data_7OZ0 # _entry.id 7OZ0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.361 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7OZ0 pdb_00007oz0 10.2210/pdb7oz0/pdb WWPDB D_1292114832 ? ? BMRB 34642 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details ;Solution structure of the N-terminal domain of human telomeric Repeat-binding factor 2-interacting protein 1 (hRap1): implication for Rap1-TRF2 interaction in Human. ; _pdbx_database_related.db_id 34642 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7OZ0 _pdbx_database_status.recvd_initial_deposition_date 2021-06-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Miron, S.' 1 ? 'LeDU, M.H.' 2 ? 'Gaullier, G.' 3 ? 'Zinn-justin, S.' 4 ? 'Cuniasse, P.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Solution structure of the N-terminal domain of human telomeric Repeat-binding factor 2-interacting protein 1 (hRap1): implication for Rap1-TRF2 interaction in Human. ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Miron, S.' 1 ? primary 'LeDU, M.H.' 2 ? primary 'Gaullier, G.' 3 ? primary 'Zinn-justin, S.' 4 ? primary 'Cuniasse, P.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Telomeric repeat-binding factor 2-interacting protein 1' _entity.formula_weight 12138.556 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;TERF2-interacting telomeric protein 1,TRF2-interacting telomeric protein 1,Dopamine receptor-interacting protein 5,Repressor/activator protein 1 homolog,RAP1 homolog,hRap1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAEAMDLGKDPNGPTHSSTLFVRDDGSSMSFYVRPSPAKRRLSTLILHGGGTVCRVQEPGAVLLAQPGEALAEASGDFIS TQYILDCVERNERLELEAYRLGPASAADTGSEAK ; _entity_poly.pdbx_seq_one_letter_code_can ;MAEAMDLGKDPNGPTHSSTLFVRDDGSSMSFYVRPSPAKRRLSTLILHGGGTVCRVQEPGAVLLAQPGEALAEASGDFIS TQYILDCVERNERLELEAYRLGPASAADTGSEAK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLU n 1 4 ALA n 1 5 MET n 1 6 ASP n 1 7 LEU n 1 8 GLY n 1 9 LYS n 1 10 ASP n 1 11 PRO n 1 12 ASN n 1 13 GLY n 1 14 PRO n 1 15 THR n 1 16 HIS n 1 17 SER n 1 18 SER n 1 19 THR n 1 20 LEU n 1 21 PHE n 1 22 VAL n 1 23 ARG n 1 24 ASP n 1 25 ASP n 1 26 GLY n 1 27 SER n 1 28 SER n 1 29 MET n 1 30 SER n 1 31 PHE n 1 32 TYR n 1 33 VAL n 1 34 ARG n 1 35 PRO n 1 36 SER n 1 37 PRO n 1 38 ALA n 1 39 LYS n 1 40 ARG n 1 41 ARG n 1 42 LEU n 1 43 SER n 1 44 THR n 1 45 LEU n 1 46 ILE n 1 47 LEU n 1 48 HIS n 1 49 GLY n 1 50 GLY n 1 51 GLY n 1 52 THR n 1 53 VAL n 1 54 CYS n 1 55 ARG n 1 56 VAL n 1 57 GLN n 1 58 GLU n 1 59 PRO n 1 60 GLY n 1 61 ALA n 1 62 VAL n 1 63 LEU n 1 64 LEU n 1 65 ALA n 1 66 GLN n 1 67 PRO n 1 68 GLY n 1 69 GLU n 1 70 ALA n 1 71 LEU n 1 72 ALA n 1 73 GLU n 1 74 ALA n 1 75 SER n 1 76 GLY n 1 77 ASP n 1 78 PHE n 1 79 ILE n 1 80 SER n 1 81 THR n 1 82 GLN n 1 83 TYR n 1 84 ILE n 1 85 LEU n 1 86 ASP n 1 87 CYS n 1 88 VAL n 1 89 GLU n 1 90 ARG n 1 91 ASN n 1 92 GLU n 1 93 ARG n 1 94 LEU n 1 95 GLU n 1 96 LEU n 1 97 GLU n 1 98 ALA n 1 99 TYR n 1 100 ARG n 1 101 LEU n 1 102 GLY n 1 103 PRO n 1 104 ALA n 1 105 SER n 1 106 ALA n 1 107 ALA n 1 108 ASP n 1 109 THR n 1 110 GLY n 1 111 SER n 1 112 GLU n 1 113 ALA n 1 114 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 114 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TERF2IP, DRIP5, RAP1, PP8000' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TE2IP_HUMAN _struct_ref.pdbx_db_accession Q9NYB0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAEAMDLGKDPNGPTHSSTLFVRDDGSSMSFYVRPSPAKRRLSTLILHGGGTVCRVQEPGAVLLAQPGEALAEASGDFIS TQYILDCVERNERLELEAYRLGPASAADTGSEAK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7OZ0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 114 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NYB0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 114 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 114 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 3 1 1 '3D HNCACB' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HN(CA)CO' 1 isotropic 8 1 1 '3D HCCH-TOSCY' 1 isotropic 13 1 1 '3D 1H-15N NOESY' 1 isotropic 9 1 1 '3D 1H-15N TOCSY' 1 isotropic 10 1 1 '3D 15N NOESY-HSQC' 2 isotropic 11 1 1 '3D 13C (aromatic)NOESY-HSQC' 2 isotropic 12 1 1 '3D 13C(aliphatic)NOESY-HSQC' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '150 mM NaCl' _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label 15N_13C _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '100 uM [U-100% 13C; U-100% 15N] human Telomeric Repeat-binding factor 2-interacting protein 1 (hRAP1), 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 15N_13C_Sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '50 mM MES Buffer' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE II' ? Bruker 700 ? 2 'AVANCE III' ? Bruker 950 ? # _pdbx_nmr_refine.entry_id 7OZ0 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'Explicit Water' _pdbx_nmr_refine.software_ordinal 5 # _pdbx_nmr_ensemble.entry_id 7OZ0 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7OZ0 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing TopSpin 4.0.7 'Bruker Biospin' 2 'chemical shift assignment' 'CcpNmr Analysis' 2.4.2 CCPN 4 'peak picking' 'CcpNmr Analysis' 2.4.2 CCPN 3 'structure calculation' CYANA 3.98.5 'Guntert, Mumenthaler and Wuthrich' 5 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7OZ0 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7OZ0 _struct.title ;Solution structure of the N-terminal domain of human telomeric Repeat-binding factor 2-interacting protein 1 (hRap1): implication for Rap1-TRF2 interaction in Human. ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7OZ0 _struct_keywords.text 'Telomere Integrity, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 38 ? GLY A 49 ? ALA A 38 GLY A 49 1 ? 12 HELX_P HELX_P2 AA2 GLN A 82 ? ARG A 90 ? GLN A 82 ARG A 90 1 ? 9 HELX_P HELX_P3 AA3 GLU A 95 ? ARG A 100 ? GLU A 95 ARG A 100 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 52 ? CYS A 54 ? THR A 52 CYS A 54 AA1 2 SER A 30 ? VAL A 33 ? SER A 30 VAL A 33 AA1 3 VAL A 62 ? ALA A 65 ? VAL A 62 ALA A 65 AA1 4 ILE A 79 ? SER A 80 ? ILE A 79 SER A 80 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 52 ? O THR A 52 N PHE A 31 ? N PHE A 31 AA1 2 3 N TYR A 32 ? N TYR A 32 O VAL A 62 ? O VAL A 62 AA1 3 4 N LEU A 63 ? N LEU A 63 O ILE A 79 ? O ILE A 79 # _atom_sites.entry_id 7OZ0 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 CYS 87 87 87 CYS CYS A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 LYS 114 114 114 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8520 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2022-10-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'human Telomeric Repeat-binding factor 2-interacting protein 1 (hRAP1)' _pdbx_nmr_exptl_sample.concentration 100 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units uM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 35 ? ? -49.50 108.43 2 1 PRO A 67 ? ? -61.76 -82.64 3 1 LEU A 71 ? ? -102.71 -90.74 4 1 ALA A 72 ? ? 172.63 156.15 5 1 GLU A 95 ? ? -54.85 101.47 6 1 LEU A 101 ? ? -94.09 -74.60 7 2 PRO A 35 ? ? -56.07 105.63 8 2 GLU A 95 ? ? -56.79 102.79 9 2 SER A 105 ? ? -94.86 39.34 10 3 PRO A 11 ? ? -43.43 98.73 11 3 PRO A 35 ? ? -34.29 104.80 12 3 GLU A 69 ? ? 67.50 -51.01 13 3 ALA A 104 ? ? -63.59 98.42 14 3 ALA A 113 ? ? -124.69 -58.60 15 4 MET A 5 ? ? 71.96 -41.03 16 4 LYS A 9 ? ? -145.72 35.69 17 4 PRO A 35 ? ? -57.72 96.68 18 4 GLN A 57 ? ? -69.79 97.88 19 4 SER A 75 ? ? -89.96 -79.79 20 5 PRO A 35 ? ? -55.81 100.85 21 5 LEU A 71 ? ? -85.82 -99.43 22 5 SER A 75 ? ? -62.64 -70.35 23 6 PRO A 35 ? ? -37.56 106.51 24 6 SER A 36 ? ? -171.69 135.10 25 6 ALA A 104 ? ? -137.77 -63.67 26 7 PRO A 11 ? ? -69.87 91.07 27 7 GLU A 69 ? ? -150.47 -98.68 28 7 ALA A 70 ? ? -130.74 -37.10 29 8 GLU A 69 ? ? -163.33 -164.97 30 8 GLU A 95 ? ? -56.59 109.18 31 9 ASP A 6 ? ? -57.54 109.28 32 9 PRO A 14 ? ? -76.33 -168.01 33 9 PRO A 35 ? ? -40.96 108.37 34 9 GLN A 57 ? ? -69.73 94.86 35 9 ALA A 70 ? ? -102.52 -167.41 36 9 LEU A 71 ? ? -73.98 -159.98 37 9 ALA A 72 ? ? -65.96 90.37 38 9 ALA A 104 ? ? -98.05 -61.00 39 9 THR A 109 ? ? -133.79 -45.86 40 10 PRO A 11 ? ? -55.80 93.64 41 10 PRO A 35 ? ? -50.52 99.58 42 10 PRO A 67 ? ? -72.62 -161.57 43 10 LEU A 71 ? ? 68.81 -9.06 44 10 ALA A 104 ? ? -61.26 91.42 45 11 PRO A 35 ? ? -48.13 104.52 46 11 PRO A 67 ? ? -80.08 -108.72 47 11 ALA A 72 ? ? -61.46 99.73 48 11 ALA A 104 ? ? -165.26 -160.62 49 11 GLU A 112 ? ? 60.73 93.56 50 12 PRO A 35 ? ? -49.90 105.50 51 12 PRO A 67 ? ? -79.64 -164.03 52 12 ALA A 72 ? ? -82.22 43.87 53 12 SER A 105 ? ? -156.94 88.67 54 13 LYS A 9 ? ? 61.50 87.59 55 13 PRO A 11 ? ? -65.06 97.06 56 13 GLN A 57 ? ? -67.88 97.69 57 13 SER A 105 ? ? -160.25 96.98 58 13 THR A 109 ? ? 60.11 -46.05 59 14 LYS A 9 ? ? -90.28 45.04 60 14 PRO A 11 ? ? -65.23 97.07 61 14 PRO A 14 ? ? -69.48 -178.55 62 14 PRO A 35 ? ? -64.10 33.73 63 14 GLU A 69 ? ? -156.00 10.38 64 14 ALA A 72 ? ? 66.31 -5.83 65 15 LEU A 7 ? ? -91.99 -66.88 66 15 PRO A 35 ? ? -59.45 58.62 67 15 PRO A 67 ? ? -82.24 -156.71 68 15 GLU A 95 ? ? -55.07 101.30 69 15 GLU A 112 ? ? -99.76 -63.33 70 16 ALA A 4 ? ? 48.24 74.66 71 16 PRO A 11 ? ? -62.33 90.73 72 16 PRO A 14 ? ? -76.05 -163.16 73 16 PRO A 35 ? ? -56.11 98.24 74 16 GLN A 57 ? ? -68.58 94.54 75 16 PRO A 67 ? ? -77.70 -153.35 76 17 PRO A 67 ? ? -69.80 -158.21 77 17 ALA A 70 ? ? -143.77 24.92 78 17 LEU A 71 ? ? -117.01 -157.59 79 17 ALA A 72 ? ? -78.34 48.06 80 17 THR A 109 ? ? 62.39 80.24 81 18 PRO A 11 ? ? -53.85 104.20 82 18 PRO A 35 ? ? -58.18 100.73 83 18 GLN A 57 ? ? -69.92 96.16 84 18 PRO A 67 ? ? -81.99 -85.22 85 19 PRO A 11 ? ? -52.70 106.74 86 19 PRO A 14 ? ? -73.95 -169.58 87 19 ALA A 70 ? ? -109.71 -74.44 88 19 GLU A 95 ? ? -49.94 109.80 89 19 ALA A 107 ? ? 57.06 80.40 90 20 LYS A 9 ? ? -89.11 37.94 91 20 PRO A 35 ? ? -55.97 103.01 92 20 ALA A 106 ? ? -172.91 117.92 93 20 ALA A 113 ? ? 66.88 86.73 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Agence Nationale de la Recherche (ANR)' France 'Teloloop : ANR-1582-30020690' 1 'French Infrastructure for Integrated Structural Biology (FRISBI)' France ? 2 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #