data_7P3O # _entry.id 7P3O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.388 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7P3O pdb_00007p3o 10.2210/pdb7p3o/pdb WWPDB D_1292116873 ? ? BMRB 34646 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-01-18 2 'Structure model' 1 1 2024-03-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' chem_comp_atom 3 2 'Structure model' chem_comp_bond # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7P3O _pdbx_database_status.recvd_initial_deposition_date 2021-07-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details ;Solution structures of HIV-1 and SIVmac p6 and their interaction with accessory proteins Vpr and Vpx in the presence of DPC micelles ; _pdbx_database_related.db_id 34646 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, X.' 1 ? 'Nonin-Lecomte, S.' 2 ? 'Bouaziz, S.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Solution structures of HIV-1 and SIVmac p6 and their interaction with accessory proteins Vpr and Vpx in the presence of DPC micelles ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, X.' 1 ? primary 'Bouaziz, S.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Gag protein' _entity.formula_weight 5812.297 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LQSRPEPTAPPEESFRFGEETTTPSQKQEPIDKELYPLASLRSLFGSDPSSQ _entity_poly.pdbx_seq_one_letter_code_can LQSRPEPTAPPEESFRFGEETTTPSQKQEPIDKELYPLASLRSLFGSDPSSQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 GLN n 1 3 SER n 1 4 ARG n 1 5 PRO n 1 6 GLU n 1 7 PRO n 1 8 THR n 1 9 ALA n 1 10 PRO n 1 11 PRO n 1 12 GLU n 1 13 GLU n 1 14 SER n 1 15 PHE n 1 16 ARG n 1 17 PHE n 1 18 GLY n 1 19 GLU n 1 20 GLU n 1 21 THR n 1 22 THR n 1 23 THR n 1 24 PRO n 1 25 SER n 1 26 GLN n 1 27 LYS n 1 28 GLN n 1 29 GLU n 1 30 PRO n 1 31 ILE n 1 32 ASP n 1 33 LYS n 1 34 GLU n 1 35 LEU n 1 36 TYR n 1 37 PRO n 1 38 LEU n 1 39 ALA n 1 40 SER n 1 41 LEU n 1 42 ARG n 1 43 SER n 1 44 LEU n 1 45 PHE n 1 46 GLY n 1 47 SER n 1 48 ASP n 1 49 PRO n 1 50 SER n 1 51 SER n 1 52 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 52 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene gag _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name Synthecium _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 2480903 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 GLN 52 52 52 GLN GLN A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7P3O _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7P3O _struct.title ;Solution structures of HIV-1 and SIVmac p6 and their interaction with accessory proteins Vpr and Vpx in the presence of DPC micelles ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7P3O _struct_keywords.text 'HIV-1, P6, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code E9P083_9HIV1 _struct_ref.pdbx_db_accession E9P083 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LQSRPEPTAPPEESFRFGEETTTPSQKQEPIDKELYPLASLRSLFGSDPSSQ _struct_ref.pdbx_align_begin 18 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7P3O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 52 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession E9P083 _struct_ref_seq.db_align_beg 18 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 69 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 52 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 11 ? PHE A 17 ? PRO A 11 PHE A 17 1 ? 7 HELX_P HELX_P2 AA2 PHE A 17 ? THR A 22 ? PHE A 17 THR A 22 1 ? 6 HELX_P HELX_P3 AA3 PRO A 24 ? GLU A 29 ? PRO A 24 GLU A 29 5 ? 6 HELX_P HELX_P4 AA4 LEU A 35 ? GLY A 46 ? LEU A 35 GLY A 46 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 OD1 A ASP 48 ? ? HG A SER 50 ? ? 1.55 2 6 HG A SER 43 ? ? OD2 A ASP 48 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 29 ? ? 69.31 87.10 2 1 ASP A 32 ? ? -171.53 -56.84 3 1 SER A 47 ? ? -161.58 113.46 4 1 SER A 51 ? ? -124.36 -159.17 5 2 GLN A 28 ? ? -94.26 -60.13 6 2 ILE A 31 ? ? 59.25 -85.27 7 2 SER A 51 ? ? 57.17 78.33 8 3 THR A 8 ? ? 71.91 118.02 9 3 GLN A 28 ? ? -90.21 46.71 10 3 ILE A 31 ? ? -116.76 67.11 11 3 SER A 47 ? ? -112.34 52.27 12 4 GLU A 29 ? ? -52.11 109.04 13 4 ASP A 32 ? ? 74.70 -65.44 14 4 SER A 51 ? ? -109.33 78.62 15 5 THR A 8 ? ? 78.54 142.22 16 5 GLU A 29 ? ? 71.68 117.81 17 5 ILE A 31 ? ? -151.25 -8.20 18 6 GLU A 6 ? ? 70.92 147.23 19 6 THR A 8 ? ? 72.14 108.30 20 6 GLU A 12 ? ? -79.78 21.24 21 6 PRO A 24 ? ? -61.60 4.27 22 6 SER A 47 ? ? -149.87 -75.08 23 7 GLN A 2 ? ? -99.07 50.26 24 7 ARG A 4 ? ? 53.78 82.14 25 7 ILE A 31 ? ? 62.43 86.54 26 7 SER A 51 ? ? 57.21 -142.56 27 8 ARG A 4 ? ? -175.22 -56.13 28 9 ASP A 32 ? ? -140.05 -60.84 29 9 SER A 47 ? ? 58.58 76.95 30 9 SER A 51 ? ? -159.54 71.60 31 10 ILE A 31 ? ? 35.51 66.45 # _pdbx_nmr_ensemble.entry_id 7P3O _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7P3O _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.0 mM unlabeled HIV-1 p6, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label unlabeled _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'HIV-1 p6' _pdbx_nmr_exptl_sample.concentration 1.0 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling unlabeled # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 323 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H NOESY' 1 isotropic 2 1 1 '2D 1H-1H TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 7P3O _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details CNS _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing TopSpin ? 'Bruker Biospin' 2 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'data analysis' 'CcpNmr Analysis' ? CCPN # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 ILE N N N N 106 ILE CA C N S 107 ILE C C N N 108 ILE O O N N 109 ILE CB C N S 110 ILE CG1 C N N 111 ILE CG2 C N N 112 ILE CD1 C N N 113 ILE OXT O N N 114 ILE H H N N 115 ILE H2 H N N 116 ILE HA H N N 117 ILE HB H N N 118 ILE HG12 H N N 119 ILE HG13 H N N 120 ILE HG21 H N N 121 ILE HG22 H N N 122 ILE HG23 H N N 123 ILE HD11 H N N 124 ILE HD12 H N N 125 ILE HD13 H N N 126 ILE HXT H N N 127 LEU N N N N 128 LEU CA C N S 129 LEU C C N N 130 LEU O O N N 131 LEU CB C N N 132 LEU CG C N N 133 LEU CD1 C N N 134 LEU CD2 C N N 135 LEU OXT O N N 136 LEU H H N N 137 LEU H2 H N N 138 LEU HA H N N 139 LEU HB2 H N N 140 LEU HB3 H N N 141 LEU HG H N N 142 LEU HD11 H N N 143 LEU HD12 H N N 144 LEU HD13 H N N 145 LEU HD21 H N N 146 LEU HD22 H N N 147 LEU HD23 H N N 148 LEU HXT H N N 149 LYS N N N N 150 LYS CA C N S 151 LYS C C N N 152 LYS O O N N 153 LYS CB C N N 154 LYS CG C N N 155 LYS CD C N N 156 LYS CE C N N 157 LYS NZ N N N 158 LYS OXT O N N 159 LYS H H N N 160 LYS H2 H N N 161 LYS HA H N N 162 LYS HB2 H N N 163 LYS HB3 H N N 164 LYS HG2 H N N 165 LYS HG3 H N N 166 LYS HD2 H N N 167 LYS HD3 H N N 168 LYS HE2 H N N 169 LYS HE3 H N N 170 LYS HZ1 H N N 171 LYS HZ2 H N N 172 LYS HZ3 H N N 173 LYS HXT H N N 174 PHE N N N N 175 PHE CA C N S 176 PHE C C N N 177 PHE O O N N 178 PHE CB C N N 179 PHE CG C Y N 180 PHE CD1 C Y N 181 PHE CD2 C Y N 182 PHE CE1 C Y N 183 PHE CE2 C Y N 184 PHE CZ C Y N 185 PHE OXT O N N 186 PHE H H N N 187 PHE H2 H N N 188 PHE HA H N N 189 PHE HB2 H N N 190 PHE HB3 H N N 191 PHE HD1 H N N 192 PHE HD2 H N N 193 PHE HE1 H N N 194 PHE HE2 H N N 195 PHE HZ H N N 196 PHE HXT H N N 197 PRO N N N N 198 PRO CA C N S 199 PRO C C N N 200 PRO O O N N 201 PRO CB C N N 202 PRO CG C N N 203 PRO CD C N N 204 PRO OXT O N N 205 PRO H H N N 206 PRO HA H N N 207 PRO HB2 H N N 208 PRO HB3 H N N 209 PRO HG2 H N N 210 PRO HG3 H N N 211 PRO HD2 H N N 212 PRO HD3 H N N 213 PRO HXT H N N 214 SER N N N N 215 SER CA C N S 216 SER C C N N 217 SER O O N N 218 SER CB C N N 219 SER OG O N N 220 SER OXT O N N 221 SER H H N N 222 SER H2 H N N 223 SER HA H N N 224 SER HB2 H N N 225 SER HB3 H N N 226 SER HG H N N 227 SER HXT H N N 228 THR N N N N 229 THR CA C N S 230 THR C C N N 231 THR O O N N 232 THR CB C N R 233 THR OG1 O N N 234 THR CG2 C N N 235 THR OXT O N N 236 THR H H N N 237 THR H2 H N N 238 THR HA H N N 239 THR HB H N N 240 THR HG1 H N N 241 THR HG21 H N N 242 THR HG22 H N N 243 THR HG23 H N N 244 THR HXT H N N 245 TYR N N N N 246 TYR CA C N S 247 TYR C C N N 248 TYR O O N N 249 TYR CB C N N 250 TYR CG C Y N 251 TYR CD1 C Y N 252 TYR CD2 C Y N 253 TYR CE1 C Y N 254 TYR CE2 C Y N 255 TYR CZ C Y N 256 TYR OH O N N 257 TYR OXT O N N 258 TYR H H N N 259 TYR H2 H N N 260 TYR HA H N N 261 TYR HB2 H N N 262 TYR HB3 H N N 263 TYR HD1 H N N 264 TYR HD2 H N N 265 TYR HE1 H N N 266 TYR HE2 H N N 267 TYR HH H N N 268 TYR HXT H N N 269 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 ILE N CA sing N N 100 ILE N H sing N N 101 ILE N H2 sing N N 102 ILE CA C sing N N 103 ILE CA CB sing N N 104 ILE CA HA sing N N 105 ILE C O doub N N 106 ILE C OXT sing N N 107 ILE CB CG1 sing N N 108 ILE CB CG2 sing N N 109 ILE CB HB sing N N 110 ILE CG1 CD1 sing N N 111 ILE CG1 HG12 sing N N 112 ILE CG1 HG13 sing N N 113 ILE CG2 HG21 sing N N 114 ILE CG2 HG22 sing N N 115 ILE CG2 HG23 sing N N 116 ILE CD1 HD11 sing N N 117 ILE CD1 HD12 sing N N 118 ILE CD1 HD13 sing N N 119 ILE OXT HXT sing N N 120 LEU N CA sing N N 121 LEU N H sing N N 122 LEU N H2 sing N N 123 LEU CA C sing N N 124 LEU CA CB sing N N 125 LEU CA HA sing N N 126 LEU C O doub N N 127 LEU C OXT sing N N 128 LEU CB CG sing N N 129 LEU CB HB2 sing N N 130 LEU CB HB3 sing N N 131 LEU CG CD1 sing N N 132 LEU CG CD2 sing N N 133 LEU CG HG sing N N 134 LEU CD1 HD11 sing N N 135 LEU CD1 HD12 sing N N 136 LEU CD1 HD13 sing N N 137 LEU CD2 HD21 sing N N 138 LEU CD2 HD22 sing N N 139 LEU CD2 HD23 sing N N 140 LEU OXT HXT sing N N 141 LYS N CA sing N N 142 LYS N H sing N N 143 LYS N H2 sing N N 144 LYS CA C sing N N 145 LYS CA CB sing N N 146 LYS CA HA sing N N 147 LYS C O doub N N 148 LYS C OXT sing N N 149 LYS CB CG sing N N 150 LYS CB HB2 sing N N 151 LYS CB HB3 sing N N 152 LYS CG CD sing N N 153 LYS CG HG2 sing N N 154 LYS CG HG3 sing N N 155 LYS CD CE sing N N 156 LYS CD HD2 sing N N 157 LYS CD HD3 sing N N 158 LYS CE NZ sing N N 159 LYS CE HE2 sing N N 160 LYS CE HE3 sing N N 161 LYS NZ HZ1 sing N N 162 LYS NZ HZ2 sing N N 163 LYS NZ HZ3 sing N N 164 LYS OXT HXT sing N N 165 PHE N CA sing N N 166 PHE N H sing N N 167 PHE N H2 sing N N 168 PHE CA C sing N N 169 PHE CA CB sing N N 170 PHE CA HA sing N N 171 PHE C O doub N N 172 PHE C OXT sing N N 173 PHE CB CG sing N N 174 PHE CB HB2 sing N N 175 PHE CB HB3 sing N N 176 PHE CG CD1 doub Y N 177 PHE CG CD2 sing Y N 178 PHE CD1 CE1 sing Y N 179 PHE CD1 HD1 sing N N 180 PHE CD2 CE2 doub Y N 181 PHE CD2 HD2 sing N N 182 PHE CE1 CZ doub Y N 183 PHE CE1 HE1 sing N N 184 PHE CE2 CZ sing Y N 185 PHE CE2 HE2 sing N N 186 PHE CZ HZ sing N N 187 PHE OXT HXT sing N N 188 PRO N CA sing N N 189 PRO N CD sing N N 190 PRO N H sing N N 191 PRO CA C sing N N 192 PRO CA CB sing N N 193 PRO CA HA sing N N 194 PRO C O doub N N 195 PRO C OXT sing N N 196 PRO CB CG sing N N 197 PRO CB HB2 sing N N 198 PRO CB HB3 sing N N 199 PRO CG CD sing N N 200 PRO CG HG2 sing N N 201 PRO CG HG3 sing N N 202 PRO CD HD2 sing N N 203 PRO CD HD3 sing N N 204 PRO OXT HXT sing N N 205 SER N CA sing N N 206 SER N H sing N N 207 SER N H2 sing N N 208 SER CA C sing N N 209 SER CA CB sing N N 210 SER CA HA sing N N 211 SER C O doub N N 212 SER C OXT sing N N 213 SER CB OG sing N N 214 SER CB HB2 sing N N 215 SER CB HB3 sing N N 216 SER OG HG sing N N 217 SER OXT HXT sing N N 218 THR N CA sing N N 219 THR N H sing N N 220 THR N H2 sing N N 221 THR CA C sing N N 222 THR CA CB sing N N 223 THR CA HA sing N N 224 THR C O doub N N 225 THR C OXT sing N N 226 THR CB OG1 sing N N 227 THR CB CG2 sing N N 228 THR CB HB sing N N 229 THR OG1 HG1 sing N N 230 THR CG2 HG21 sing N N 231 THR CG2 HG22 sing N N 232 THR CG2 HG23 sing N N 233 THR OXT HXT sing N N 234 TYR N CA sing N N 235 TYR N H sing N N 236 TYR N H2 sing N N 237 TYR CA C sing N N 238 TYR CA CB sing N N 239 TYR CA HA sing N N 240 TYR C O doub N N 241 TYR C OXT sing N N 242 TYR CB CG sing N N 243 TYR CB HB2 sing N N 244 TYR CB HB3 sing N N 245 TYR CG CD1 doub Y N 246 TYR CG CD2 sing Y N 247 TYR CD1 CE1 sing Y N 248 TYR CD1 HD1 sing N N 249 TYR CD2 CE2 doub Y N 250 TYR CD2 HD2 sing N N 251 TYR CE1 CZ doub Y N 252 TYR CE1 HE1 sing N N 253 TYR CE2 CZ sing Y N 254 TYR CE2 HE2 sing N N 255 TYR CZ OH sing N N 256 TYR OH HH sing N N 257 TYR OXT HXT sing N N 258 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7P3O _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_