data_7P27 # _entry.id 7P27 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7P27 pdb_00007p27 10.2210/pdb7p27/pdb WWPDB D_1292116814 ? ? BMRB 27158 ? 10.13018/BMR27158 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-07-13 2 'Structure model' 1 1 2023-02-01 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_database_status 4 3 'Structure model' struct_ref 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 14 3 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 15 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7P27 _pdbx_database_status.recvd_initial_deposition_date 2021-07-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category CASD-NMR _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 27158 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lykouras, M.V.' 1 0000-0001-7864-0911 'Tsika, A.C.' 2 0000-0002-3723-0606 'Papageorgiou, N.' 3 ? 'Canard, B.' 4 0000-0003-4924-1991 'Coutard, B.' 5 0000-0002-2859-7123 'Bentrop, D.' 6 ? 'Spyroulias, G.A.' 7 0000-0003-1799-3312 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 434 _citation.language ? _citation.page_first 167720 _citation.page_last 167720 _citation.title 'Binding Adaptation of GS-441524 Diversifies Macro Domains and Downregulates SARS-CoV-2 de-MARylation Capacity.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2022.167720 _citation.pdbx_database_id_PubMed 35839840 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tsika, A.C.' 1 ? primary 'Gallo, A.' 2 ? primary 'Fourkiotis, N.K.' 3 ? primary 'Argyriou, A.I.' 4 ? primary 'Sreeramulu, S.' 5 ? primary 'Lohr, F.' 6 ? primary 'Rogov, V.V.' 7 ? primary 'Richter, C.' 8 ? primary 'Linhard, V.' 9 ? primary 'Gande, S.L.' 10 ? primary 'Altincekic, N.' 11 ? primary 'Krishnathas, R.' 12 ? primary 'Elamri, I.' 13 ? primary 'Schwalbe, H.' 14 ? primary 'Wollenhaupt, J.' 15 ? primary 'Weiss, M.S.' 16 ? primary 'Spyroulias, G.A.' 17 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Polyprotein P1234' _entity.formula_weight 18635.123 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'First 8 residues are not shown and correspond to sequence MKHHHHHH' # _entity_name_com.entity_id 1 _entity_name_com.name 'P1234,Non-structural polyprotein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKHHHHHHAPSYRVKRMDIAKNDEECVVNAANPRGLPGDGVCKAVYKKWPESFKNSATPVGTAKTVMCGTYPVIHAVGPN FSNYSESEGDRELAAAYREVAKEVTRLGVNSVAIPLLSTGVYSGGKDRLTQSLNHLFTAMDSTDADVVIYCRDKEWEKKI SEAIQMRT ; _entity_poly.pdbx_seq_one_letter_code_can ;MKHHHHHHAPSYRVKRMDIAKNDEECVVNAANPRGLPGDGVCKAVYKKWPESFKNSATPVGTAKTVMCGTYPVIHAVGPN FSNYSESEGDRELAAAYREVAKEVTRLGVNSVAIPLLSTGVYSGGKDRLTQSLNHLFTAMDSTDADVVIYCRDKEWEKKI SEAIQMRT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 ALA n 1 10 PRO n 1 11 SER n 1 12 TYR n 1 13 ARG n 1 14 VAL n 1 15 LYS n 1 16 ARG n 1 17 MET n 1 18 ASP n 1 19 ILE n 1 20 ALA n 1 21 LYS n 1 22 ASN n 1 23 ASP n 1 24 GLU n 1 25 GLU n 1 26 CYS n 1 27 VAL n 1 28 VAL n 1 29 ASN n 1 30 ALA n 1 31 ALA n 1 32 ASN n 1 33 PRO n 1 34 ARG n 1 35 GLY n 1 36 LEU n 1 37 PRO n 1 38 GLY n 1 39 ASP n 1 40 GLY n 1 41 VAL n 1 42 CYS n 1 43 LYS n 1 44 ALA n 1 45 VAL n 1 46 TYR n 1 47 LYS n 1 48 LYS n 1 49 TRP n 1 50 PRO n 1 51 GLU n 1 52 SER n 1 53 PHE n 1 54 LYS n 1 55 ASN n 1 56 SER n 1 57 ALA n 1 58 THR n 1 59 PRO n 1 60 VAL n 1 61 GLY n 1 62 THR n 1 63 ALA n 1 64 LYS n 1 65 THR n 1 66 VAL n 1 67 MET n 1 68 CYS n 1 69 GLY n 1 70 THR n 1 71 TYR n 1 72 PRO n 1 73 VAL n 1 74 ILE n 1 75 HIS n 1 76 ALA n 1 77 VAL n 1 78 GLY n 1 79 PRO n 1 80 ASN n 1 81 PHE n 1 82 SER n 1 83 ASN n 1 84 TYR n 1 85 SER n 1 86 GLU n 1 87 SER n 1 88 GLU n 1 89 GLY n 1 90 ASP n 1 91 ARG n 1 92 GLU n 1 93 LEU n 1 94 ALA n 1 95 ALA n 1 96 ALA n 1 97 TYR n 1 98 ARG n 1 99 GLU n 1 100 VAL n 1 101 ALA n 1 102 LYS n 1 103 GLU n 1 104 VAL n 1 105 THR n 1 106 ARG n 1 107 LEU n 1 108 GLY n 1 109 VAL n 1 110 ASN n 1 111 SER n 1 112 VAL n 1 113 ALA n 1 114 ILE n 1 115 PRO n 1 116 LEU n 1 117 LEU n 1 118 SER n 1 119 THR n 1 120 GLY n 1 121 VAL n 1 122 TYR n 1 123 SER n 1 124 GLY n 1 125 GLY n 1 126 LYS n 1 127 ASP n 1 128 ARG n 1 129 LEU n 1 130 THR n 1 131 GLN n 1 132 SER n 1 133 LEU n 1 134 ASN n 1 135 HIS n 1 136 LEU n 1 137 PHE n 1 138 THR n 1 139 ALA n 1 140 MET n 1 141 ASP n 1 142 SER n 1 143 THR n 1 144 ASP n 1 145 ALA n 1 146 ASP n 1 147 VAL n 1 148 VAL n 1 149 ILE n 1 150 TYR n 1 151 CYS n 1 152 ARG n 1 153 ASP n 1 154 LYS n 1 155 GLU n 1 156 TRP n 1 157 GLU n 1 158 LYS n 1 159 LYS n 1 160 ILE n 1 161 SER n 1 162 GLU n 1 163 ALA n 1 164 ILE n 1 165 GLN n 1 166 MET n 1 167 ARG n 1 168 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 168 _entity_src_gen.gene_src_common_name CHIKV _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'S27-African prototype' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Chikungunya virus (strain S27-African prototype)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 371094 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Rosetta 2' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -7 ? ? ? A . n A 1 2 LYS 2 -6 ? ? ? A . n A 1 3 HIS 3 -5 ? ? ? A . n A 1 4 HIS 4 -4 ? ? ? A . n A 1 5 HIS 5 -3 ? ? ? A . n A 1 6 HIS 6 -2 ? ? ? A . n A 1 7 HIS 7 -1 ? ? ? A . n A 1 8 HIS 8 0 ? ? ? A . n A 1 9 ALA 9 1 1 ALA ALA A . n A 1 10 PRO 10 2 2 PRO PRO A . n A 1 11 SER 11 3 3 SER SER A . n A 1 12 TYR 12 4 4 TYR TYR A . n A 1 13 ARG 13 5 5 ARG ARG A . n A 1 14 VAL 14 6 6 VAL VAL A . n A 1 15 LYS 15 7 7 LYS LYS A . n A 1 16 ARG 16 8 8 ARG ARG A . n A 1 17 MET 17 9 9 MET MET A . n A 1 18 ASP 18 10 10 ASP ASP A . n A 1 19 ILE 19 11 11 ILE ILE A . n A 1 20 ALA 20 12 12 ALA ALA A . n A 1 21 LYS 21 13 13 LYS LYS A . n A 1 22 ASN 22 14 14 ASN ASN A . n A 1 23 ASP 23 15 15 ASP ASP A . n A 1 24 GLU 24 16 16 GLU GLU A . n A 1 25 GLU 25 17 17 GLU GLU A . n A 1 26 CYS 26 18 18 CYS CYS A . n A 1 27 VAL 27 19 19 VAL VAL A . n A 1 28 VAL 28 20 20 VAL VAL A . n A 1 29 ASN 29 21 21 ASN ASN A . n A 1 30 ALA 30 22 22 ALA ALA A . n A 1 31 ALA 31 23 23 ALA ALA A . n A 1 32 ASN 32 24 24 ASN ASN A . n A 1 33 PRO 33 25 25 PRO PRO A . n A 1 34 ARG 34 26 26 ARG ARG A . n A 1 35 GLY 35 27 27 GLY GLY A . n A 1 36 LEU 36 28 28 LEU LEU A . n A 1 37 PRO 37 29 29 PRO PRO A . n A 1 38 GLY 38 30 30 GLY GLY A . n A 1 39 ASP 39 31 31 ASP ASP A . n A 1 40 GLY 40 32 32 GLY GLY A . n A 1 41 VAL 41 33 33 VAL VAL A . n A 1 42 CYS 42 34 34 CYS CYS A . n A 1 43 LYS 43 35 35 LYS LYS A . n A 1 44 ALA 44 36 36 ALA ALA A . n A 1 45 VAL 45 37 37 VAL VAL A . n A 1 46 TYR 46 38 38 TYR TYR A . n A 1 47 LYS 47 39 39 LYS LYS A . n A 1 48 LYS 48 40 40 LYS LYS A . n A 1 49 TRP 49 41 41 TRP TRP A . n A 1 50 PRO 50 42 42 PRO PRO A . n A 1 51 GLU 51 43 43 GLU GLU A . n A 1 52 SER 52 44 44 SER SER A . n A 1 53 PHE 53 45 45 PHE PHE A . n A 1 54 LYS 54 46 46 LYS LYS A . n A 1 55 ASN 55 47 47 ASN ASN A . n A 1 56 SER 56 48 48 SER SER A . n A 1 57 ALA 57 49 49 ALA ALA A . n A 1 58 THR 58 50 50 THR THR A . n A 1 59 PRO 59 51 51 PRO PRO A . n A 1 60 VAL 60 52 52 VAL VAL A . n A 1 61 GLY 61 53 53 GLY GLY A . n A 1 62 THR 62 54 54 THR THR A . n A 1 63 ALA 63 55 55 ALA ALA A . n A 1 64 LYS 64 56 56 LYS LYS A . n A 1 65 THR 65 57 57 THR THR A . n A 1 66 VAL 66 58 58 VAL VAL A . n A 1 67 MET 67 59 59 MET MET A . n A 1 68 CYS 68 60 60 CYS CYS A . n A 1 69 GLY 69 61 61 GLY GLY A . n A 1 70 THR 70 62 62 THR THR A . n A 1 71 TYR 71 63 63 TYR TYR A . n A 1 72 PRO 72 64 64 PRO PRO A . n A 1 73 VAL 73 65 65 VAL VAL A . n A 1 74 ILE 74 66 66 ILE ILE A . n A 1 75 HIS 75 67 67 HIS HIS A . n A 1 76 ALA 76 68 68 ALA ALA A . n A 1 77 VAL 77 69 69 VAL VAL A . n A 1 78 GLY 78 70 70 GLY GLY A . n A 1 79 PRO 79 71 71 PRO PRO A . n A 1 80 ASN 80 72 72 ASN ASN A . n A 1 81 PHE 81 73 73 PHE PHE A . n A 1 82 SER 82 74 74 SER SER A . n A 1 83 ASN 83 75 75 ASN ASN A . n A 1 84 TYR 84 76 76 TYR TYR A . n A 1 85 SER 85 77 77 SER SER A . n A 1 86 GLU 86 78 78 GLU GLU A . n A 1 87 SER 87 79 79 SER SER A . n A 1 88 GLU 88 80 80 GLU GLU A . n A 1 89 GLY 89 81 81 GLY GLY A . n A 1 90 ASP 90 82 82 ASP ASP A . n A 1 91 ARG 91 83 83 ARG ARG A . n A 1 92 GLU 92 84 84 GLU GLU A . n A 1 93 LEU 93 85 85 LEU LEU A . n A 1 94 ALA 94 86 86 ALA ALA A . n A 1 95 ALA 95 87 87 ALA ALA A . n A 1 96 ALA 96 88 88 ALA ALA A . n A 1 97 TYR 97 89 89 TYR TYR A . n A 1 98 ARG 98 90 90 ARG ARG A . n A 1 99 GLU 99 91 91 GLU GLU A . n A 1 100 VAL 100 92 92 VAL VAL A . n A 1 101 ALA 101 93 93 ALA ALA A . n A 1 102 LYS 102 94 94 LYS LYS A . n A 1 103 GLU 103 95 95 GLU GLU A . n A 1 104 VAL 104 96 96 VAL VAL A . n A 1 105 THR 105 97 97 THR THR A . n A 1 106 ARG 106 98 98 ARG ARG A . n A 1 107 LEU 107 99 99 LEU LEU A . n A 1 108 GLY 108 100 100 GLY GLY A . n A 1 109 VAL 109 101 101 VAL VAL A . n A 1 110 ASN 110 102 102 ASN ASN A . n A 1 111 SER 111 103 103 SER SER A . n A 1 112 VAL 112 104 104 VAL VAL A . n A 1 113 ALA 113 105 105 ALA ALA A . n A 1 114 ILE 114 106 106 ILE ILE A . n A 1 115 PRO 115 107 107 PRO PRO A . n A 1 116 LEU 116 108 108 LEU LEU A . n A 1 117 LEU 117 109 109 LEU LEU A . n A 1 118 SER 118 110 110 SER SER A . n A 1 119 THR 119 111 111 THR THR A . n A 1 120 GLY 120 112 112 GLY GLY A . n A 1 121 VAL 121 113 113 VAL VAL A . n A 1 122 TYR 122 114 114 TYR TYR A . n A 1 123 SER 123 115 115 SER SER A . n A 1 124 GLY 124 116 116 GLY GLY A . n A 1 125 GLY 125 117 117 GLY GLY A . n A 1 126 LYS 126 118 118 LYS LYS A . n A 1 127 ASP 127 119 119 ASP ASP A . n A 1 128 ARG 128 120 120 ARG ARG A . n A 1 129 LEU 129 121 121 LEU LEU A . n A 1 130 THR 130 122 122 THR THR A . n A 1 131 GLN 131 123 123 GLN GLN A . n A 1 132 SER 132 124 124 SER SER A . n A 1 133 LEU 133 125 125 LEU LEU A . n A 1 134 ASN 134 126 126 ASN ASN A . n A 1 135 HIS 135 127 127 HIS HIS A . n A 1 136 LEU 136 128 128 LEU LEU A . n A 1 137 PHE 137 129 129 PHE PHE A . n A 1 138 THR 138 130 130 THR THR A . n A 1 139 ALA 139 131 131 ALA ALA A . n A 1 140 MET 140 132 132 MET MET A . n A 1 141 ASP 141 133 133 ASP ASP A . n A 1 142 SER 142 134 134 SER SER A . n A 1 143 THR 143 135 135 THR THR A . n A 1 144 ASP 144 136 136 ASP ASP A . n A 1 145 ALA 145 137 137 ALA ALA A . n A 1 146 ASP 146 138 138 ASP ASP A . n A 1 147 VAL 147 139 139 VAL VAL A . n A 1 148 VAL 148 140 140 VAL VAL A . n A 1 149 ILE 149 141 141 ILE ILE A . n A 1 150 TYR 150 142 142 TYR TYR A . n A 1 151 CYS 151 143 143 CYS CYS A . n A 1 152 ARG 152 144 144 ARG ARG A . n A 1 153 ASP 153 145 145 ASP ASP A . n A 1 154 LYS 154 146 146 LYS LYS A . n A 1 155 GLU 155 147 147 GLU GLU A . n A 1 156 TRP 156 148 148 TRP TRP A . n A 1 157 GLU 157 149 149 GLU GLU A . n A 1 158 LYS 158 150 150 LYS LYS A . n A 1 159 LYS 159 151 151 LYS LYS A . n A 1 160 ILE 160 152 152 ILE ILE A . n A 1 161 SER 161 153 153 SER SER A . n A 1 162 GLU 162 154 154 GLU GLU A . n A 1 163 ALA 163 155 155 ALA ALA A . n A 1 164 ILE 164 156 156 ILE ILE A . n A 1 165 GLN 165 157 157 GLN GLN A . n A 1 166 MET 166 158 158 MET MET A . n A 1 167 ARG 167 159 159 ARG ARG A . n A 1 168 THR 168 160 160 THR THR A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7P27 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7P27 _struct.title 'NMR solution structure of Chikungunya virus macro domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7P27 _struct_keywords.text 'CHIKV, macro domain, viral replication, ADP-ribose, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POLN_CHIKS _struct_ref.pdbx_db_accession Q8JUX6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;APSYRVKRMDIAKNDEECVVNAANPRGLPGDGVCKAVYKKWPESFKNSATPVGTAKTVMCGTYPVIHAVGPNFSNYSESE GDRELAAAYREVAKEVTRLGVNSVAIPLLSTGVYSGGKDRLTQSLNHLFTAMDSTDADVVIYCRDKEWEKKISEAIQMRT ; _struct_ref.pdbx_align_begin 1334 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7P27 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 168 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8JUX6 _struct_ref_seq.db_align_beg 1334 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1493 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 160 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7P27 MET A 1 ? UNP Q8JUX6 ? ? 'initiating methionine' -7 1 1 7P27 LYS A 2 ? UNP Q8JUX6 ? ? 'expression tag' -6 2 1 7P27 HIS A 3 ? UNP Q8JUX6 ? ? 'expression tag' -5 3 1 7P27 HIS A 4 ? UNP Q8JUX6 ? ? 'expression tag' -4 4 1 7P27 HIS A 5 ? UNP Q8JUX6 ? ? 'expression tag' -3 5 1 7P27 HIS A 6 ? UNP Q8JUX6 ? ? 'expression tag' -2 6 1 7P27 HIS A 7 ? UNP Q8JUX6 ? ? 'expression tag' -1 7 1 7P27 HIS A 8 ? UNP Q8JUX6 ? ? 'expression tag' 0 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 9080 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'NMR relaxation study' ? 2 1 'gel filtration' ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 18 ? ASN A 22 ? ASP A 10 ASN A 14 5 ? 5 HELX_P HELX_P2 AA2 GLY A 40 ? TRP A 49 ? GLY A 32 TRP A 41 1 ? 10 HELX_P HELX_P3 AA3 TRP A 49 ? LYS A 54 ? TRP A 41 LYS A 46 1 ? 6 HELX_P HELX_P4 AA4 ASN A 80 ? TYR A 84 ? ASN A 72 TYR A 76 5 ? 5 HELX_P HELX_P5 AA5 SER A 85 ? GLY A 108 ? SER A 77 GLY A 100 1 ? 24 HELX_P HELX_P6 AA6 ARG A 128 ? SER A 142 ? ARG A 120 SER A 134 1 ? 15 HELX_P HELX_P7 AA7 ASP A 153 ? ARG A 167 ? ASP A 145 ARG A 159 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 12 ? LYS A 15 ? TYR A 4 LYS A 7 AA1 2 ASP A 146 ? TYR A 150 ? ASP A 138 TYR A 142 AA1 3 SER A 111 ? PRO A 115 ? SER A 103 PRO A 107 AA2 1 VAL A 27 ? ALA A 30 ? VAL A 19 ALA A 22 AA2 2 PRO A 72 ? ALA A 76 ? PRO A 64 ALA A 68 AA2 3 ALA A 63 ? MET A 67 ? ALA A 55 MET A 59 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 13 ? N ARG A 5 O ILE A 149 ? O ILE A 141 AA1 2 3 O VAL A 148 ? O VAL A 140 N VAL A 112 ? N VAL A 104 AA2 1 2 N ASN A 29 ? N ASN A 21 O ILE A 74 ? O ILE A 66 AA2 2 3 O VAL A 73 ? O VAL A 65 N VAL A 66 ? N VAL A 58 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 20 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 TYR _pdbx_validate_rmsd_angle.auth_seq_id_1 142 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 TYR _pdbx_validate_rmsd_angle.auth_seq_id_2 142 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CD1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 TYR _pdbx_validate_rmsd_angle.auth_seq_id_3 142 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.20 _pdbx_validate_rmsd_angle.angle_target_value 121.00 _pdbx_validate_rmsd_angle.angle_deviation -3.80 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.60 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 12 ? ? -66.86 1.61 2 1 ASN A 14 ? ? 82.90 82.95 3 1 CYS A 18 ? ? -172.97 149.29 4 1 CYS A 60 ? ? -91.70 55.81 5 1 TYR A 63 ? ? 62.06 142.80 6 1 PHE A 73 ? ? -70.07 27.01 7 1 LEU A 109 ? ? -124.59 -165.03 8 1 THR A 111 ? ? -95.49 52.76 9 1 SER A 115 ? ? -84.78 -146.39 10 1 ARG A 144 ? ? -119.64 -74.21 11 2 ASN A 14 ? ? 75.69 70.62 12 2 CYS A 18 ? ? -171.08 142.87 13 2 TYR A 63 ? ? 83.76 128.02 14 2 PHE A 73 ? ? -70.51 27.71 15 2 LEU A 109 ? ? -125.52 -169.13 16 2 THR A 111 ? ? -108.25 56.00 17 2 SER A 115 ? ? -80.83 -156.93 18 3 ASN A 14 ? ? 81.17 76.68 19 3 CYS A 18 ? ? -172.51 146.53 20 3 TYR A 63 ? ? 79.85 128.56 21 3 PHE A 73 ? ? -71.49 31.07 22 3 ARG A 144 ? ? -102.50 -73.95 23 4 ASN A 14 ? ? 76.33 73.94 24 4 CYS A 18 ? ? -172.32 147.59 25 4 SER A 48 ? ? -92.07 31.27 26 4 CYS A 60 ? ? -95.62 58.88 27 4 TYR A 63 ? ? 59.09 129.98 28 4 PHE A 73 ? ? -76.40 26.51 29 4 LEU A 109 ? ? -117.56 -157.68 30 4 SER A 115 ? ? -79.28 -144.34 31 4 ARG A 144 ? ? -95.84 -83.46 32 5 ASN A 14 ? ? 62.00 75.31 33 5 ASP A 31 ? ? -129.15 -164.31 34 5 TYR A 63 ? ? 67.18 130.58 35 5 PHE A 73 ? ? -74.77 37.85 36 5 SER A 115 ? ? -82.94 -103.42 37 5 ASP A 138 ? ? -69.08 89.41 38 6 ASN A 14 ? ? 82.34 83.27 39 6 ASP A 31 ? ? -161.61 -169.18 40 6 TYR A 63 ? ? 71.04 126.64 41 6 PHE A 73 ? ? -67.15 27.05 42 6 SER A 110 ? ? 88.32 34.50 43 6 THR A 111 ? ? -104.24 58.85 44 6 ASP A 138 ? ? -69.43 99.97 45 6 ARG A 144 ? ? -93.81 -64.88 46 7 ASN A 14 ? ? 80.63 78.98 47 7 CYS A 18 ? ? -172.34 147.27 48 7 CYS A 60 ? ? -91.31 54.04 49 7 TYR A 63 ? ? 56.18 133.07 50 7 PHE A 73 ? ? -77.59 35.17 51 7 LEU A 109 ? ? -106.34 62.33 52 7 SER A 115 ? ? -88.13 -72.76 53 7 ASP A 138 ? ? -68.11 96.87 54 8 ASN A 14 ? ? 65.90 92.54 55 8 CYS A 18 ? ? -172.25 144.35 56 8 TYR A 63 ? ? 77.95 126.64 57 8 PHE A 73 ? ? -69.66 27.62 58 8 LEU A 109 ? ? -127.53 -152.54 59 8 THR A 111 ? ? -99.70 38.95 60 8 SER A 115 ? ? -76.62 -157.38 61 8 ASP A 138 ? ? -69.78 95.93 62 9 ASN A 14 ? ? 74.42 90.55 63 9 SER A 48 ? ? -88.28 33.78 64 9 CYS A 60 ? ? -91.19 56.54 65 9 TYR A 63 ? ? 77.85 127.88 66 9 PHE A 73 ? ? -70.73 32.99 67 9 LEU A 109 ? ? -124.92 -159.65 68 9 SER A 115 ? ? -96.85 -152.39 69 9 ASP A 138 ? ? -69.28 96.69 70 9 ARG A 144 ? ? -113.42 -71.37 71 10 SER A 3 ? ? -102.85 -156.76 72 10 ASN A 14 ? ? 81.09 86.31 73 10 CYS A 18 ? ? -171.73 145.88 74 10 ASP A 31 ? ? -130.86 -156.78 75 10 CYS A 60 ? ? -94.81 58.09 76 10 TYR A 63 ? ? 58.38 130.27 77 10 ASN A 72 ? ? -67.58 4.30 78 10 PHE A 73 ? ? -71.20 31.27 79 10 ASP A 138 ? ? -68.53 94.69 80 11 ASN A 14 ? ? 81.23 73.93 81 11 CYS A 18 ? ? -170.06 136.79 82 11 TYR A 63 ? ? 69.97 128.69 83 11 PHE A 73 ? ? -70.61 31.59 84 11 SER A 115 ? ? -68.68 -153.08 85 11 ARG A 144 ? ? -103.07 -66.26 86 12 ASN A 14 ? ? 70.09 86.60 87 12 TYR A 63 ? ? 61.58 129.10 88 12 LEU A 109 ? ? -111.56 53.90 89 12 SER A 115 ? ? -80.04 -105.92 90 12 ARG A 120 ? ? -151.89 86.54 91 12 ARG A 159 ? ? -102.06 64.79 92 13 ASN A 14 ? ? 46.39 73.68 93 13 TYR A 63 ? ? 74.91 115.70 94 13 PHE A 73 ? ? -71.97 27.16 95 13 LEU A 109 ? ? -123.49 -164.15 96 13 SER A 115 ? ? -89.53 -141.37 97 13 ASP A 138 ? ? -68.67 97.72 98 13 ARG A 144 ? ? -94.56 -74.34 99 13 ARG A 159 ? ? -110.58 70.72 100 14 ASN A 14 ? ? 75.73 80.23 101 14 TYR A 63 ? ? 76.19 120.50 102 14 PHE A 73 ? ? -72.20 30.55 103 14 SER A 115 ? ? -85.38 -143.81 104 14 ASP A 138 ? ? -68.69 98.68 105 14 ARG A 144 ? ? -111.25 -72.24 106 15 ASN A 14 ? ? 67.10 79.14 107 15 TYR A 63 ? ? 69.78 129.23 108 15 PHE A 73 ? ? -71.90 32.83 109 15 SER A 115 ? ? -76.43 -164.09 110 15 ARG A 144 ? ? -102.85 -80.62 111 16 ASN A 14 ? ? 74.64 87.06 112 16 SER A 48 ? ? -93.76 31.94 113 16 CYS A 60 ? ? -96.49 59.98 114 16 TYR A 63 ? ? 72.98 108.97 115 16 ASN A 72 ? ? -69.60 5.95 116 16 PHE A 73 ? ? -69.00 33.50 117 16 SER A 110 ? ? 80.95 47.03 118 16 THR A 111 ? ? -119.24 63.93 119 16 SER A 115 ? ? -76.37 -163.03 120 16 ARG A 159 ? ? -107.22 64.48 121 17 ASN A 14 ? ? 61.83 78.86 122 17 TYR A 63 ? ? 67.84 137.69 123 17 ASN A 72 ? ? -68.71 2.76 124 17 PHE A 73 ? ? -75.46 25.73 125 17 SER A 115 ? ? -71.99 -161.79 126 18 ASN A 14 ? ? 61.56 77.32 127 18 CYS A 18 ? ? -170.02 146.29 128 18 ASP A 31 ? ? -108.74 -152.84 129 18 CYS A 60 ? ? -96.69 59.66 130 18 TYR A 63 ? ? 56.00 128.82 131 18 PHE A 73 ? ? -73.36 32.35 132 18 SER A 110 ? ? 48.26 -49.66 133 18 THR A 111 ? ? 60.32 -174.49 134 18 SER A 115 ? ? -84.81 -123.97 135 19 ASN A 14 ? ? 65.40 83.57 136 19 CYS A 18 ? ? -170.34 143.13 137 19 TYR A 63 ? ? 76.05 126.99 138 19 PHE A 73 ? ? -72.21 29.75 139 19 SER A 110 ? ? 88.77 51.60 140 19 SER A 115 ? ? -67.85 -165.78 141 19 ARG A 159 ? ? -119.62 79.62 142 20 SER A 3 ? ? -101.62 -165.20 143 20 ASN A 14 ? ? 79.36 79.02 144 20 CYS A 60 ? ? -93.12 57.18 145 20 TYR A 63 ? ? 72.72 127.69 146 20 PHE A 73 ? ? -67.96 19.05 147 20 SER A 115 ? ? -63.86 -162.98 148 20 ARG A 144 ? ? -128.69 -83.21 149 20 ARG A 159 ? ? -110.81 60.68 150 21 SER A 3 ? ? -160.05 -169.02 151 21 ASN A 14 ? ? 65.65 77.18 152 21 TYR A 63 ? ? 76.93 120.60 153 21 THR A 111 ? ? -115.23 61.96 154 21 ASP A 138 ? ? -69.28 87.06 155 21 ARG A 144 ? ? -95.43 -74.07 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 5 LEU A 109 ? ? SER A 110 ? ? 143.48 2 7 LEU A 109 ? ? SER A 110 ? ? 103.63 3 12 LEU A 109 ? ? SER A 110 ? ? 135.64 4 18 LEU A 109 ? ? SER A 110 ? ? 111.85 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 8 ? ? 0.089 'SIDE CHAIN' 2 1 TYR A 76 ? ? 0.076 'SIDE CHAIN' 3 3 TYR A 76 ? ? 0.075 'SIDE CHAIN' 4 9 ARG A 8 ? ? 0.076 'SIDE CHAIN' 5 9 TYR A 76 ? ? 0.083 'SIDE CHAIN' 6 9 ARG A 120 ? ? 0.078 'SIDE CHAIN' 7 10 TYR A 89 ? ? 0.084 'SIDE CHAIN' 8 11 TYR A 76 ? ? 0.068 'SIDE CHAIN' 9 11 TYR A 89 ? ? 0.073 'SIDE CHAIN' 10 12 TYR A 4 ? ? 0.070 'SIDE CHAIN' 11 13 TYR A 4 ? ? 0.062 'SIDE CHAIN' 12 14 TYR A 76 ? ? 0.101 'SIDE CHAIN' 13 17 TYR A 89 ? ? 0.080 'SIDE CHAIN' 14 19 TYR A 89 ? ? 0.072 'SIDE CHAIN' 15 20 TYR A 89 ? ? 0.076 'SIDE CHAIN' 16 21 TYR A 76 ? ? 0.092 'SIDE CHAIN' 17 21 ARG A 159 ? ? 0.081 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 7P27 _pdbx_nmr_ensemble.conformers_calculated_total_number 21 _pdbx_nmr_ensemble.conformers_submitted_total_number 21 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7P27 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;0.6 mM [U-99% 15N] Chikungunya virus macro domain, 20 mM no sodium chloride, 10 mM no HEPES, 2 mM no DTT, 2 mM no EDTA, 0.25 mM no DSS, 10 % no D2O, 90% H2O/10% D2O ; '90% H2O/10% D2O' 15N solution 'CHIKV macro domain, [U-99% 15N], 0.6 mM; soduim chloride 20 mM; Hepes 10 mM' 2 ;0.6 mM [U-99% 13C; U-99% 15N] Chikungunya virus macro domain, 20 mM no sodium chloride, 10 mM no HEPES, 2 mM no DTT, 2 mM no EDTA, 0.25 mM no DSS, 10 % no D2O, 90% H2O/10% D2O ; '90% H2O/10% D2O' 13C-15N solution 'CHIKV macro domain, [U-99% 13C; U-99% 15N], 0.6 mM; soduim chloride 20 mM; Hepes 10 mM' 3 ;0.3 mM no Chikungunya virus macro domain, 20 mM no sodium chloride, 2 mM no HEPES, 2 mM no DTT, 2 mM no EDTA, 0.25 mM no DSS, 10 % no D2O, 90% H2O/10% D2O ; '90% H2O/10% D2O' unlabeled solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Chikungunya virus macro domain' 0.6 ? mM '[U-99% 15N]' 1 'sodium chloride' 20 ? mM no 1 HEPES 10 ? mM no 1 DTT 2 ? mM no 1 EDTA 2 ? mM no 1 DSS 0.25 ? mM no 1 D2O 10 ? % no 2 'Chikungunya virus macro domain' 0.6 ? mM '[U-99% 13C; U-99% 15N]' 2 'sodium chloride' 20 ? mM no 2 HEPES 10 ? mM no 2 DTT 2 ? mM no 2 EDTA 2 ? mM no 2 DSS 0.25 ? mM no 2 D2O 10 ? % no 3 'Chikungunya virus macro domain' 0.3 ? mM no 3 'sodium chloride' 20 ? mM no 3 HEPES 2 ? mM no 3 DTT 2 ? mM no 3 EDTA 2 ? mM no 3 DSS 0.25 ? mM no 3 D2O 10 ? % no # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 2 '2D 1H-13C HSQC' 1 isotropic 3 1 2 '3D HBHA(CO)NH' 1 isotropic 4 1 1 '3D HNHA' 1 isotropic 5 1 2 '3D CBCA(CO)NH' 1 isotropic 9 1 2 '3D HNCACB' 1 isotropic 8 1 2 '3D HNCA' 1 isotropic 7 1 2 '3D HN(CO)CA' 1 isotropic 6 1 2 '3D HNCO' 1 isotropic 11 1 2 '3D HN(CA)CO' 1 isotropic 10 1 2 '3D HCCH-TOCSY' 1 isotropic 12 1 2 '3D 1H-13C NOESY aliphatic' 1 isotropic 13 1 2 '3D 1H-13C NOESY aromatic' 1 isotropic 14 1 1 '3D 1H-15N NOESY' 1 isotropic 15 1 3 '2D 1H-1H NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 7P27 _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 7 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 4 'peak picking' CARA v1.5.5 'Keller and Wuthrich' 1 'chemical shift assignment' CARA v1.5.5 'Keller and Wuthrich' 2 'structure calculation' DYANA ? 'Guntert, Braun and Wuthrich' 5 collection TopSpin 3.2 'Bruker Biospin' 6 processing TopSpin 3.2 'Bruker Biospin' 7 refinement Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -7 ? A MET 1 2 1 Y 1 A LYS -6 ? A LYS 2 3 1 Y 1 A HIS -5 ? A HIS 3 4 1 Y 1 A HIS -4 ? A HIS 4 5 1 Y 1 A HIS -3 ? A HIS 5 6 1 Y 1 A HIS -2 ? A HIS 6 7 1 Y 1 A HIS -1 ? A HIS 7 8 1 Y 1 A HIS 0 ? A HIS 8 9 2 Y 1 A MET -7 ? A MET 1 10 2 Y 1 A LYS -6 ? A LYS 2 11 2 Y 1 A HIS -5 ? A HIS 3 12 2 Y 1 A HIS -4 ? A HIS 4 13 2 Y 1 A HIS -3 ? A HIS 5 14 2 Y 1 A HIS -2 ? A HIS 6 15 2 Y 1 A HIS -1 ? A HIS 7 16 2 Y 1 A HIS 0 ? A HIS 8 17 3 Y 1 A MET -7 ? A MET 1 18 3 Y 1 A LYS -6 ? A LYS 2 19 3 Y 1 A HIS -5 ? A HIS 3 20 3 Y 1 A HIS -4 ? A HIS 4 21 3 Y 1 A HIS -3 ? A HIS 5 22 3 Y 1 A HIS -2 ? A HIS 6 23 3 Y 1 A HIS -1 ? A HIS 7 24 3 Y 1 A HIS 0 ? A HIS 8 25 4 Y 1 A MET -7 ? A MET 1 26 4 Y 1 A LYS -6 ? A LYS 2 27 4 Y 1 A HIS -5 ? A HIS 3 28 4 Y 1 A HIS -4 ? A HIS 4 29 4 Y 1 A HIS -3 ? A HIS 5 30 4 Y 1 A HIS -2 ? A HIS 6 31 4 Y 1 A HIS -1 ? A HIS 7 32 4 Y 1 A HIS 0 ? A HIS 8 33 5 Y 1 A MET -7 ? A MET 1 34 5 Y 1 A LYS -6 ? A LYS 2 35 5 Y 1 A HIS -5 ? A HIS 3 36 5 Y 1 A HIS -4 ? A HIS 4 37 5 Y 1 A HIS -3 ? A HIS 5 38 5 Y 1 A HIS -2 ? A HIS 6 39 5 Y 1 A HIS -1 ? A HIS 7 40 5 Y 1 A HIS 0 ? A HIS 8 41 6 Y 1 A MET -7 ? A MET 1 42 6 Y 1 A LYS -6 ? A LYS 2 43 6 Y 1 A HIS -5 ? A HIS 3 44 6 Y 1 A HIS -4 ? A HIS 4 45 6 Y 1 A HIS -3 ? A HIS 5 46 6 Y 1 A HIS -2 ? A HIS 6 47 6 Y 1 A HIS -1 ? A HIS 7 48 6 Y 1 A HIS 0 ? A HIS 8 49 7 Y 1 A MET -7 ? A MET 1 50 7 Y 1 A LYS -6 ? A LYS 2 51 7 Y 1 A HIS -5 ? A HIS 3 52 7 Y 1 A HIS -4 ? A HIS 4 53 7 Y 1 A HIS -3 ? A HIS 5 54 7 Y 1 A HIS -2 ? A HIS 6 55 7 Y 1 A HIS -1 ? A HIS 7 56 7 Y 1 A HIS 0 ? A HIS 8 57 8 Y 1 A MET -7 ? A MET 1 58 8 Y 1 A LYS -6 ? A LYS 2 59 8 Y 1 A HIS -5 ? A HIS 3 60 8 Y 1 A HIS -4 ? A HIS 4 61 8 Y 1 A HIS -3 ? A HIS 5 62 8 Y 1 A HIS -2 ? A HIS 6 63 8 Y 1 A HIS -1 ? A HIS 7 64 8 Y 1 A HIS 0 ? A HIS 8 65 9 Y 1 A MET -7 ? A MET 1 66 9 Y 1 A LYS -6 ? A LYS 2 67 9 Y 1 A HIS -5 ? A HIS 3 68 9 Y 1 A HIS -4 ? A HIS 4 69 9 Y 1 A HIS -3 ? A HIS 5 70 9 Y 1 A HIS -2 ? A HIS 6 71 9 Y 1 A HIS -1 ? A HIS 7 72 9 Y 1 A HIS 0 ? A HIS 8 73 10 Y 1 A MET -7 ? A MET 1 74 10 Y 1 A LYS -6 ? A LYS 2 75 10 Y 1 A HIS -5 ? A HIS 3 76 10 Y 1 A HIS -4 ? A HIS 4 77 10 Y 1 A HIS -3 ? A HIS 5 78 10 Y 1 A HIS -2 ? A HIS 6 79 10 Y 1 A HIS -1 ? A HIS 7 80 10 Y 1 A HIS 0 ? A HIS 8 81 11 Y 1 A MET -7 ? A MET 1 82 11 Y 1 A LYS -6 ? A LYS 2 83 11 Y 1 A HIS -5 ? A HIS 3 84 11 Y 1 A HIS -4 ? A HIS 4 85 11 Y 1 A HIS -3 ? A HIS 5 86 11 Y 1 A HIS -2 ? A HIS 6 87 11 Y 1 A HIS -1 ? A HIS 7 88 11 Y 1 A HIS 0 ? A HIS 8 89 12 Y 1 A MET -7 ? A MET 1 90 12 Y 1 A LYS -6 ? A LYS 2 91 12 Y 1 A HIS -5 ? A HIS 3 92 12 Y 1 A HIS -4 ? A HIS 4 93 12 Y 1 A HIS -3 ? A HIS 5 94 12 Y 1 A HIS -2 ? A HIS 6 95 12 Y 1 A HIS -1 ? A HIS 7 96 12 Y 1 A HIS 0 ? A HIS 8 97 13 Y 1 A MET -7 ? A MET 1 98 13 Y 1 A LYS -6 ? A LYS 2 99 13 Y 1 A HIS -5 ? A HIS 3 100 13 Y 1 A HIS -4 ? A HIS 4 101 13 Y 1 A HIS -3 ? A HIS 5 102 13 Y 1 A HIS -2 ? A HIS 6 103 13 Y 1 A HIS -1 ? A HIS 7 104 13 Y 1 A HIS 0 ? A HIS 8 105 14 Y 1 A MET -7 ? A MET 1 106 14 Y 1 A LYS -6 ? A LYS 2 107 14 Y 1 A HIS -5 ? A HIS 3 108 14 Y 1 A HIS -4 ? A HIS 4 109 14 Y 1 A HIS -3 ? A HIS 5 110 14 Y 1 A HIS -2 ? A HIS 6 111 14 Y 1 A HIS -1 ? A HIS 7 112 14 Y 1 A HIS 0 ? A HIS 8 113 15 Y 1 A MET -7 ? A MET 1 114 15 Y 1 A LYS -6 ? A LYS 2 115 15 Y 1 A HIS -5 ? A HIS 3 116 15 Y 1 A HIS -4 ? A HIS 4 117 15 Y 1 A HIS -3 ? A HIS 5 118 15 Y 1 A HIS -2 ? A HIS 6 119 15 Y 1 A HIS -1 ? A HIS 7 120 15 Y 1 A HIS 0 ? A HIS 8 121 16 Y 1 A MET -7 ? A MET 1 122 16 Y 1 A LYS -6 ? A LYS 2 123 16 Y 1 A HIS -5 ? A HIS 3 124 16 Y 1 A HIS -4 ? A HIS 4 125 16 Y 1 A HIS -3 ? A HIS 5 126 16 Y 1 A HIS -2 ? A HIS 6 127 16 Y 1 A HIS -1 ? A HIS 7 128 16 Y 1 A HIS 0 ? A HIS 8 129 17 Y 1 A MET -7 ? A MET 1 130 17 Y 1 A LYS -6 ? A LYS 2 131 17 Y 1 A HIS -5 ? A HIS 3 132 17 Y 1 A HIS -4 ? A HIS 4 133 17 Y 1 A HIS -3 ? A HIS 5 134 17 Y 1 A HIS -2 ? A HIS 6 135 17 Y 1 A HIS -1 ? A HIS 7 136 17 Y 1 A HIS 0 ? A HIS 8 137 18 Y 1 A MET -7 ? A MET 1 138 18 Y 1 A LYS -6 ? A LYS 2 139 18 Y 1 A HIS -5 ? A HIS 3 140 18 Y 1 A HIS -4 ? A HIS 4 141 18 Y 1 A HIS -3 ? A HIS 5 142 18 Y 1 A HIS -2 ? A HIS 6 143 18 Y 1 A HIS -1 ? A HIS 7 144 18 Y 1 A HIS 0 ? A HIS 8 145 19 Y 1 A MET -7 ? A MET 1 146 19 Y 1 A LYS -6 ? A LYS 2 147 19 Y 1 A HIS -5 ? A HIS 3 148 19 Y 1 A HIS -4 ? A HIS 4 149 19 Y 1 A HIS -3 ? A HIS 5 150 19 Y 1 A HIS -2 ? A HIS 6 151 19 Y 1 A HIS -1 ? A HIS 7 152 19 Y 1 A HIS 0 ? A HIS 8 153 20 Y 1 A MET -7 ? A MET 1 154 20 Y 1 A LYS -6 ? A LYS 2 155 20 Y 1 A HIS -5 ? A HIS 3 156 20 Y 1 A HIS -4 ? A HIS 4 157 20 Y 1 A HIS -3 ? A HIS 5 158 20 Y 1 A HIS -2 ? A HIS 6 159 20 Y 1 A HIS -1 ? A HIS 7 160 20 Y 1 A HIS 0 ? A HIS 8 161 21 Y 1 A MET -7 ? A MET 1 162 21 Y 1 A LYS -6 ? A LYS 2 163 21 Y 1 A HIS -5 ? A HIS 3 164 21 Y 1 A HIS -4 ? A HIS 4 165 21 Y 1 A HIS -3 ? A HIS 5 166 21 Y 1 A HIS -2 ? A HIS 6 167 21 Y 1 A HIS -1 ? A HIS 7 168 21 Y 1 A HIS 0 ? A HIS 8 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'European Research Council (ERC)' Greece 'EU FP7 REGPOT CT-2011-285950 SEE-DRUG' 1 'European Commission' France 653316 2 'European Regional Development Fund' Greece 'MIS 5002550' 3 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'Avance HD-III H 700 MHz' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7P27 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_