data_7OXB # _entry.id 7OXB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7OXB pdb_00007oxb 10.2210/pdb7oxb/pdb WWPDB D_1292116580 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7OXB _pdbx_database_status.recvd_initial_deposition_date 2021-06-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Collie, G.W.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-0406-922X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Bioorg.Med.Chem.Lett. _citation.journal_id_ASTM BMCLE8 _citation.journal_id_CSD 1127 _citation.journal_id_ISSN 1464-3405 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first 128406 _citation.page_last 128406 _citation.title ;Discovery and optimization of covalent EGFR T790M/L858R mutant inhibitors". ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bmcl.2021.128406 _citation.pdbx_database_id_PubMed 34624491 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hoogenboom, N.' 1 ? primary 'Demont, D.' 2 ? primary 'de Zwart, E.' 3 ? primary 'Verkaik, S.' 4 ? primary 'Emmelot, M.' 5 ? primary 'van de Kar, B.' 6 ? primary 'Kaptein, A.' 7 ? primary 'Barf, T.' 8 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7OXB _cell.details ? _cell.formula_units_Z ? _cell.length_a 147.715 _cell.length_a_esd ? _cell.length_b 147.715 _cell.length_b_esd ? _cell.length_c 147.715 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7OXB _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Epidermal growth factor receptor' 37324.273 1 2.7.10.1 ? 'KINASE DOMAIN' ? 2 non-polymer syn "2-[2-(3-methoxyphenyl)pyrimidin-4-yl]-1'-prop-2-enoyl-spiro[5,6-dihydro-1~{H}-pyrrolo[3,2-c]pyridine-7,4'-piperidine]-4-one" 443.498 1 ? ? ? ? 3 water nat water 18.015 31 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proto-oncogene c-ErbB-1,Receptor tyrosine-protein kinase erbB-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV CRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKIT DFGRAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLP QPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDAD EYLIPQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV CRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKIT DFGRAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLP QPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDAD EYLIPQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 GLU n 1 4 ALA n 1 5 PRO n 1 6 ASN n 1 7 GLN n 1 8 ALA n 1 9 LEU n 1 10 LEU n 1 11 ARG n 1 12 ILE n 1 13 LEU n 1 14 LYS n 1 15 GLU n 1 16 THR n 1 17 GLU n 1 18 PHE n 1 19 LYS n 1 20 LYS n 1 21 ILE n 1 22 LYS n 1 23 VAL n 1 24 LEU n 1 25 GLY n 1 26 SER n 1 27 GLY n 1 28 ALA n 1 29 PHE n 1 30 GLY n 1 31 THR n 1 32 VAL n 1 33 TYR n 1 34 LYS n 1 35 GLY n 1 36 LEU n 1 37 TRP n 1 38 ILE n 1 39 PRO n 1 40 GLU n 1 41 GLY n 1 42 GLU n 1 43 LYS n 1 44 VAL n 1 45 LYS n 1 46 ILE n 1 47 PRO n 1 48 VAL n 1 49 ALA n 1 50 ILE n 1 51 LYS n 1 52 GLU n 1 53 LEU n 1 54 ARG n 1 55 GLU n 1 56 ALA n 1 57 THR n 1 58 SER n 1 59 PRO n 1 60 LYS n 1 61 ALA n 1 62 ASN n 1 63 LYS n 1 64 GLU n 1 65 ILE n 1 66 LEU n 1 67 ASP n 1 68 GLU n 1 69 ALA n 1 70 TYR n 1 71 VAL n 1 72 MET n 1 73 ALA n 1 74 SER n 1 75 VAL n 1 76 ASP n 1 77 ASN n 1 78 PRO n 1 79 HIS n 1 80 VAL n 1 81 CYS n 1 82 ARG n 1 83 LEU n 1 84 LEU n 1 85 GLY n 1 86 ILE n 1 87 CYS n 1 88 LEU n 1 89 THR n 1 90 SER n 1 91 THR n 1 92 VAL n 1 93 GLN n 1 94 LEU n 1 95 ILE n 1 96 MET n 1 97 GLN n 1 98 LEU n 1 99 MET n 1 100 PRO n 1 101 PHE n 1 102 GLY n 1 103 CYS n 1 104 LEU n 1 105 LEU n 1 106 ASP n 1 107 TYR n 1 108 VAL n 1 109 ARG n 1 110 GLU n 1 111 HIS n 1 112 LYS n 1 113 ASP n 1 114 ASN n 1 115 ILE n 1 116 GLY n 1 117 SER n 1 118 GLN n 1 119 TYR n 1 120 LEU n 1 121 LEU n 1 122 ASN n 1 123 TRP n 1 124 CYS n 1 125 VAL n 1 126 GLN n 1 127 ILE n 1 128 ALA n 1 129 LYS n 1 130 GLY n 1 131 MET n 1 132 ASN n 1 133 TYR n 1 134 LEU n 1 135 GLU n 1 136 ASP n 1 137 ARG n 1 138 ARG n 1 139 LEU n 1 140 VAL n 1 141 HIS n 1 142 ARG n 1 143 ASP n 1 144 LEU n 1 145 ALA n 1 146 ALA n 1 147 ARG n 1 148 ASN n 1 149 VAL n 1 150 LEU n 1 151 VAL n 1 152 LYS n 1 153 THR n 1 154 PRO n 1 155 GLN n 1 156 HIS n 1 157 VAL n 1 158 LYS n 1 159 ILE n 1 160 THR n 1 161 ASP n 1 162 PHE n 1 163 GLY n 1 164 ARG n 1 165 ALA n 1 166 LYS n 1 167 LEU n 1 168 LEU n 1 169 GLY n 1 170 ALA n 1 171 GLU n 1 172 GLU n 1 173 LYS n 1 174 GLU n 1 175 TYR n 1 176 HIS n 1 177 ALA n 1 178 GLU n 1 179 GLY n 1 180 GLY n 1 181 LYS n 1 182 VAL n 1 183 PRO n 1 184 ILE n 1 185 LYS n 1 186 TRP n 1 187 MET n 1 188 ALA n 1 189 LEU n 1 190 GLU n 1 191 SER n 1 192 ILE n 1 193 LEU n 1 194 HIS n 1 195 ARG n 1 196 ILE n 1 197 TYR n 1 198 THR n 1 199 HIS n 1 200 GLN n 1 201 SER n 1 202 ASP n 1 203 VAL n 1 204 TRP n 1 205 SER n 1 206 TYR n 1 207 GLY n 1 208 VAL n 1 209 THR n 1 210 VAL n 1 211 TRP n 1 212 GLU n 1 213 LEU n 1 214 MET n 1 215 THR n 1 216 PHE n 1 217 GLY n 1 218 SER n 1 219 LYS n 1 220 PRO n 1 221 TYR n 1 222 ASP n 1 223 GLY n 1 224 ILE n 1 225 PRO n 1 226 ALA n 1 227 SER n 1 228 GLU n 1 229 ILE n 1 230 SER n 1 231 SER n 1 232 ILE n 1 233 LEU n 1 234 GLU n 1 235 LYS n 1 236 GLY n 1 237 GLU n 1 238 ARG n 1 239 LEU n 1 240 PRO n 1 241 GLN n 1 242 PRO n 1 243 PRO n 1 244 ILE n 1 245 CYS n 1 246 THR n 1 247 ILE n 1 248 ASP n 1 249 VAL n 1 250 TYR n 1 251 MET n 1 252 ILE n 1 253 MET n 1 254 VAL n 1 255 LYS n 1 256 CYS n 1 257 TRP n 1 258 MET n 1 259 ILE n 1 260 ASP n 1 261 ALA n 1 262 ASP n 1 263 SER n 1 264 ARG n 1 265 PRO n 1 266 LYS n 1 267 PHE n 1 268 ARG n 1 269 GLU n 1 270 LEU n 1 271 ILE n 1 272 ILE n 1 273 GLU n 1 274 PHE n 1 275 SER n 1 276 LYS n 1 277 MET n 1 278 ALA n 1 279 ARG n 1 280 ASP n 1 281 PRO n 1 282 GLN n 1 283 ARG n 1 284 TYR n 1 285 LEU n 1 286 VAL n 1 287 ILE n 1 288 GLN n 1 289 GLY n 1 290 ASP n 1 291 GLU n 1 292 ARG n 1 293 MET n 1 294 HIS n 1 295 LEU n 1 296 PRO n 1 297 SER n 1 298 PRO n 1 299 THR n 1 300 ASP n 1 301 SER n 1 302 ASN n 1 303 PHE n 1 304 TYR n 1 305 ARG n 1 306 ALA n 1 307 LEU n 1 308 MET n 1 309 ASP n 1 310 GLU n 1 311 GLU n 1 312 ASP n 1 313 MET n 1 314 ASP n 1 315 ASP n 1 316 VAL n 1 317 VAL n 1 318 ASP n 1 319 ALA n 1 320 ASP n 1 321 GLU n 1 322 TYR n 1 323 LEU n 1 324 ILE n 1 325 PRO n 1 326 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 326 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EGFR, ERBB, ERBB1, HER1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EGFR_HUMAN _struct_ref.pdbx_db_accession P00533 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVC RLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITD FGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ PPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADE YLIPQ ; _struct_ref.pdbx_align_begin 696 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7OXB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 326 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00533 _struct_ref_seq.db_align_beg 696 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1020 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 696 _struct_ref_seq.pdbx_auth_seq_align_end 1020 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7OXB MET A 1 ? UNP P00533 ? ? 'initiating methionine' 695 1 1 7OXB MET A 96 ? UNP P00533 THR 790 variant 790 2 1 7OXB ARG A 164 ? UNP P00533 LEU 858 variant 858 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 35Z non-polymer . "2-[2-(3-methoxyphenyl)pyrimidin-4-yl]-1'-prop-2-enoyl-spiro[5,6-dihydro-1~{H}-pyrrolo[3,2-c]pyridine-7,4'-piperidine]-4-one" ? 'C25 H25 N5 O3' 443.498 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7OXB _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.670 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.530 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details Unknown _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100.000 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-02-24 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7OXB _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.560 _reflns.d_resolution_low 104.450 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16941 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.300 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.000 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.07 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.34 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.560 _reflns_shell.d_res_low 2.810 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 4103 _reflns_shell.percent_possible_all 98.500 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.000 _reflns_shell.pdbx_Rsym_value 0.441 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 133.370 _refine.B_iso_mean 31.9500 _refine.B_iso_min 20.990 _refine.correlation_coeff_Fo_to_Fc 0.9450 _refine.correlation_coeff_Fo_to_Fc_free 0.9290 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7OXB _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5600 _refine.ls_d_res_low 104.4500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16030 _refine.ls_number_reflns_R_free 910 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.2900 _refine.ls_percent_reflns_R_free 5.4000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2003 _refine.ls_R_factor_R_free 0.2274 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1988 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model NONE _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.3240 _refine.pdbx_overall_ESU_R_Free 0.2330 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 16.3110 _refine.overall_SU_ML 0.1710 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5600 _refine_hist.d_res_low 104.4500 _refine_hist.number_atoms_solvent 31 _refine_hist.number_atoms_total 2506 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 305 _refine_hist.pdbx_B_iso_mean_ligand 43.75 _refine_hist.pdbx_B_iso_mean_solvent 50.06 _refine_hist.pdbx_number_atoms_protein 2442 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.020 2447 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1708 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.041 1.989 3324 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.964 3.000 4121 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.162 5.000 301 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.504 24.086 93 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 10.931 15.000 417 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.305 15.000 12 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.059 0.200 376 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.021 2656 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 470 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.5610 _refine_ls_shell.d_res_low 2.6270 _refine_ls_shell.number_reflns_all 1169 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 66 _refine_ls_shell.number_reflns_R_work 1103 _refine_ls_shell.percent_reflns_obs 97.2500 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3620 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3450 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7OXB _struct.title 'Crystal structure of EGFR double mutant (T790M/L858R) in complex with compound 6.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7OXB _struct_keywords.text 'Kinase, inhibitor, EGFR, mutant, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 14 ? THR A 16 ? LYS A 708 THR A 710 5 ? 3 HELX_P HELX_P2 AA2 PRO A 59 ? VAL A 75 ? PRO A 753 VAL A 769 1 ? 17 HELX_P HELX_P3 AA3 CYS A 103 ? HIS A 111 ? CYS A 797 HIS A 805 1 ? 9 HELX_P HELX_P4 AA4 LYS A 112 ? ILE A 115 ? LYS A 806 ILE A 809 5 ? 4 HELX_P HELX_P5 AA5 GLY A 116 ? ARG A 137 ? GLY A 810 ARG A 831 1 ? 22 HELX_P HELX_P6 AA6 ALA A 145 ? ARG A 147 ? ALA A 839 ARG A 841 5 ? 3 HELX_P HELX_P7 AA7 PRO A 183 ? MET A 187 ? PRO A 877 MET A 881 5 ? 5 HELX_P HELX_P8 AA8 ALA A 188 ? ARG A 195 ? ALA A 882 ARG A 889 1 ? 8 HELX_P HELX_P9 AA9 THR A 198 ? THR A 215 ? THR A 892 THR A 909 1 ? 18 HELX_P HELX_P10 AB1 PRO A 225 ? SER A 227 ? PRO A 919 SER A 921 5 ? 3 HELX_P HELX_P11 AB2 GLU A 228 ? LYS A 235 ? GLU A 922 LYS A 929 1 ? 8 HELX_P HELX_P12 AB3 THR A 246 ? TRP A 257 ? THR A 940 TRP A 951 1 ? 12 HELX_P HELX_P13 AB4 ASP A 260 ? ARG A 264 ? ASP A 954 ARG A 958 5 ? 5 HELX_P HELX_P14 AB5 LYS A 266 ? ARG A 279 ? LYS A 960 ARG A 973 1 ? 14 HELX_P HELX_P15 AB6 ASP A 280 ? LEU A 285 ? ASP A 974 LEU A 979 1 ? 6 HELX_P HELX_P16 AB7 ASP A 318 ? TYR A 322 ? ASP A 1012 TYR A 1016 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 103 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id 35Z _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C33 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 797 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id 35Z _struct_conn.ptnr2_auth_seq_id 1101 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.742 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 18 ? GLY A 27 ? PHE A 712 GLY A 721 AA1 2 GLY A 30 ? TRP A 37 ? GLY A 724 TRP A 731 AA1 3 ILE A 46 ? GLU A 52 ? ILE A 740 GLU A 746 AA1 4 VAL A 92 ? GLN A 97 ? VAL A 786 GLN A 791 AA1 5 LEU A 83 ? LEU A 88 ? LEU A 777 LEU A 782 AA2 1 LEU A 139 ? VAL A 140 ? LEU A 833 VAL A 834 AA2 2 LYS A 166 ? LEU A 167 ? LYS A 860 LEU A 861 AA3 1 VAL A 149 ? THR A 153 ? VAL A 843 THR A 847 AA3 2 HIS A 156 ? ILE A 159 ? HIS A 850 ILE A 853 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 22 ? N LYS A 716 O LYS A 34 ? O LYS A 728 AA1 2 3 N TRP A 37 ? N TRP A 731 O ILE A 46 ? O ILE A 740 AA1 3 4 N ALA A 49 ? N ALA A 743 O MET A 96 ? O MET A 790 AA1 4 5 O ILE A 95 ? O ILE A 789 N GLY A 85 ? N GLY A 779 AA2 1 2 N VAL A 140 ? N VAL A 834 O LYS A 166 ? O LYS A 860 AA3 1 2 N LEU A 150 ? N LEU A 844 O LYS A 158 ? O LYS A 852 # _atom_sites.entry_id 7OXB _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.006770 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006770 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006770 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 695 695 MET MET A . n A 1 2 GLY 2 696 696 GLY GLY A . n A 1 3 GLU 3 697 697 GLU GLU A . n A 1 4 ALA 4 698 698 ALA ALA A . n A 1 5 PRO 5 699 699 PRO PRO A . n A 1 6 ASN 6 700 700 ASN ASN A . n A 1 7 GLN 7 701 701 GLN GLN A . n A 1 8 ALA 8 702 702 ALA ALA A . n A 1 9 LEU 9 703 703 LEU LEU A . n A 1 10 LEU 10 704 704 LEU LEU A . n A 1 11 ARG 11 705 705 ARG ARG A . n A 1 12 ILE 12 706 706 ILE ILE A . n A 1 13 LEU 13 707 707 LEU LEU A . n A 1 14 LYS 14 708 708 LYS LYS A . n A 1 15 GLU 15 709 709 GLU GLU A . n A 1 16 THR 16 710 710 THR THR A . n A 1 17 GLU 17 711 711 GLU GLU A . n A 1 18 PHE 18 712 712 PHE PHE A . n A 1 19 LYS 19 713 713 LYS LYS A . n A 1 20 LYS 20 714 714 LYS LYS A . n A 1 21 ILE 21 715 715 ILE ILE A . n A 1 22 LYS 22 716 716 LYS LYS A . n A 1 23 VAL 23 717 717 VAL VAL A . n A 1 24 LEU 24 718 718 LEU LEU A . n A 1 25 GLY 25 719 719 GLY GLY A . n A 1 26 SER 26 720 720 SER SER A . n A 1 27 GLY 27 721 721 GLY GLY A . n A 1 28 ALA 28 722 722 ALA ALA A . n A 1 29 PHE 29 723 723 PHE PHE A . n A 1 30 GLY 30 724 724 GLY GLY A . n A 1 31 THR 31 725 725 THR THR A . n A 1 32 VAL 32 726 726 VAL VAL A . n A 1 33 TYR 33 727 727 TYR TYR A . n A 1 34 LYS 34 728 728 LYS LYS A . n A 1 35 GLY 35 729 729 GLY GLY A . n A 1 36 LEU 36 730 730 LEU LEU A . n A 1 37 TRP 37 731 731 TRP TRP A . n A 1 38 ILE 38 732 732 ILE ILE A . n A 1 39 PRO 39 733 733 PRO PRO A . n A 1 40 GLU 40 734 734 GLU GLU A . n A 1 41 GLY 41 735 735 GLY GLY A . n A 1 42 GLU 42 736 736 GLU GLU A . n A 1 43 LYS 43 737 737 LYS LYS A . n A 1 44 VAL 44 738 738 VAL VAL A . n A 1 45 LYS 45 739 739 LYS LYS A . n A 1 46 ILE 46 740 740 ILE ILE A . n A 1 47 PRO 47 741 741 PRO PRO A . n A 1 48 VAL 48 742 742 VAL VAL A . n A 1 49 ALA 49 743 743 ALA ALA A . n A 1 50 ILE 50 744 744 ILE ILE A . n A 1 51 LYS 51 745 745 LYS LYS A . n A 1 52 GLU 52 746 746 GLU GLU A . n A 1 53 LEU 53 747 747 LEU LEU A . n A 1 54 ARG 54 748 748 ARG ARG A . n A 1 55 GLU 55 749 ? ? ? A . n A 1 56 ALA 56 750 ? ? ? A . n A 1 57 THR 57 751 ? ? ? A . n A 1 58 SER 58 752 752 SER SER A . n A 1 59 PRO 59 753 753 PRO PRO A . n A 1 60 LYS 60 754 754 LYS LYS A . n A 1 61 ALA 61 755 755 ALA ALA A . n A 1 62 ASN 62 756 756 ASN ASN A . n A 1 63 LYS 63 757 757 LYS LYS A . n A 1 64 GLU 64 758 758 GLU GLU A . n A 1 65 ILE 65 759 759 ILE ILE A . n A 1 66 LEU 66 760 760 LEU LEU A . n A 1 67 ASP 67 761 761 ASP ASP A . n A 1 68 GLU 68 762 762 GLU GLU A . n A 1 69 ALA 69 763 763 ALA ALA A . n A 1 70 TYR 70 764 764 TYR TYR A . n A 1 71 VAL 71 765 765 VAL VAL A . n A 1 72 MET 72 766 766 MET MET A . n A 1 73 ALA 73 767 767 ALA ALA A . n A 1 74 SER 74 768 768 SER SER A . n A 1 75 VAL 75 769 769 VAL VAL A . n A 1 76 ASP 76 770 770 ASP ASP A . n A 1 77 ASN 77 771 771 ASN ASN A . n A 1 78 PRO 78 772 772 PRO PRO A . n A 1 79 HIS 79 773 773 HIS HIS A . n A 1 80 VAL 80 774 774 VAL VAL A . n A 1 81 CYS 81 775 775 CYS CYS A . n A 1 82 ARG 82 776 776 ARG ARG A . n A 1 83 LEU 83 777 777 LEU LEU A . n A 1 84 LEU 84 778 778 LEU LEU A . n A 1 85 GLY 85 779 779 GLY GLY A . n A 1 86 ILE 86 780 780 ILE ILE A . n A 1 87 CYS 87 781 781 CYS CYS A . n A 1 88 LEU 88 782 782 LEU LEU A . n A 1 89 THR 89 783 783 THR THR A . n A 1 90 SER 90 784 784 SER SER A . n A 1 91 THR 91 785 785 THR THR A . n A 1 92 VAL 92 786 786 VAL VAL A . n A 1 93 GLN 93 787 787 GLN GLN A . n A 1 94 LEU 94 788 788 LEU LEU A . n A 1 95 ILE 95 789 789 ILE ILE A . n A 1 96 MET 96 790 790 MET MET A . n A 1 97 GLN 97 791 791 GLN GLN A . n A 1 98 LEU 98 792 792 LEU LEU A . n A 1 99 MET 99 793 793 MET MET A . n A 1 100 PRO 100 794 794 PRO PRO A . n A 1 101 PHE 101 795 795 PHE PHE A . n A 1 102 GLY 102 796 796 GLY GLY A . n A 1 103 CYS 103 797 797 CYS CYS A . n A 1 104 LEU 104 798 798 LEU LEU A . n A 1 105 LEU 105 799 799 LEU LEU A . n A 1 106 ASP 106 800 800 ASP ASP A . n A 1 107 TYR 107 801 801 TYR TYR A . n A 1 108 VAL 108 802 802 VAL VAL A . n A 1 109 ARG 109 803 803 ARG ARG A . n A 1 110 GLU 110 804 804 GLU GLU A . n A 1 111 HIS 111 805 805 HIS HIS A . n A 1 112 LYS 112 806 806 LYS LYS A . n A 1 113 ASP 113 807 807 ASP ASP A . n A 1 114 ASN 114 808 808 ASN ASN A . n A 1 115 ILE 115 809 809 ILE ILE A . n A 1 116 GLY 116 810 810 GLY GLY A . n A 1 117 SER 117 811 811 SER SER A . n A 1 118 GLN 118 812 812 GLN GLN A . n A 1 119 TYR 119 813 813 TYR TYR A . n A 1 120 LEU 120 814 814 LEU LEU A . n A 1 121 LEU 121 815 815 LEU LEU A . n A 1 122 ASN 122 816 816 ASN ASN A . n A 1 123 TRP 123 817 817 TRP TRP A . n A 1 124 CYS 124 818 818 CYS CYS A . n A 1 125 VAL 125 819 819 VAL VAL A . n A 1 126 GLN 126 820 820 GLN GLN A . n A 1 127 ILE 127 821 821 ILE ILE A . n A 1 128 ALA 128 822 822 ALA ALA A . n A 1 129 LYS 129 823 823 LYS LYS A . n A 1 130 GLY 130 824 824 GLY GLY A . n A 1 131 MET 131 825 825 MET MET A . n A 1 132 ASN 132 826 826 ASN ASN A . n A 1 133 TYR 133 827 827 TYR TYR A . n A 1 134 LEU 134 828 828 LEU LEU A . n A 1 135 GLU 135 829 829 GLU GLU A . n A 1 136 ASP 136 830 830 ASP ASP A . n A 1 137 ARG 137 831 831 ARG ARG A . n A 1 138 ARG 138 832 832 ARG ARG A . n A 1 139 LEU 139 833 833 LEU LEU A . n A 1 140 VAL 140 834 834 VAL VAL A . n A 1 141 HIS 141 835 835 HIS HIS A . n A 1 142 ARG 142 836 836 ARG ARG A . n A 1 143 ASP 143 837 837 ASP ASP A . n A 1 144 LEU 144 838 838 LEU LEU A . n A 1 145 ALA 145 839 839 ALA ALA A . n A 1 146 ALA 146 840 840 ALA ALA A . n A 1 147 ARG 147 841 841 ARG ARG A . n A 1 148 ASN 148 842 842 ASN ASN A . n A 1 149 VAL 149 843 843 VAL VAL A . n A 1 150 LEU 150 844 844 LEU LEU A . n A 1 151 VAL 151 845 845 VAL VAL A . n A 1 152 LYS 152 846 846 LYS LYS A . n A 1 153 THR 153 847 847 THR THR A . n A 1 154 PRO 154 848 848 PRO PRO A . n A 1 155 GLN 155 849 849 GLN GLN A . n A 1 156 HIS 156 850 850 HIS HIS A . n A 1 157 VAL 157 851 851 VAL VAL A . n A 1 158 LYS 158 852 852 LYS LYS A . n A 1 159 ILE 159 853 853 ILE ILE A . n A 1 160 THR 160 854 854 THR THR A . n A 1 161 ASP 161 855 855 ASP ASP A . n A 1 162 PHE 162 856 856 PHE PHE A . n A 1 163 GLY 163 857 857 GLY GLY A . n A 1 164 ARG 164 858 858 ARG ARG A . n A 1 165 ALA 165 859 859 ALA ALA A . n A 1 166 LYS 166 860 860 LYS LYS A . n A 1 167 LEU 167 861 861 LEU LEU A . n A 1 168 LEU 168 862 862 LEU LEU A . n A 1 169 GLY 169 863 863 GLY GLY A . n A 1 170 ALA 170 864 ? ? ? A . n A 1 171 GLU 171 865 ? ? ? A . n A 1 172 GLU 172 866 ? ? ? A . n A 1 173 LYS 173 867 ? ? ? A . n A 1 174 GLU 174 868 ? ? ? A . n A 1 175 TYR 175 869 ? ? ? A . n A 1 176 HIS 176 870 870 HIS HIS A . n A 1 177 ALA 177 871 871 ALA ALA A . n A 1 178 GLU 178 872 872 GLU GLU A . n A 1 179 GLY 179 873 873 GLY GLY A . n A 1 180 GLY 180 874 874 GLY GLY A . n A 1 181 LYS 181 875 875 LYS LYS A . n A 1 182 VAL 182 876 876 VAL VAL A . n A 1 183 PRO 183 877 877 PRO PRO A . n A 1 184 ILE 184 878 878 ILE ILE A . n A 1 185 LYS 185 879 879 LYS LYS A . n A 1 186 TRP 186 880 880 TRP TRP A . n A 1 187 MET 187 881 881 MET MET A . n A 1 188 ALA 188 882 882 ALA ALA A . n A 1 189 LEU 189 883 883 LEU LEU A . n A 1 190 GLU 190 884 884 GLU GLU A . n A 1 191 SER 191 885 885 SER SER A . n A 1 192 ILE 192 886 886 ILE ILE A . n A 1 193 LEU 193 887 887 LEU LEU A . n A 1 194 HIS 194 888 888 HIS HIS A . n A 1 195 ARG 195 889 889 ARG ARG A . n A 1 196 ILE 196 890 890 ILE ILE A . n A 1 197 TYR 197 891 891 TYR TYR A . n A 1 198 THR 198 892 892 THR THR A . n A 1 199 HIS 199 893 893 HIS HIS A . n A 1 200 GLN 200 894 894 GLN GLN A . n A 1 201 SER 201 895 895 SER SER A . n A 1 202 ASP 202 896 896 ASP ASP A . n A 1 203 VAL 203 897 897 VAL VAL A . n A 1 204 TRP 204 898 898 TRP TRP A . n A 1 205 SER 205 899 899 SER SER A . n A 1 206 TYR 206 900 900 TYR TYR A . n A 1 207 GLY 207 901 901 GLY GLY A . n A 1 208 VAL 208 902 902 VAL VAL A . n A 1 209 THR 209 903 903 THR THR A . n A 1 210 VAL 210 904 904 VAL VAL A . n A 1 211 TRP 211 905 905 TRP TRP A . n A 1 212 GLU 212 906 906 GLU GLU A . n A 1 213 LEU 213 907 907 LEU LEU A . n A 1 214 MET 214 908 908 MET MET A . n A 1 215 THR 215 909 909 THR THR A . n A 1 216 PHE 216 910 910 PHE PHE A . n A 1 217 GLY 217 911 911 GLY GLY A . n A 1 218 SER 218 912 912 SER SER A . n A 1 219 LYS 219 913 913 LYS LYS A . n A 1 220 PRO 220 914 914 PRO PRO A . n A 1 221 TYR 221 915 915 TYR TYR A . n A 1 222 ASP 222 916 916 ASP ASP A . n A 1 223 GLY 223 917 917 GLY GLY A . n A 1 224 ILE 224 918 918 ILE ILE A . n A 1 225 PRO 225 919 919 PRO PRO A . n A 1 226 ALA 226 920 920 ALA ALA A . n A 1 227 SER 227 921 921 SER SER A . n A 1 228 GLU 228 922 922 GLU GLU A . n A 1 229 ILE 229 923 923 ILE ILE A . n A 1 230 SER 230 924 924 SER SER A . n A 1 231 SER 231 925 925 SER SER A . n A 1 232 ILE 232 926 926 ILE ILE A . n A 1 233 LEU 233 927 927 LEU LEU A . n A 1 234 GLU 234 928 928 GLU GLU A . n A 1 235 LYS 235 929 929 LYS LYS A . n A 1 236 GLY 236 930 930 GLY GLY A . n A 1 237 GLU 237 931 931 GLU GLU A . n A 1 238 ARG 238 932 932 ARG ARG A . n A 1 239 LEU 239 933 933 LEU LEU A . n A 1 240 PRO 240 934 934 PRO PRO A . n A 1 241 GLN 241 935 935 GLN GLN A . n A 1 242 PRO 242 936 936 PRO PRO A . n A 1 243 PRO 243 937 937 PRO PRO A . n A 1 244 ILE 244 938 938 ILE ILE A . n A 1 245 CYS 245 939 939 CYS CYS A . n A 1 246 THR 246 940 940 THR THR A . n A 1 247 ILE 247 941 941 ILE ILE A . n A 1 248 ASP 248 942 942 ASP ASP A . n A 1 249 VAL 249 943 943 VAL VAL A . n A 1 250 TYR 250 944 944 TYR TYR A . n A 1 251 MET 251 945 945 MET MET A . n A 1 252 ILE 252 946 946 ILE ILE A . n A 1 253 MET 253 947 947 MET MET A . n A 1 254 VAL 254 948 948 VAL VAL A . n A 1 255 LYS 255 949 949 LYS LYS A . n A 1 256 CYS 256 950 950 CYS CYS A . n A 1 257 TRP 257 951 951 TRP TRP A . n A 1 258 MET 258 952 952 MET MET A . n A 1 259 ILE 259 953 953 ILE ILE A . n A 1 260 ASP 260 954 954 ASP ASP A . n A 1 261 ALA 261 955 955 ALA ALA A . n A 1 262 ASP 262 956 956 ASP ASP A . n A 1 263 SER 263 957 957 SER SER A . n A 1 264 ARG 264 958 958 ARG ARG A . n A 1 265 PRO 265 959 959 PRO PRO A . n A 1 266 LYS 266 960 960 LYS LYS A . n A 1 267 PHE 267 961 961 PHE PHE A . n A 1 268 ARG 268 962 962 ARG ARG A . n A 1 269 GLU 269 963 963 GLU GLU A . n A 1 270 LEU 270 964 964 LEU LEU A . n A 1 271 ILE 271 965 965 ILE ILE A . n A 1 272 ILE 272 966 966 ILE ILE A . n A 1 273 GLU 273 967 967 GLU GLU A . n A 1 274 PHE 274 968 968 PHE PHE A . n A 1 275 SER 275 969 969 SER SER A . n A 1 276 LYS 276 970 970 LYS LYS A . n A 1 277 MET 277 971 971 MET MET A . n A 1 278 ALA 278 972 972 ALA ALA A . n A 1 279 ARG 279 973 973 ARG ARG A . n A 1 280 ASP 280 974 974 ASP ASP A . n A 1 281 PRO 281 975 975 PRO PRO A . n A 1 282 GLN 282 976 976 GLN GLN A . n A 1 283 ARG 283 977 977 ARG ARG A . n A 1 284 TYR 284 978 978 TYR TYR A . n A 1 285 LEU 285 979 979 LEU LEU A . n A 1 286 VAL 286 980 980 VAL VAL A . n A 1 287 ILE 287 981 981 ILE ILE A . n A 1 288 GLN 288 982 982 GLN GLN A . n A 1 289 GLY 289 983 983 GLY GLY A . n A 1 290 ASP 290 984 984 ASP ASP A . n A 1 291 GLU 291 985 985 GLU GLU A . n A 1 292 ARG 292 986 986 ARG ARG A . n A 1 293 MET 293 987 987 MET MET A . n A 1 294 HIS 294 988 988 HIS HIS A . n A 1 295 LEU 295 989 989 LEU LEU A . n A 1 296 PRO 296 990 990 PRO PRO A . n A 1 297 SER 297 991 ? ? ? A . n A 1 298 PRO 298 992 ? ? ? A . n A 1 299 THR 299 993 ? ? ? A . n A 1 300 ASP 300 994 ? ? ? A . n A 1 301 SER 301 995 ? ? ? A . n A 1 302 ASN 302 996 ? ? ? A . n A 1 303 PHE 303 997 ? ? ? A . n A 1 304 TYR 304 998 ? ? ? A . n A 1 305 ARG 305 999 ? ? ? A . n A 1 306 ALA 306 1000 ? ? ? A . n A 1 307 LEU 307 1001 ? ? ? A . n A 1 308 MET 308 1002 1002 MET MET A . n A 1 309 ASP 309 1003 1003 ASP ASP A . n A 1 310 GLU 310 1004 1004 GLU GLU A . n A 1 311 GLU 311 1005 1005 GLU GLU A . n A 1 312 ASP 312 1006 1006 ASP ASP A . n A 1 313 MET 313 1007 1007 MET MET A . n A 1 314 ASP 314 1008 1008 ASP ASP A . n A 1 315 ASP 315 1009 1009 ASP ASP A . n A 1 316 VAL 316 1010 1010 VAL VAL A . n A 1 317 VAL 317 1011 1011 VAL VAL A . n A 1 318 ASP 318 1012 1012 ASP ASP A . n A 1 319 ALA 319 1013 1013 ALA ALA A . n A 1 320 ASP 320 1014 1014 ASP ASP A . n A 1 321 GLU 321 1015 1015 GLU GLU A . n A 1 322 TYR 322 1016 1016 TYR TYR A . n A 1 323 LEU 323 1017 1017 LEU LEU A . n A 1 324 ILE 324 1018 1018 ILE ILE A . n A 1 325 PRO 325 1019 1019 PRO PRO A . n A 1 326 GLN 326 1020 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 35Z 1 1101 1 35Z INX A . C 3 HOH 1 1201 7 HOH HOH A . C 3 HOH 2 1202 68 HOH HOH A . C 3 HOH 3 1203 22 HOH HOH A . C 3 HOH 4 1204 64 HOH HOH A . C 3 HOH 5 1205 2 HOH HOH A . C 3 HOH 6 1206 1 HOH HOH A . C 3 HOH 7 1207 4 HOH HOH A . C 3 HOH 8 1208 24 HOH HOH A . C 3 HOH 9 1209 8 HOH HOH A . C 3 HOH 10 1210 32 HOH HOH A . C 3 HOH 11 1211 3 HOH HOH A . C 3 HOH 12 1212 31 HOH HOH A . C 3 HOH 13 1213 65 HOH HOH A . C 3 HOH 14 1214 13 HOH HOH A . C 3 HOH 15 1215 14 HOH HOH A . C 3 HOH 16 1216 37 HOH HOH A . C 3 HOH 17 1217 25 HOH HOH A . C 3 HOH 18 1218 23 HOH HOH A . C 3 HOH 19 1219 35 HOH HOH A . C 3 HOH 20 1220 59 HOH HOH A . C 3 HOH 21 1221 40 HOH HOH A . C 3 HOH 22 1222 45 HOH HOH A . C 3 HOH 23 1223 53 HOH HOH A . C 3 HOH 24 1224 16 HOH HOH A . C 3 HOH 25 1225 70 HOH HOH A . C 3 HOH 26 1226 50 HOH HOH A . C 3 HOH 27 1227 19 HOH HOH A . C 3 HOH 28 1228 69 HOH HOH A . C 3 HOH 29 1229 12 HOH HOH A . C 3 HOH 30 1230 63 HOH HOH A . C 3 HOH 31 1231 62 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3160 ? 1 MORE 0 ? 1 'SSA (A^2)' 29670 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 147.7150000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.6.0117 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7OXB _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 837 ? ? -159.54 38.29 2 1 ASP A 855 ? ? 66.07 88.81 3 1 LEU A 862 ? ? 50.38 80.91 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A MET 695 ? SD ? A MET 1 SD 2 1 Y 0 A MET 695 ? CE ? A MET 1 CE 3 1 Y 0 A GLU 697 ? CD ? A GLU 3 CD 4 1 Y 0 A GLU 697 ? OE1 ? A GLU 3 OE1 5 1 Y 0 A GLU 697 ? OE2 ? A GLU 3 OE2 6 1 Y 0 A LYS 708 ? NZ ? A LYS 14 NZ 7 1 Y 0 A GLU 709 ? CD ? A GLU 15 CD 8 1 Y 0 A GLU 709 ? OE1 ? A GLU 15 OE1 9 1 Y 0 A GLU 709 ? OE2 ? A GLU 15 OE2 10 1 Y 0 A LYS 713 ? CE ? A LYS 19 CE 11 1 Y 0 A LYS 713 ? NZ ? A LYS 19 NZ 12 1 Y 0 A LYS 714 ? NZ ? A LYS 20 NZ 13 1 Y 0 A LYS 716 ? CE ? A LYS 22 CE 14 1 Y 0 A LYS 716 ? NZ ? A LYS 22 NZ 15 1 Y 0 A GLU 734 ? CD ? A GLU 40 CD 16 1 Y 0 A GLU 734 ? OE1 ? A GLU 40 OE1 17 1 Y 0 A GLU 734 ? OE2 ? A GLU 40 OE2 18 1 Y 0 A LYS 737 ? CD ? A LYS 43 CD 19 1 Y 0 A LYS 737 ? CE ? A LYS 43 CE 20 1 Y 0 A LYS 737 ? NZ ? A LYS 43 NZ 21 1 Y 0 A ARG 748 ? CG ? A ARG 54 CG 22 1 Y 0 A ARG 748 ? CD ? A ARG 54 CD 23 1 Y 0 A ARG 748 ? NE ? A ARG 54 NE 24 1 Y 0 A ARG 748 ? CZ ? A ARG 54 CZ 25 1 Y 0 A ARG 748 ? NH1 ? A ARG 54 NH1 26 1 Y 0 A ARG 748 ? NH2 ? A ARG 54 NH2 27 1 Y 0 A LYS 754 ? CG ? A LYS 60 CG 28 1 Y 0 A LYS 754 ? CD ? A LYS 60 CD 29 1 Y 0 A LYS 754 ? CE ? A LYS 60 CE 30 1 Y 0 A LYS 754 ? NZ ? A LYS 60 NZ 31 1 Y 0 A LYS 757 ? CE ? A LYS 63 CE 32 1 Y 0 A LYS 757 ? NZ ? A LYS 63 NZ 33 1 Y 0 A ILE 759 ? CD1 ? A ILE 65 CD1 34 1 Y 0 A ARG 776 ? CD ? A ARG 82 CD 35 1 Y 0 A ARG 776 ? NE ? A ARG 82 NE 36 1 Y 0 A ARG 776 ? CZ ? A ARG 82 CZ 37 1 Y 0 A ARG 776 ? NH1 ? A ARG 82 NH1 38 1 Y 0 A ARG 776 ? NH2 ? A ARG 82 NH2 39 1 Y 0 A SER 784 ? OG ? A SER 90 OG 40 1 Y 0 A GLU 804 ? CD ? A GLU 110 CD 41 1 Y 0 A GLU 804 ? OE1 ? A GLU 110 OE1 42 1 Y 0 A GLU 804 ? OE2 ? A GLU 110 OE2 43 1 Y 0 A LYS 806 ? CE ? A LYS 112 CE 44 1 Y 0 A LYS 806 ? NZ ? A LYS 112 NZ 45 1 Y 0 A ARG 832 ? CZ ? A ARG 138 CZ 46 1 Y 0 A ARG 832 ? NH1 ? A ARG 138 NH1 47 1 Y 0 A ARG 832 ? NH2 ? A ARG 138 NH2 48 1 Y 0 A LYS 860 ? CE ? A LYS 166 CE 49 1 Y 0 A LYS 860 ? NZ ? A LYS 166 NZ 50 1 Y 0 A GLU 872 ? CD ? A GLU 178 CD 51 1 Y 0 A GLU 872 ? OE1 ? A GLU 178 OE1 52 1 Y 0 A GLU 872 ? OE2 ? A GLU 178 OE2 53 1 Y 0 A LYS 875 ? CD ? A LYS 181 CD 54 1 Y 0 A LYS 875 ? CE ? A LYS 181 CE 55 1 Y 0 A LYS 875 ? NZ ? A LYS 181 NZ 56 1 Y 0 A ILE 878 ? CD1 ? A ILE 184 CD1 57 1 Y 0 A ARG 889 ? CZ ? A ARG 195 CZ 58 1 Y 0 A ARG 889 ? NH1 ? A ARG 195 NH1 59 1 Y 0 A ARG 889 ? NH2 ? A ARG 195 NH2 60 1 Y 0 A LYS 913 ? NZ ? A LYS 219 NZ 61 1 Y 0 A ILE 918 ? CD1 ? A ILE 224 CD1 62 1 Y 0 A GLU 922 ? CD ? A GLU 228 CD 63 1 Y 0 A GLU 922 ? OE1 ? A GLU 228 OE1 64 1 Y 0 A GLU 922 ? OE2 ? A GLU 228 OE2 65 1 Y 0 A GLU 928 ? CD ? A GLU 234 CD 66 1 Y 0 A GLU 928 ? OE1 ? A GLU 234 OE1 67 1 Y 0 A GLU 928 ? OE2 ? A GLU 234 OE2 68 1 Y 0 A LYS 929 ? CE ? A LYS 235 CE 69 1 Y 0 A LYS 929 ? NZ ? A LYS 235 NZ 70 1 Y 0 A LYS 960 ? CE ? A LYS 266 CE 71 1 Y 0 A LYS 960 ? NZ ? A LYS 266 NZ 72 1 Y 0 A GLU 985 ? CD ? A GLU 291 CD 73 1 Y 0 A GLU 985 ? OE1 ? A GLU 291 OE1 74 1 Y 0 A GLU 985 ? OE2 ? A GLU 291 OE2 75 1 Y 0 A HIS 988 ? CG ? A HIS 294 CG 76 1 Y 0 A HIS 988 ? ND1 ? A HIS 294 ND1 77 1 Y 0 A HIS 988 ? CD2 ? A HIS 294 CD2 78 1 Y 0 A HIS 988 ? CE1 ? A HIS 294 CE1 79 1 Y 0 A HIS 988 ? NE2 ? A HIS 294 NE2 80 1 Y 0 A GLU 1004 ? CD ? A GLU 310 CD 81 1 Y 0 A GLU 1004 ? OE1 ? A GLU 310 OE1 82 1 Y 0 A GLU 1004 ? OE2 ? A GLU 310 OE2 83 1 Y 0 A ILE 1018 ? CD1 ? A ILE 324 CD1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 749 ? A GLU 55 2 1 Y 1 A ALA 750 ? A ALA 56 3 1 Y 1 A THR 751 ? A THR 57 4 1 Y 1 A ALA 864 ? A ALA 170 5 1 Y 1 A GLU 865 ? A GLU 171 6 1 Y 1 A GLU 866 ? A GLU 172 7 1 Y 1 A LYS 867 ? A LYS 173 8 1 Y 1 A GLU 868 ? A GLU 174 9 1 Y 1 A TYR 869 ? A TYR 175 10 1 Y 1 A SER 991 ? A SER 297 11 1 Y 1 A PRO 992 ? A PRO 298 12 1 Y 1 A THR 993 ? A THR 299 13 1 Y 1 A ASP 994 ? A ASP 300 14 1 Y 1 A SER 995 ? A SER 301 15 1 Y 1 A ASN 996 ? A ASN 302 16 1 Y 1 A PHE 997 ? A PHE 303 17 1 Y 1 A TYR 998 ? A TYR 304 18 1 Y 1 A ARG 999 ? A ARG 305 19 1 Y 1 A ALA 1000 ? A ALA 306 20 1 Y 1 A LEU 1001 ? A LEU 307 21 1 Y 1 A GLN 1020 ? A GLN 326 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 35Z _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 35Z _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "2-[2-(3-methoxyphenyl)pyrimidin-4-yl]-1'-prop-2-enoyl-spiro[5,6-dihydro-1~{H}-pyrrolo[3,2-c]pyridine-7,4'-piperidine]-4-one" 35Z 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #