 ASP O O N N 121 ASP CB C N N 122 ASP CG C N N 123 ASP OD1 O N N 124 ASP OD2 O N N 125 ASP OXT O N N 126 ASP H H N N 127 ASP H2 H N N 128 ASP HA H N N 129 ASP HB2 H N N 130 ASP HB3 H N N 131 ASP HD2 H N N 132 ASP HXT H N N 133 CYS N N N N 134 CYS CA C N R 135 CYS C C N N 136 CYS O O N N 137 CYS CB C N N 138 CYS SG S N N 139 CYS OXT O N N 140 CYS H H N N 141 CYS H2 H N N 142 CYS HA H N N 143 CYS HB2 H N N 144 CYS HB3 H N N 145 CYS HG H N N 146 CYS HXT H N N 147 GLN N N N N 148 GLN CA C N S 149 GLN C C N N 150 GLN O O N N 151 GLN CB C N N 152 GLN CG C N N 153 GLN CD C N N 154 GLN OE1 O N N 155 GLN NE2 N N N 156 GLN OXT O N N 157 GLN H H N N 158 GLN H2 H N N 159 GLN HA H N N 160 GLN HB2 H N N 161 GLN HB3 H N N 162 GLN HG2 H N N 163 GLN HG3 H N N 164 GLN HE21 H N N 165 GLN HE22 H N N 166 GLN HXT H N N 167 GLU N N N N 168 GLU CA C N S 169 GLU C C N N 170 GLU O O N N 171 GLU CB C N N 172 GLU CG C N N 173 GLU CD C N N 174 GLU OE1 O N N 175 GLU OE2 O N N 176 GLU OXT O N N 177 GLU H H N N 178 GLU H2 H N N 179 GLU HA H N N 180 GLU HB2 H N N 181 GLU HB3 H N N 182 GLU HG2 H N N 183 GLU HG3 H N N 184 GLU HE2 H N N 185 GLU HXT H N N 186 GLY N N N N 187 GLY CA C N N 188 GLY C C N N 189 GLY O O N N 190 GLY OXT O N N 191 GLY H H N N 192 GLY H2 H N N 193 GLY HA2 H N N 194 GLY HA3 H N N 195 GLY HXT H N N 196 HIS N N N N 197 HIS CA C N S 198 HIS C C N N 199 HIS O O N N 200 HIS CB C N N 201 HIS CG C Y N 202 HIS ND1 N Y N 203 HIS CD2 C Y N 204 HIS CE1 C Y N 205 HIS NE2 N Y N 206 HIS OXT O N N 207 HIS H H N N 208 HIS H2 H N N 209 HIS HA H N N 210 HIS HB2 H N N 211 HIS HB3 H N N 212 HIS HD1 H N N 213 HIS HD2 H N N 214 HIS HE1 H N N 215 HIS HE2 H N N 216 HIS HXT H N N 217 HOH O O N N 218 HOH H1 H N N 219 HOH H2 H N N 220 ILE N N N N 221 ILE CA C N S 222 ILE C C N N 223 ILE O O N N 224 ILE CB C N S 225 ILE CG1 C N N 226 ILE CG2 C N N 227 ILE CD1 C N N 228 ILE OXT O N N 229 ILE H H N N 230 ILE H2 H N N 231 ILE HA H N N 232 ILE HB H N N 233 ILE HG12 H N N 234 ILE HG13 H N N 235 ILE HG21 H N N 236 ILE HG22 H N N 237 ILE HG23 H N N 238 ILE HD11 H N N 239 ILE HD12 H N N 240 ILE HD13 H N N 241 ILE HXT H N N 242 LEU N N N N 243 LEU CA C N S 244 LEU C C N N 245 LEU O O N N 246 LEU CB C N N 247 LEU CG C N N 248 LEU CD1 C N N 249 LEU CD2 C N N 250 LEU OXT O N N 251 LEU H H N N 252 LEU H2 H N N 253 LEU HA H N N 254 LEU HB2 H N N 255 LEU HB3 H N N 256 LEU HG H N N 257 LEU HD11 H N N 258 LEU HD12 H N N 259 LEU HD13 H N N 260 LEU HD21 H N N 261 LEU HD22 H N N 262 LEU HD23 H N N 263 LEU HXT H N N 264 LYS N N N N 265 LYS CA C N S 266 LYS C C N N 267 LYS O O N N 268 LYS CB C N N 269 LYS CG C N N 270 LYS CD C N N 271 LYS CE C N N 272 LYS NZ N N N 273 LYS OXT O N N 274 LYS H H N N 275 LYS H2 H N N 276 LYS HA H N N 277 LYS HB2 H N N 278 LYS HB3 H N N 279 LYS HG2 H N N 280 LYS HG3 H N N 281 LYS HD2 H N N 282 LYS HD3 H N N 283 LYS HE2 H N N 284 LYS HE3 H N N 285 LYS HZ1 H N N 286 LYS HZ2 H N N 287 LYS HZ3 H N N 288 LYS HXT H N N 289 MET N N N N 290 MET CA C N S 291 MET C C N N 292 MET O O N N 293 MET CB C N N 294 MET CG C N N 295 MET SD S N N 296 MET CE C N N 297 MET OXT O N N 298 MET H H N N 299 MET H2 H N N 300 MET HA H N N 301 MET HB2 H N N 302 MET HB3 H N N 303 MET HG2 H N N 304 MET HG3 H N N 305 MET HE1 H N N 306 MET HE2 H N N 307 MET HE3 H N N 308 MET HXT H N N 309 PHE N N N N 310 PHE CA C N S 311 PHE C C N N 312 PHE O O N N 313 PHE CB C N N 314 PHE CG C Y N 315 PHE CD1 C Y N 316 PHE CD2 C Y N 317 PHE CE1 C Y N 318 PHE CE2 C Y N 319 PHE CZ C Y N 320 PHE OXT O N N 321 PHE H H N N 322 PHE H2 H N N 323 PHE HA H N N 324 PHE HB2 H N N 325 PHE HB3 H N N 326 PHE HD1 H N N 327 PHE HD2 H N N 328 PHE HE1 H N N 329 PHE HE2 H N N 330 PHE HZ H N N 331 PHE HXT H N N 332 PRO N N N N 333 PRO CA C N S 334 PRO C C N N 335 PRO O O N N 336 PRO CB C N N 337 PRO CG C N N 338 PRO CD C N N 339 PRO OXT O N N 340 PRO H H N N 341 PRO HA H N N 342 PRO HB2 H N N 343 PRO HB3 H N N 344 PRO HG2 H N N 345 PRO HG3 H N N 346 PRO HD2 H N N 347 PRO HD3 H N N 348 PRO HXT H N N 349 SER N N N N 350 SER CA C N S 351 SER C C N N 352 SER O O N N 353 SER CB C N N 354 SER OG O N N 355 SER OXT O N N 356 SER H H N N 357 SER H2 H N N 358 SER HA H N N 359 SER HB2 H N N 360 SER HB3 H N N 361 SER HG H N N 362 SER HXT H N N 363 THR N N N N 364 THR CA C N S 365 THR C C N N 366 THR O O N N 367 THR CB C N R 368 THR OG1 O N N 369 THR CG2 C N N 370 THR OXT O N N 371 THR H H N N 372 THR H2 H N N 373 THR HA H N N 374 THR HB H N N 375 THR HG1 H N N 376 THR HG21 H N N 377 THR HG22 H N N 378 THR HG23 H N N 379 THR HXT H N N 380 TRP N N N N 381 TRP CA C N S 382 TRP C C N N 383 TRP O O N N 384 TRP CB C N N 385 TRP CG C Y N 386 TRP CD1 C Y N 387 TRP CD2 C Y N 388 TRP NE1 N Y N 389 TRP CE2 C Y N 390 TRP CE3 C Y N 391 TRP CZ2 C Y N 392 TRP CZ3 C Y N 393 TRP CH2 C Y N 394 TRP OXT O N N 395 TRP H H N N 396 TRP H2 H N N 397 TRP HA H N N 398 TRP HB2 H N N 399 TRP HB3 H N N 400 TRP HD1 H N N 401 TRP HE1 H N N 402 TRP HE3 H N N 403 TRP HZ2 H N N 404 TRP HZ3 H N N 405 TRP HH2 H N N 406 TRP HXT H N N 407 TYR N N N N 408 TYR CA C N S 409 TYR C C N N 410 TYR O O N N 411 TYR CB C N N 412 TYR CG C Y N 413 TYR CD1 C Y N 414 TYR CD2 C Y N 415 TYR CE1 C Y N 416 TYR CE2 C Y N 417 TYR CZ C Y N 418 TYR OH O N N 419 TYR OXT O N N 420 TYR H H N N 421 TYR H2 H N N 422 TYR HA H N N 423 TYR HB2 H N N 424 TYR HB3 H N N 425 TYR HD1 H N N 426 TYR HD2 H N N 427 TYR HE1 H N N 428 TYR HE2 H N N 429 TYR HH H N N 430 TYR HXT H N N 431 VAL N N N N 432 VAL CA C N S 433 VAL C C N N 434 VAL O O N N 435 VAL CB C N N 436 VAL CG1 C N N 437 VAL CG2 C N N 438 VAL OXT O N N 439 VAL H H N N 440 VAL H2 H N N 441 VAL HA H N N 442 VAL HB H N N 443 VAL HG11 H N N 444 VAL HG12 H N N 445 VAL HG13 H N N 446 VAL HG21 H N N 447 VAL HG22 H N N 448 VAL HG23 H N N 449 VAL HXT H N N 450 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 2GI C32 N31 doub Y N 1 2GI C32 N33 sing Y N 2 2GI N31 C04 sing Y N 3 2GI N33 C02 doub Y N 4 2GI C08 C07 sing N N 5 2GI C08 C09 sing N N 6 2GI C04 C03 doub Y N 7 2GI C04 N05 sing Y N 8 2GI C02 C03 sing Y N 9 2GI C02 N01 sing N N 10 2GI C07 C06 sing N N 11 2GI C06 N05 sing N N 12 2GI C06 C15 sing N N 13 2GI O14 C11 doub N N 14 2GI C03 C17 sing Y N 15 2GI N05 N16 sing Y N 16 2GI C11 C12 sing N N 17 2GI C11 N10 sing N N 18 2GI C12 C13 sing N N 19 2GI C09 N10 sing N N 20 2GI N10 C15 sing N N 21 2GI C17 N16 doub Y N 22 2GI C17 C18 sing N N 23 2GI C18 N30 sing Y N 24 2GI C18 C19 doub Y N 25 2GI N30 N29 doub Y N 26 2GI C19 N20 sing Y N 27 2GI N29 N20 sing Y N 28 2GI N20 C21 sing N N 29 2GI C22 C21 sing N N 30 2GI C22 C23 sing N N 31 2GI C23 C24 doub Y N 32 2GI C23 C28 sing Y N 33 2GI C24 C25 sing Y N 34 2GI C28 C27 doub Y N 35 2GI C25 C26 doub Y N 36 2GI C27 C26 sing Y N 37 2GI C06 H1 sing N N 38 2GI C07 H2 sing N N 39 2GI C07 H3 sing N N 40 2GI C08 H4 sing N N 41 2GI C08 H5 sing N N 42 2GI C09 H6 sing N N 43 2GI C09 H7 sing N N 44 2GI C12 H8 sing N N 45 2GI C12 H9 sing N N 46 2GI C13 H10 sing N N 47 2GI C13 H11 sing N N 48 2GI C13 H12 sing N N 49 2GI C15 H13 sing N N 50 2GI C15 H14 sing N N 51 2GI C19 H15 sing N N 52 2GI C21 H16 sing N N 53 2GI C21 H17 sing N N 54 2GI C22 H18 sing N N 55 2GI C22 H19 sing N N 56 2GI C24 H20 sing N N 57 2GI C25 H21 sing N N 58 2GI C26 H22 sing N N 59 2GI C27 H23 sing N N 60 2GI C28 H24 sing N N 61 2GI C32 H25 sing N N 62 2GI N01 H26 sing N N 63 2GI N01 H27 sing N N 64 ALA N CA sing N N 65 ALA N H sing N N 66 ALA N H2 sing N N 67 ALA CA C sing N N 68 ALA CA CB sing N N 69 ALA CA HA sing N N 70 ALA C O doub N N 71 ALA C OXT sing N N 72 ALA CB HB1 sing N N 73 ALA CB HB2 sing N N 74 ALA CB HB3 sing N N 75 ALA OXT HXT sing N N 76 ARG N CA sing N N 77 ARG N H sing N N 78 ARG N H2 sing N N 79 ARG CA C sing N N 80 ARG CA CB sing N N 81 ARG CA HA sing N N 82 ARG C O doub N N 83 ARG C OXT sing N N 84 ARG CB CG sing N N 85 ARG CB HB2 sing N N 86 ARG CB HB3 sing N N 87 ARG CG CD sing N N 88 ARG CG HG2 sing N N 89 ARG CG HG3 sing N N 90 ARG CD NE sing N N 91 ARG CD HD2 sing N N 92 ARG CD HD3 sing N N 93 ARG NE CZ sing N N 94 ARG NE HE sing N N 95 ARG CZ NH1 sing N N 96 ARG CZ NH2 doub N N 97 ARG NH1 HH11 sing N N 98 ARG NH1 HH12 sing N N 99 ARG NH2 HH21 sing N N 100 ARG NH2 HH22 sing N N 101 ARG OXT HXT sing N N 102 ASN N CA sing N N 103 ASN N H sing N N 104 ASN N H2 sing N N 105 ASN CA C sing N N 106 ASN CA CB sing N N 107 ASN CA HA sing N N 108 ASN C O doub N N 109 ASN C OXT sing N N 110 ASN CB CG sing N N 111 ASN CB HB2 sing N N 112 ASN CB HB3 sing N N 113 ASN CG OD1 doub N N 114 ASN CG ND2 sing N N 115 ASN ND2 HD21 sing N N 116 ASN ND2 HD22 sing N N 117 ASN OXT HXT sing N N 118 ASP N CA sing N N 119 ASP N H sing N N 120 ASP N H2 sing N N 121 ASP CA C sing N N 122 ASP CA CB sing N N 123 ASP CA HA sing N N 124 ASP C O doub N N 125 ASP C OXT sing N N 126 ASP CB CG sing N N 127 ASP CB HB2 sing N N 128 ASP CB HB3 sing N N 129 ASP CG OD1 doub N N 130 ASP CG OD2 sing N N 131 ASP OD2 HD2 sing N N 132 ASP OXT HXT sing N N 133 CYS N CA sing N N 134 CYS N H sing N N 135 CYS N H2 sing N N 136 CYS CA C sing N N 137 CYS CA CB sing N N 138 CYS CA HA sing N N 139 CYS C O doub N N 140 CYS C OXT sing N N 141 CYS CB SG sing N N 142 CYS CB HB2 sing N N 143 CYS CB HB3 sing N N 144 CYS SG HG sing N N 145 CYS OXT HXT sing N N 146 GLN N CA sing N N 147 GLN N H sing N N 148 GLN N H2 sing N N 149 GLN CA C sing N N 150 GLN CA CB sing N N 151 GLN CA HA sing N N 152 GLN C O doub N N 153 GLN C OXT sing N N 154 GLN CB CG sing N N 155 GLN CB HB2 sing N N 156 GLN CB HB3 sing N N 157 GLN CG CD sing N N 158 GLN CG HG2 sing N N 159 GLN CG HG3 sing N N 160 GLN CD OE1 doub N N 161 GLN CD NE2 sing N N 162 GLN NE2 HE21 sing N N 163 GLN NE2 HE22 sing N N 164 GLN OXT HXT sing N N 165 GLU N CA sing N N 166 GLU N H sing N N 167 GLU N H2 sing N N 168 GLU CA C sing N N 169 GLU CA CB sing N N 170 GLU CA HA sing N N 171 GLU C O doub N N 172 GLU C OXT sing N N 173 GLU CB CG sing N N 174 GLU CB HB2 sing N N 175 GLU CB HB3 sing N N 176 GLU CG CD sing N N 177 GLU CG HG2 sing N N 178 GLU CG HG3 sing N N 179 GLU CD OE1 doub N N 180 GLU CD OE2 sing N N 181 GLU OE2 HE2 sing N N 182 GLU OXT HXT sing N N 183 GLY N CA sing N N 184 GLY N H sing N N 185 GLY N H2 sing N N 186 GLY CA C sing N N 187 GLY CA HA2 sing N N 188 GLY CA HA3 sing N N 189 GLY C O doub N N 190 GLY C OXT sing N N 191 GLY OXT HXT sing N N 192 HIS N CA sing N N 193 HIS N H sing N N 194 HIS N H2 sing N N 195 HIS CA C sing N N 196 HIS CA CB sing N N 197 HIS CA HA sing N N 198 HIS C O doub N N 199 HIS C OXT sing N N 200 HIS CB CG sing N N 201 HIS CB HB2 sing N N 202 HIS CB HB3 sing N N 203 HIS CG ND1 sing Y N 204 HIS CG CD2 doub Y N 205 HIS ND1 CE1 doub Y N 206 HIS ND1 HD1 sing N N 207 HIS CD2 NE2 sing Y N 208 HIS CD2 HD2 sing N N 209 HIS CE1 NE2 sing Y N 210 HIS CE1 HE1 sing N N 211 HIS NE2 HE2 sing N N 212 HIS OXT HXT sing N N 213 HOH O H1 sing N N 214 HOH O H2 sing N N 215 ILE N CA sing N N 216 ILE N H sing N N 217 ILE N H2 sing N N 218 ILE CA C sing N N 219 ILE CA CB sing N N 220 ILE CA HA sing N N 221 ILE C O doub N N 222 ILE C OXT sing N N 223 ILE CB CG1 sing N N 224 ILE CB CG2 sing N N 225 ILE CB HB sing N N 226 ILE CG1 CD1 sing N N 227 ILE CG1 HG12 sing N N 228 ILE CG1 HG13 sing N N 229 ILE CG2 HG21 sing N N 230 ILE CG2 HG22 sing N N 231 ILE CG2 HG23 sing N N 232 ILE CD1 HD11 sing N N 233 ILE CD1 HD12 sing N N 234 ILE CD1 HD13 sing N N 235 ILE OXT HXT sing N N 236 LEU N CA sing N N 237 LEU N H sing N N 238 LEU N H2 sing N N 239 LEU CA C sing N N 240 LEU CA CB sing N N 241 LEU CA HA sing N N 242 LEU C O doub N N 243 LEU C OXT sing N N 244 LEU CB CG sing N N 245 LEU CB HB2 sing N N 246 LEU CB HB3 sing N N 247 LEU CG CD1 sing N N 248 LEU CG CD2 sing N N 249 LEU CG HG sing N N 250 LEU CD1 HD11 sing N N 251 LEU CD1 HD12 sing N N 252 LEU CD1 HD13 sing N N 253 LEU CD2 HD21 sing N N 254 LEU CD2 HD22 sing N N 255 LEU CD2 HD23 sing N N 256 LEU OXT HXT sing N N 257 LYS N CA sing N N 258 LYS N H sing N N 259 LYS N H2 sing N N 260 LYS CA C sing N N 261 LYS CA CB sing N N 262 LYS CA HA sing N N 263 LYS C O doub N N 264 LYS C OXT sing N N 265 LYS CB CG sing N N 266 LYS CB HB2 sing N N 267 LYS CB HB3 sing N N 268 LYS CG CD sing N N 269 LYS CG HG2 sing N N 270 LYS CG HG3 sing N N 271 LYS CD CE sing N N 272 LYS CD HD2 sing N N 273 LYS CD HD3 sing N N 274 LYS CE NZ sing N N 275 LYS CE HE2 sing N N 276 LYS CE HE3 sing N N 277 LYS NZ HZ1 sing N N 278 LYS NZ HZ2 sing N N 279 LYS NZ HZ3 sing N N 280 LYS OXT HXT sing N N 281 MET N CA sing N N 282 MET N H sing N N 283 MET N H2 sing N N 284 MET CA C sing N N 285 MET CA CB sing N N 286 MET CA HA sing N N 287 MET C O doub N N 288 MET C OXT sing N N 289 MET CB CG sing N N 290 MET CB HB2 sing N N 291 MET CB HB3 sing N N 292 MET CG SD sing N N 293 MET CG HG2 sing N N 294 MET CG HG3 sing N N 295 MET SD CE sing N N 296 MET CE HE1 sing N N 297 MET CE HE2 sing N N 298 MET CE HE3 sing N N 299 MET OXT HXT sing N N 300 PHE N CA sing N N 301 PHE N H sing N N 302 PHE N H2 sing N N 303 PHE CA C sing N N 304 PHE CA CB sing N N 305 PHE CA HA sing N N 306 PHE C O doub N N 307 PHE C OXT sing N N 308 PHE CB CG sing N N 309 PHE CB HB2 sing N N 310 PHE CB HB3 sing N N 311 PHE CG CD1 doub Y N 312 PHE CG CD2 sing Y N 313 PHE CD1 CE1 sing Y N 314 PHE CD1 HD1 sing N N 315 PHE CD2 CE2 doub Y N 316 PHE CD2 HD2 sing N N 317 PHE CE1 CZ doub Y N 318 PHE CE1 HE1 sing N N 319 PHE CE2 CZ sing Y N 320 PHE CE2 HE2 sing N N 321 PHE CZ HZ sing N N 322 PHE OXT HXT sing N N 323 PRO N CA sing N N 324 PRO N CD sing N N 325 PRO N H sing N N 326 PRO CA C sing N N 327 PRO CA CB sing N N 328 PRO CA HA sing N N 329 PRO C O doub N N 330 PRO C OXT sing N N 331 PRO CB CG sing N N 332 PRO CB HB2 sing N N 333 PRO CB HB3 sing N N 334 PRO CG CD sing N N 335 PRO CG HG2 sing N N 336 PRO CG HG3 sing N N 337 PRO CD HD2 sing N N 338 PRO CD HD3 sing N N 339 PRO OXT HXT sing N N 340 SER N CA sing N N 341 SER N H sing N N 342 SER N H2 sing N N 343 SER CA C sing N N 344 SER CA CB sing N N 345 SER CA HA sing N N 346 SER C O doub N N 347 SER C OXT sing N N 348 SER CB OG sing N N 349 SER CB HB2 sing N N 350 SER CB HB3 sing N N 351 SER OG HG sing N N 352 SER OXT HXT sing N N 353 THR N CA sing N N 354 THR N H sing N N 355 THR N H2 sing N N 356 THR CA C sing N N 357 THR CA CB sing N N 358 THR CA HA sing N N 359 THR C O doub N N 360 THR C OXT sing N N 361 THR CB OG1 sing N N 362 THR CB CG2 sing N N 363 THR CB HB sing N N 364 THR OG1 HG1 sing N N 365 THR CG2 HG21 sing N N 366 THR CG2 HG22 sing N N 367 THR CG2 HG23 sing N N 368 THR OXT HXT sing N N 369 TRP N CA sing N N 370 TRP N H sing N N 371 TRP N H2 sing N N 372 TRP CA C sing N N 373 TRP CA CB sing N N 374 TRP CA HA sing N N 375 TRP C O doub N N 376 TRP C OXT sing N N 377 TRP CB CG sing N N 378 TRP CB HB2 sing N N 379 TRP CB HB3 sing N N 380 TRP CG CD1 doub Y N 381 TRP CG CD2 sing Y N 382 TRP CD1 NE1 sing Y N 383 TRP CD1 HD1 sing N N 384 TRP CD2 CE2 doub Y N 385 TRP CD2 CE3 sing Y N 386 TRP NE1 CE2 sing Y N 387 TRP NE1 HE1 sing N N 388 TRP CE2 CZ2 sing Y N 389 TRP CE3 CZ3 doub Y N 390 TRP CE3 HE3 sing N N 391 TRP CZ2 CH2 doub Y N 392 TRP CZ2 HZ2 sing N N 393 TRP CZ3 CH2 sing Y N 394 TRP CZ3 HZ3 sing N N 395 TRP CH2 HH2 sing N N 396 TRP OXT HXT sing N N 397 TYR N CA sing N N 398 TYR N H sing N N 399 TYR N H2 sing N N 400 TYR CA C sing N N 401 TYR CA CB sing N N 402 TYR CA HA sing N N 403 TYR C O doub N N 404 TYR C OXT sing N N 405 TYR CB CG sing N N 406 TYR CB HB2 sing N N 407 TYR CB HB3 sing N N 408 TYR CG CD1 doub Y N 409 TYR CG CD2 sing Y N 410 TYR CD1 CE1 sing Y N 411 TYR CD1 HD1 sing N N 412 TYR CD2 CE2 doub Y N 413 TYR CD2 HD2 sing N N 414 TYR CE1 CZ doub Y N 415 TYR CE1 HE1 sing N N 416 TYR CE2 CZ sing Y N 417 TYR CE2 HE2 sing N N 418 TYR CZ OH sing N N 419 TYR OH HH sing N N 420 TYR OXT HXT sing N N 421 VAL N CA sing N N 422 VAL N H sing N N 423 VAL N H2 sing N N 424 VAL CA C sing N N 425 VAL CA CB sing N N 426 VAL CA HA sing N N 427 VAL C O doub N N 428 VAL C OXT sing N N 429 VAL CB CG1 sing N N 430 VAL CB CG2 sing N N 431 VAL CB HB sing N N 432 VAL CG1 HG11 sing N N 433 VAL CG1 HG12 sing N N 434 VAL CG1 HG13 sing N N 435 VAL CG2 HG21 sing N N 436 VAL CG2 HG22 sing N N 437 VAL CG2 HG23 sing N N 438 VAL OXT HXT sing N N 439 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6QFL _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 7OVI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016202 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014601 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011906 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #