data_7P42 # _entry.id 7P42 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7P42 pdb_00007p42 10.2210/pdb7p42/pdb WWPDB D_1292116553 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-07-20 2 'Structure model' 1 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 2 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 2 2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 3 2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 4 2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 5 2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 6 2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 7 2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 8 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7P42 _pdbx_database_status.recvd_initial_deposition_date 2021-07-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gardonyi, M.' 1 0000-0001-6689-0112 'Heine, A.' 2 0000-0002-5285-4089 'Klebe, G.' 3 0000-0002-4913-390X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of IpgC in complex with a follow-up compound based on J2' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gardonyi, M.' 1 0000-0001-6689-0112 primary 'Heine, A.' 2 0000-0002-5285-4089 primary 'Klebe, G.' 3 0000-0002-4913-390X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Chaperone protein IpgC' 16310.492 2 ? ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 3 ? ? ? ? 4 non-polymer syn 'DIMETHYL SULFOXIDE' 78.133 1 ? ? ? ? 5 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 2 ? ? ? ? 6 non-polymer syn '2-(4,6-dimethylpyrimidin-2-yl)-3H-isoindol-1-imine' 238.288 1 ? ? ? ? 7 water nat water 18.015 213 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQ AADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GSISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQ AADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQ ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 'CHLORIDE ION' CL 4 'DIMETHYL SULFOXIDE' DMS 5 'DI(HYDROXYETHYL)ETHER' PEG 6 '2-(4,6-dimethylpyrimidin-2-yl)-3H-isoindol-1-imine' 5I8 7 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ILE n 1 4 SER n 1 5 THR n 1 6 ALA n 1 7 VAL n 1 8 ILE n 1 9 ASP n 1 10 ALA n 1 11 ILE n 1 12 ASN n 1 13 SER n 1 14 GLY n 1 15 ALA n 1 16 THR n 1 17 LEU n 1 18 LYS n 1 19 ASP n 1 20 ILE n 1 21 ASN n 1 22 ALA n 1 23 ILE n 1 24 PRO n 1 25 ASP n 1 26 ASP n 1 27 MET n 1 28 MET n 1 29 ASP n 1 30 ASP n 1 31 ILE n 1 32 TYR n 1 33 SER n 1 34 TYR n 1 35 ALA n 1 36 TYR n 1 37 ASP n 1 38 PHE n 1 39 TYR n 1 40 ASN n 1 41 LYS n 1 42 GLY n 1 43 ARG n 1 44 ILE n 1 45 GLU n 1 46 GLU n 1 47 ALA n 1 48 GLU n 1 49 VAL n 1 50 PHE n 1 51 PHE n 1 52 ARG n 1 53 PHE n 1 54 LEU n 1 55 CYS n 1 56 ILE n 1 57 TYR n 1 58 ASP n 1 59 PHE n 1 60 TYR n 1 61 ASN n 1 62 VAL n 1 63 ASP n 1 64 TYR n 1 65 ILE n 1 66 MET n 1 67 GLY n 1 68 LEU n 1 69 ALA n 1 70 ALA n 1 71 ILE n 1 72 TYR n 1 73 GLN n 1 74 ILE n 1 75 LYS n 1 76 GLU n 1 77 GLN n 1 78 PHE n 1 79 GLN n 1 80 GLN n 1 81 ALA n 1 82 ALA n 1 83 ASP n 1 84 LEU n 1 85 TYR n 1 86 ALA n 1 87 VAL n 1 88 ALA n 1 89 PHE n 1 90 ALA n 1 91 LEU n 1 92 GLY n 1 93 LYS n 1 94 ASN n 1 95 ASP n 1 96 TYR n 1 97 THR n 1 98 PRO n 1 99 VAL n 1 100 PHE n 1 101 HIS n 1 102 THR n 1 103 GLY n 1 104 GLN n 1 105 CYS n 1 106 GLN n 1 107 LEU n 1 108 ARG n 1 109 LEU n 1 110 LYS n 1 111 ALA n 1 112 PRO n 1 113 LEU n 1 114 LYS n 1 115 ALA n 1 116 LYS n 1 117 GLU n 1 118 CYS n 1 119 PHE n 1 120 GLU n 1 121 LEU n 1 122 VAL n 1 123 ILE n 1 124 GLN n 1 125 HIS n 1 126 SER n 1 127 ASN n 1 128 ASP n 1 129 GLU n 1 130 LYS n 1 131 LEU n 1 132 LYS n 1 133 ILE n 1 134 LYS n 1 135 ALA n 1 136 GLN n 1 137 SER n 1 138 TYR n 1 139 LEU n 1 140 ASP n 1 141 ALA n 1 142 ILE n 1 143 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 143 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ipgC, ippI, CP0129' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Shigella flexneri' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 623 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 5I8 non-polymer . '2-(4,6-dimethylpyrimidin-2-yl)-3H-isoindol-1-imine' '2-(4,6-Dimethylpyrimidin-2-yl)-2,3-dihydro-1H-isoindol-1-imine; 3466575' 'C14 H14 N4' 238.288 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DMS non-polymer . 'DIMETHYL SULFOXIDE' ? 'C2 H6 O S' 78.133 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 9 ? ? ? A . n A 1 2 SER 2 10 ? ? ? A . n A 1 3 ILE 3 11 ? ? ? A . n A 1 4 SER 4 12 ? ? ? A . n A 1 5 THR 5 13 ? ? ? A . n A 1 6 ALA 6 14 ? ? ? A . n A 1 7 VAL 7 15 ? ? ? A . n A 1 8 ILE 8 16 16 ILE ILE A . n A 1 9 ASP 9 17 17 ASP ASP A . n A 1 10 ALA 10 18 18 ALA ALA A . n A 1 11 ILE 11 19 19 ILE ILE A . n A 1 12 ASN 12 20 20 ASN ASN A . n A 1 13 SER 13 21 21 SER SER A . n A 1 14 GLY 14 22 22 GLY GLY A . n A 1 15 ALA 15 23 23 ALA ALA A . n A 1 16 THR 16 24 24 THR THR A . n A 1 17 LEU 17 25 25 LEU LEU A . n A 1 18 LYS 18 26 26 LYS LYS A . n A 1 19 ASP 19 27 27 ASP ASP A . n A 1 20 ILE 20 28 28 ILE ILE A . n A 1 21 ASN 21 29 29 ASN ASN A . n A 1 22 ALA 22 30 30 ALA ALA A . n A 1 23 ILE 23 31 31 ILE ILE A . n A 1 24 PRO 24 32 32 PRO PRO A . n A 1 25 ASP 25 33 33 ASP ASP A . n A 1 26 ASP 26 34 34 ASP ASP A . n A 1 27 MET 27 35 35 MET MET A . n A 1 28 MET 28 36 36 MET MET A . n A 1 29 ASP 29 37 37 ASP ASP A . n A 1 30 ASP 30 38 38 ASP ASP A . n A 1 31 ILE 31 39 39 ILE ILE A . n A 1 32 TYR 32 40 40 TYR TYR A . n A 1 33 SER 33 41 41 SER SER A . n A 1 34 TYR 34 42 42 TYR TYR A . n A 1 35 ALA 35 43 43 ALA ALA A . n A 1 36 TYR 36 44 44 TYR TYR A . n A 1 37 ASP 37 45 45 ASP ASP A . n A 1 38 PHE 38 46 46 PHE PHE A . n A 1 39 TYR 39 47 47 TYR TYR A . n A 1 40 ASN 40 48 48 ASN ASN A . n A 1 41 LYS 41 49 49 LYS LYS A . n A 1 42 GLY 42 50 50 GLY GLY A . n A 1 43 ARG 43 51 51 ARG ARG A . n A 1 44 ILE 44 52 52 ILE ILE A . n A 1 45 GLU 45 53 53 GLU GLU A . n A 1 46 GLU 46 54 54 GLU GLU A . n A 1 47 ALA 47 55 55 ALA ALA A . n A 1 48 GLU 48 56 56 GLU GLU A . n A 1 49 VAL 49 57 57 VAL VAL A . n A 1 50 PHE 50 58 58 PHE PHE A . n A 1 51 PHE 51 59 59 PHE PHE A . n A 1 52 ARG 52 60 60 ARG ARG A . n A 1 53 PHE 53 61 61 PHE PHE A . n A 1 54 LEU 54 62 62 LEU LEU A . n A 1 55 CYS 55 63 63 CYS CYS A . n A 1 56 ILE 56 64 64 ILE ILE A . n A 1 57 TYR 57 65 65 TYR TYR A . n A 1 58 ASP 58 66 66 ASP ASP A . n A 1 59 PHE 59 67 67 PHE PHE A . n A 1 60 TYR 60 68 68 TYR TYR A . n A 1 61 ASN 61 69 69 ASN ASN A . n A 1 62 VAL 62 70 70 VAL VAL A . n A 1 63 ASP 63 71 71 ASP ASP A . n A 1 64 TYR 64 72 72 TYR TYR A . n A 1 65 ILE 65 73 73 ILE ILE A . n A 1 66 MET 66 74 74 MET MET A . n A 1 67 GLY 67 75 75 GLY GLY A . n A 1 68 LEU 68 76 76 LEU LEU A . n A 1 69 ALA 69 77 77 ALA ALA A . n A 1 70 ALA 70 78 78 ALA ALA A . n A 1 71 ILE 71 79 79 ILE ILE A . n A 1 72 TYR 72 80 80 TYR TYR A . n A 1 73 GLN 73 81 81 GLN GLN A . n A 1 74 ILE 74 82 82 ILE ILE A . n A 1 75 LYS 75 83 83 LYS LYS A . n A 1 76 GLU 76 84 84 GLU GLU A . n A 1 77 GLN 77 85 85 GLN GLN A . n A 1 78 PHE 78 86 86 PHE PHE A . n A 1 79 GLN 79 87 87 GLN GLN A . n A 1 80 GLN 80 88 88 GLN GLN A . n A 1 81 ALA 81 89 89 ALA ALA A . n A 1 82 ALA 82 90 90 ALA ALA A . n A 1 83 ASP 83 91 91 ASP ASP A . n A 1 84 LEU 84 92 92 LEU LEU A . n A 1 85 TYR 85 93 93 TYR TYR A . n A 1 86 ALA 86 94 94 ALA ALA A . n A 1 87 VAL 87 95 95 VAL VAL A . n A 1 88 ALA 88 96 96 ALA ALA A . n A 1 89 PHE 89 97 97 PHE PHE A . n A 1 90 ALA 90 98 98 ALA ALA A . n A 1 91 LEU 91 99 99 LEU LEU A . n A 1 92 GLY 92 100 100 GLY GLY A . n A 1 93 LYS 93 101 101 LYS LYS A . n A 1 94 ASN 94 102 102 ASN ASN A . n A 1 95 ASP 95 103 103 ASP ASP A . n A 1 96 TYR 96 104 104 TYR TYR A . n A 1 97 THR 97 105 105 THR THR A . n A 1 98 PRO 98 106 106 PRO PRO A . n A 1 99 VAL 99 107 107 VAL VAL A . n A 1 100 PHE 100 108 108 PHE PHE A . n A 1 101 HIS 101 109 109 HIS HIS A . n A 1 102 THR 102 110 110 THR THR A . n A 1 103 GLY 103 111 111 GLY GLY A . n A 1 104 GLN 104 112 112 GLN GLN A . n A 1 105 CYS 105 113 113 CYS CYS A . n A 1 106 GLN 106 114 114 GLN GLN A . n A 1 107 LEU 107 115 115 LEU LEU A . n A 1 108 ARG 108 116 116 ARG ARG A . n A 1 109 LEU 109 117 117 LEU LEU A . n A 1 110 LYS 110 118 118 LYS LYS A . n A 1 111 ALA 111 119 119 ALA ALA A . n A 1 112 PRO 112 120 120 PRO PRO A . n A 1 113 LEU 113 121 121 LEU LEU A . n A 1 114 LYS 114 122 122 LYS LYS A . n A 1 115 ALA 115 123 123 ALA ALA A . n A 1 116 LYS 116 124 124 LYS LYS A . n A 1 117 GLU 117 125 125 GLU GLU A . n A 1 118 CYS 118 126 126 CYS CYS A . n A 1 119 PHE 119 127 127 PHE PHE A . n A 1 120 GLU 120 128 128 GLU GLU A . n A 1 121 LEU 121 129 129 LEU LEU A . n A 1 122 VAL 122 130 130 VAL VAL A . n A 1 123 ILE 123 131 131 ILE ILE A . n A 1 124 GLN 124 132 132 GLN GLN A . n A 1 125 HIS 125 133 133 HIS HIS A . n A 1 126 SER 126 134 134 SER SER A . n A 1 127 ASN 127 135 135 ASN ASN A . n A 1 128 ASP 128 136 136 ASP ASP A . n A 1 129 GLU 129 137 137 GLU GLU A . n A 1 130 LYS 130 138 138 LYS LYS A . n A 1 131 LEU 131 139 139 LEU LEU A . n A 1 132 LYS 132 140 140 LYS LYS A . n A 1 133 ILE 133 141 141 ILE ILE A . n A 1 134 LYS 134 142 142 LYS LYS A . n A 1 135 ALA 135 143 143 ALA ALA A . n A 1 136 GLN 136 144 144 GLN GLN A . n A 1 137 SER 137 145 145 SER SER A . n A 1 138 TYR 138 146 146 TYR TYR A . n A 1 139 LEU 139 147 147 LEU LEU A . n A 1 140 ASP 140 148 148 ASP ASP A . n A 1 141 ALA 141 149 149 ALA ALA A . n A 1 142 ILE 142 150 150 ILE ILE A . n A 1 143 GLN 143 151 151 GLN GLN A . n B 1 1 GLY 1 9 9 GLY GLY B . n B 1 2 SER 2 10 10 SER SER B . n B 1 3 ILE 3 11 11 ILE ILE B . n B 1 4 SER 4 12 12 SER SER B . n B 1 5 THR 5 13 13 THR THR B . n B 1 6 ALA 6 14 14 ALA ALA B . n B 1 7 VAL 7 15 15 VAL VAL B . n B 1 8 ILE 8 16 16 ILE ILE B . n B 1 9 ASP 9 17 17 ASP ASP B . n B 1 10 ALA 10 18 18 ALA ALA B . n B 1 11 ILE 11 19 19 ILE ILE B . n B 1 12 ASN 12 20 20 ASN ASN B . n B 1 13 SER 13 21 21 SER SER B . n B 1 14 GLY 14 22 22 GLY GLY B . n B 1 15 ALA 15 23 23 ALA ALA B . n B 1 16 THR 16 24 24 THR THR B . n B 1 17 LEU 17 25 25 LEU LEU B . n B 1 18 LYS 18 26 26 LYS LYS B . n B 1 19 ASP 19 27 27 ASP ASP B . n B 1 20 ILE 20 28 28 ILE ILE B . n B 1 21 ASN 21 29 29 ASN ASN B . n B 1 22 ALA 22 30 30 ALA ALA B . n B 1 23 ILE 23 31 31 ILE ILE B . n B 1 24 PRO 24 32 32 PRO PRO B . n B 1 25 ASP 25 33 33 ASP ASP B . n B 1 26 ASP 26 34 34 ASP ASP B . n B 1 27 MET 27 35 35 MET MET B . n B 1 28 MET 28 36 36 MET MET B . n B 1 29 ASP 29 37 37 ASP ASP B . n B 1 30 ASP 30 38 38 ASP ASP B . n B 1 31 ILE 31 39 39 ILE ILE B . n B 1 32 TYR 32 40 40 TYR TYR B . n B 1 33 SER 33 41 41 SER SER B . n B 1 34 TYR 34 42 42 TYR TYR B . n B 1 35 ALA 35 43 43 ALA ALA B . n B 1 36 TYR 36 44 44 TYR TYR B . n B 1 37 ASP 37 45 45 ASP ASP B . n B 1 38 PHE 38 46 46 PHE PHE B . n B 1 39 TYR 39 47 47 TYR TYR B . n B 1 40 ASN 40 48 48 ASN ASN B . n B 1 41 LYS 41 49 49 LYS LYS B . n B 1 42 GLY 42 50 50 GLY GLY B . n B 1 43 ARG 43 51 51 ARG ARG B . n B 1 44 ILE 44 52 52 ILE ILE B . n B 1 45 GLU 45 53 53 GLU GLU B . n B 1 46 GLU 46 54 54 GLU GLU B . n B 1 47 ALA 47 55 55 ALA ALA B . n B 1 48 GLU 48 56 56 GLU GLU B . n B 1 49 VAL 49 57 57 VAL VAL B . n B 1 50 PHE 50 58 58 PHE PHE B . n B 1 51 PHE 51 59 59 PHE PHE B . n B 1 52 ARG 52 60 60 ARG ARG B . n B 1 53 PHE 53 61 61 PHE PHE B . n B 1 54 LEU 54 62 62 LEU LEU B . n B 1 55 CYS 55 63 63 CYS CYS B . n B 1 56 ILE 56 64 64 ILE ILE B . n B 1 57 TYR 57 65 65 TYR TYR B . n B 1 58 ASP 58 66 66 ASP ASP B . n B 1 59 PHE 59 67 67 PHE PHE B . n B 1 60 TYR 60 68 68 TYR TYR B . n B 1 61 ASN 61 69 69 ASN ASN B . n B 1 62 VAL 62 70 70 VAL VAL B . n B 1 63 ASP 63 71 71 ASP ASP B . n B 1 64 TYR 64 72 72 TYR TYR B . n B 1 65 ILE 65 73 73 ILE ILE B . n B 1 66 MET 66 74 74 MET MET B . n B 1 67 GLY 67 75 75 GLY GLY B . n B 1 68 LEU 68 76 76 LEU LEU B . n B 1 69 ALA 69 77 77 ALA ALA B . n B 1 70 ALA 70 78 78 ALA ALA B . n B 1 71 ILE 71 79 79 ILE ILE B . n B 1 72 TYR 72 80 80 TYR TYR B . n B 1 73 GLN 73 81 81 GLN GLN B . n B 1 74 ILE 74 82 82 ILE ILE B . n B 1 75 LYS 75 83 83 LYS LYS B . n B 1 76 GLU 76 84 84 GLU GLU B . n B 1 77 GLN 77 85 85 GLN GLN B . n B 1 78 PHE 78 86 86 PHE PHE B . n B 1 79 GLN 79 87 87 GLN GLN B . n B 1 80 GLN 80 88 88 GLN GLN B . n B 1 81 ALA 81 89 89 ALA ALA B . n B 1 82 ALA 82 90 90 ALA ALA B . n B 1 83 ASP 83 91 91 ASP ASP B . n B 1 84 LEU 84 92 92 LEU LEU B . n B 1 85 TYR 85 93 93 TYR TYR B . n B 1 86 ALA 86 94 94 ALA ALA B . n B 1 87 VAL 87 95 95 VAL VAL B . n B 1 88 ALA 88 96 96 ALA ALA B . n B 1 89 PHE 89 97 97 PHE PHE B . n B 1 90 ALA 90 98 98 ALA ALA B . n B 1 91 LEU 91 99 99 LEU LEU B . n B 1 92 GLY 92 100 100 GLY GLY B . n B 1 93 LYS 93 101 101 LYS LYS B . n B 1 94 ASN 94 102 102 ASN ASN B . n B 1 95 ASP 95 103 103 ASP ASP B . n B 1 96 TYR 96 104 104 TYR TYR B . n B 1 97 THR 97 105 105 THR THR B . n B 1 98 PRO 98 106 106 PRO PRO B . n B 1 99 VAL 99 107 107 VAL VAL B . n B 1 100 PHE 100 108 108 PHE PHE B . n B 1 101 HIS 101 109 109 HIS HIS B . n B 1 102 THR 102 110 110 THR THR B . n B 1 103 GLY 103 111 111 GLY GLY B . n B 1 104 GLN 104 112 112 GLN GLN B . n B 1 105 CYS 105 113 113 CYS CYS B . n B 1 106 GLN 106 114 114 GLN GLN B . n B 1 107 LEU 107 115 115 LEU LEU B . n B 1 108 ARG 108 116 116 ARG ARG B . n B 1 109 LEU 109 117 117 LEU LEU B . n B 1 110 LYS 110 118 118 LYS LYS B . n B 1 111 ALA 111 119 119 ALA ALA B . n B 1 112 PRO 112 120 120 PRO PRO B . n B 1 113 LEU 113 121 121 LEU LEU B . n B 1 114 LYS 114 122 122 LYS LYS B . n B 1 115 ALA 115 123 123 ALA ALA B . n B 1 116 LYS 116 124 124 LYS LYS B . n B 1 117 GLU 117 125 125 GLU GLU B . n B 1 118 CYS 118 126 126 CYS CYS B . n B 1 119 PHE 119 127 127 PHE PHE B . n B 1 120 GLU 120 128 128 GLU GLU B . n B 1 121 LEU 121 129 129 LEU LEU B . n B 1 122 VAL 122 130 130 VAL VAL B . n B 1 123 ILE 123 131 131 ILE ILE B . n B 1 124 GLN 124 132 132 GLN GLN B . n B 1 125 HIS 125 133 133 HIS HIS B . n B 1 126 SER 126 134 134 SER SER B . n B 1 127 ASN 127 135 135 ASN ASN B . n B 1 128 ASP 128 136 136 ASP ASP B . n B 1 129 GLU 129 137 137 GLU GLU B . n B 1 130 LYS 130 138 138 LYS LYS B . n B 1 131 LEU 131 139 139 LEU LEU B . n B 1 132 LYS 132 140 140 LYS LYS B . n B 1 133 ILE 133 141 141 ILE ILE B . n B 1 134 LYS 134 142 142 LYS LYS B . n B 1 135 ALA 135 143 143 ALA ALA B . n B 1 136 GLN 136 144 144 GLN GLN B . n B 1 137 SER 137 145 145 SER SER B . n B 1 138 TYR 138 146 146 TYR TYR B . n B 1 139 LEU 139 147 147 LEU LEU B . n B 1 140 ASP 140 148 148 ASP ASP B . n B 1 141 ALA 141 149 149 ALA ALA B . n B 1 142 ILE 142 150 150 ILE ILE B . n B 1 143 GLN 143 151 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 MG 1 201 1 MG MG A . D 3 CL 1 202 3 CL CL A . E 4 DMS 1 203 1 DMS DMS A . F 5 PEG 1 204 2 PEG PEG A . G 2 MG 1 201 3 MG MG B . H 3 CL 1 202 1 CL CL B . I 3 CL 1 203 4 CL CL B . J 6 5I8 1 204 1 5I8 U09 B . K 5 PEG 1 205 1 PEG PEG B . L 7 HOH 1 301 77 HOH HOH A . L 7 HOH 2 302 179 HOH HOH A . L 7 HOH 3 303 160 HOH HOH A . L 7 HOH 4 304 29 HOH HOH A . L 7 HOH 5 305 51 HOH HOH A . L 7 HOH 6 306 147 HOH HOH A . L 7 HOH 7 307 187 HOH HOH A . L 7 HOH 8 308 199 HOH HOH A . L 7 HOH 9 309 102 HOH HOH A . L 7 HOH 10 310 17 HOH HOH A . L 7 HOH 11 311 300 HOH HOH A . L 7 HOH 12 312 287 HOH HOH A . L 7 HOH 13 313 35 HOH HOH A . L 7 HOH 14 314 139 HOH HOH A . L 7 HOH 15 315 23 HOH HOH A . L 7 HOH 16 316 31 HOH HOH A . L 7 HOH 17 317 22 HOH HOH A . L 7 HOH 18 318 39 HOH HOH A . L 7 HOH 19 319 71 HOH HOH A . L 7 HOH 20 320 86 HOH HOH A . L 7 HOH 21 321 163 HOH HOH A . L 7 HOH 22 322 75 HOH HOH A . L 7 HOH 23 323 12 HOH HOH A . L 7 HOH 24 324 185 HOH HOH A . L 7 HOH 25 325 319 HOH HOH A . L 7 HOH 26 326 56 HOH HOH A . L 7 HOH 27 327 170 HOH HOH A . L 7 HOH 28 328 27 HOH HOH A . L 7 HOH 29 329 61 HOH HOH A . L 7 HOH 30 330 255 HOH HOH A . L 7 HOH 31 331 68 HOH HOH A . L 7 HOH 32 332 207 HOH HOH A . L 7 HOH 33 333 88 HOH HOH A . L 7 HOH 34 334 204 HOH HOH A . L 7 HOH 35 335 107 HOH HOH A . L 7 HOH 36 336 4 HOH HOH A . L 7 HOH 37 337 135 HOH HOH A . L 7 HOH 38 338 128 HOH HOH A . L 7 HOH 39 339 52 HOH HOH A . L 7 HOH 40 340 252 HOH HOH A . L 7 HOH 41 341 283 HOH HOH A . L 7 HOH 42 342 143 HOH HOH A . L 7 HOH 43 343 100 HOH HOH A . L 7 HOH 44 344 192 HOH HOH A . L 7 HOH 45 345 19 HOH HOH A . L 7 HOH 46 346 74 HOH HOH A . L 7 HOH 47 347 20 HOH HOH A . L 7 HOH 48 348 65 HOH HOH A . L 7 HOH 49 349 108 HOH HOH A . L 7 HOH 50 350 268 HOH HOH A . L 7 HOH 51 351 110 HOH HOH A . L 7 HOH 52 352 121 HOH HOH A . L 7 HOH 53 353 191 HOH HOH A . L 7 HOH 54 354 13 HOH HOH A . L 7 HOH 55 355 41 HOH HOH A . L 7 HOH 56 356 142 HOH HOH A . L 7 HOH 57 357 53 HOH HOH A . L 7 HOH 58 358 127 HOH HOH A . L 7 HOH 59 359 260 HOH HOH A . L 7 HOH 60 360 130 HOH HOH A . L 7 HOH 61 361 269 HOH HOH A . L 7 HOH 62 362 183 HOH HOH A . L 7 HOH 63 363 55 HOH HOH A . L 7 HOH 64 364 57 HOH HOH A . L 7 HOH 65 365 89 HOH HOH A . L 7 HOH 66 366 106 HOH HOH A . L 7 HOH 67 367 307 HOH HOH A . L 7 HOH 68 368 94 HOH HOH A . L 7 HOH 69 369 250 HOH HOH A . L 7 HOH 70 370 49 HOH HOH A . L 7 HOH 71 371 85 HOH HOH A . L 7 HOH 72 372 155 HOH HOH A . L 7 HOH 73 373 1 HOH HOH A . L 7 HOH 74 374 243 HOH HOH A . L 7 HOH 75 375 113 HOH HOH A . L 7 HOH 76 376 78 HOH HOH A . L 7 HOH 77 377 180 HOH HOH A . L 7 HOH 78 378 262 HOH HOH A . L 7 HOH 79 379 30 HOH HOH A . L 7 HOH 80 380 59 HOH HOH A . L 7 HOH 81 381 261 HOH HOH A . L 7 HOH 82 382 123 HOH HOH A . L 7 HOH 83 383 306 HOH HOH A . L 7 HOH 84 384 245 HOH HOH A . L 7 HOH 85 385 60 HOH HOH A . L 7 HOH 86 386 32 HOH HOH A . L 7 HOH 87 387 265 HOH HOH A . L 7 HOH 88 388 38 HOH HOH A . L 7 HOH 89 389 174 HOH HOH A . L 7 HOH 90 390 153 HOH HOH A . L 7 HOH 91 391 251 HOH HOH A . L 7 HOH 92 392 9 HOH HOH A . L 7 HOH 93 393 293 HOH HOH A . L 7 HOH 94 394 129 HOH HOH A . L 7 HOH 95 395 226 HOH HOH A . L 7 HOH 96 396 291 HOH HOH A . L 7 HOH 97 397 188 HOH HOH A . L 7 HOH 98 398 275 HOH HOH A . L 7 HOH 99 399 225 HOH HOH A . L 7 HOH 100 400 162 HOH HOH A . L 7 HOH 101 401 144 HOH HOH A . L 7 HOH 102 402 98 HOH HOH A . L 7 HOH 103 403 118 HOH HOH A . L 7 HOH 104 404 125 HOH HOH A . L 7 HOH 105 405 103 HOH HOH A . L 7 HOH 106 406 167 HOH HOH A . L 7 HOH 107 407 146 HOH HOH A . L 7 HOH 108 408 203 HOH HOH A . L 7 HOH 109 409 212 HOH HOH A . L 7 HOH 110 410 263 HOH HOH A . L 7 HOH 111 411 124 HOH HOH A . L 7 HOH 112 412 295 HOH HOH A . M 7 HOH 1 301 230 HOH HOH B . M 7 HOH 2 302 231 HOH HOH B . M 7 HOH 3 303 54 HOH HOH B . M 7 HOH 4 304 298 HOH HOH B . M 7 HOH 5 305 197 HOH HOH B . M 7 HOH 6 306 208 HOH HOH B . M 7 HOH 7 307 28 HOH HOH B . M 7 HOH 8 308 87 HOH HOH B . M 7 HOH 9 309 217 HOH HOH B . M 7 HOH 10 310 181 HOH HOH B . M 7 HOH 11 311 296 HOH HOH B . M 7 HOH 12 312 36 HOH HOH B . M 7 HOH 13 313 122 HOH HOH B . M 7 HOH 14 314 80 HOH HOH B . M 7 HOH 15 315 62 HOH HOH B . M 7 HOH 16 316 84 HOH HOH B . M 7 HOH 17 317 97 HOH HOH B . M 7 HOH 18 318 214 HOH HOH B . M 7 HOH 19 319 176 HOH HOH B . M 7 HOH 20 320 42 HOH HOH B . M 7 HOH 21 321 48 HOH HOH B . M 7 HOH 22 322 202 HOH HOH B . M 7 HOH 23 323 70 HOH HOH B . M 7 HOH 24 324 116 HOH HOH B . M 7 HOH 25 325 284 HOH HOH B . M 7 HOH 26 326 58 HOH HOH B . M 7 HOH 27 327 286 HOH HOH B . M 7 HOH 28 328 6 HOH HOH B . M 7 HOH 29 329 237 HOH HOH B . M 7 HOH 30 330 177 HOH HOH B . M 7 HOH 31 331 154 HOH HOH B . M 7 HOH 32 332 90 HOH HOH B . M 7 HOH 33 333 253 HOH HOH B . M 7 HOH 34 334 67 HOH HOH B . M 7 HOH 35 335 34 HOH HOH B . M 7 HOH 36 336 33 HOH HOH B . M 7 HOH 37 337 96 HOH HOH B . M 7 HOH 38 338 134 HOH HOH B . M 7 HOH 39 339 117 HOH HOH B . M 7 HOH 40 340 285 HOH HOH B . M 7 HOH 41 341 120 HOH HOH B . M 7 HOH 42 342 173 HOH HOH B . M 7 HOH 43 343 93 HOH HOH B . M 7 HOH 44 344 11 HOH HOH B . M 7 HOH 45 345 254 HOH HOH B . M 7 HOH 46 346 112 HOH HOH B . M 7 HOH 47 347 137 HOH HOH B . M 7 HOH 48 348 236 HOH HOH B . M 7 HOH 49 349 45 HOH HOH B . M 7 HOH 50 350 101 HOH HOH B . M 7 HOH 51 351 15 HOH HOH B . M 7 HOH 52 352 111 HOH HOH B . M 7 HOH 53 353 21 HOH HOH B . M 7 HOH 54 354 8 HOH HOH B . M 7 HOH 55 355 73 HOH HOH B . M 7 HOH 56 356 18 HOH HOH B . M 7 HOH 57 357 211 HOH HOH B . M 7 HOH 58 358 156 HOH HOH B . M 7 HOH 59 359 64 HOH HOH B . M 7 HOH 60 360 209 HOH HOH B . M 7 HOH 61 361 136 HOH HOH B . M 7 HOH 62 362 200 HOH HOH B . M 7 HOH 63 363 175 HOH HOH B . M 7 HOH 64 364 104 HOH HOH B . M 7 HOH 65 365 205 HOH HOH B . M 7 HOH 66 366 172 HOH HOH B . M 7 HOH 67 367 201 HOH HOH B . M 7 HOH 68 368 190 HOH HOH B . M 7 HOH 69 369 171 HOH HOH B . M 7 HOH 70 370 196 HOH HOH B . M 7 HOH 71 371 216 HOH HOH B . M 7 HOH 72 372 5 HOH HOH B . M 7 HOH 73 373 222 HOH HOH B . M 7 HOH 74 374 95 HOH HOH B . M 7 HOH 75 375 210 HOH HOH B . M 7 HOH 76 376 132 HOH HOH B . M 7 HOH 77 377 46 HOH HOH B . M 7 HOH 78 378 318 HOH HOH B . M 7 HOH 79 379 270 HOH HOH B . M 7 HOH 80 380 50 HOH HOH B . M 7 HOH 81 381 178 HOH HOH B . M 7 HOH 82 382 186 HOH HOH B . M 7 HOH 83 383 16 HOH HOH B . M 7 HOH 84 384 213 HOH HOH B . M 7 HOH 85 385 47 HOH HOH B . M 7 HOH 86 386 233 HOH HOH B . M 7 HOH 87 387 221 HOH HOH B . M 7 HOH 88 388 273 HOH HOH B . M 7 HOH 89 389 109 HOH HOH B . M 7 HOH 90 390 297 HOH HOH B . M 7 HOH 91 391 206 HOH HOH B . M 7 HOH 92 392 165 HOH HOH B . M 7 HOH 93 393 274 HOH HOH B . M 7 HOH 94 394 277 HOH HOH B . M 7 HOH 95 395 239 HOH HOH B . M 7 HOH 96 396 99 HOH HOH B . M 7 HOH 97 397 238 HOH HOH B . M 7 HOH 98 398 317 HOH HOH B . M 7 HOH 99 399 115 HOH HOH B . M 7 HOH 100 400 133 HOH HOH B . M 7 HOH 101 401 184 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ILE 16 ? CG1 ? A ILE 8 CG1 2 1 Y 1 A ILE 16 ? CG2 ? A ILE 8 CG2 3 1 Y 1 A ILE 16 ? CD1 ? A ILE 8 CD1 4 1 Y 1 A ASP 17 ? CG ? A ASP 9 CG 5 1 Y 1 A ASP 17 ? OD1 ? A ASP 9 OD1 6 1 Y 1 A ASP 17 ? OD2 ? A ASP 9 OD2 7 1 Y 1 A ILE 19 ? CG1 ? A ILE 11 CG1 8 1 Y 1 A ILE 19 ? CG2 ? A ILE 11 CG2 9 1 Y 1 A ILE 19 ? CD1 ? A ILE 11 CD1 10 1 Y 1 A SER 21 ? OG ? A SER 13 OG 11 1 Y 1 A ASN 29 ? CG ? A ASN 21 CG 12 1 Y 1 A ASN 29 ? OD1 ? A ASN 21 OD1 13 1 Y 1 A ASN 29 ? ND2 ? A ASN 21 ND2 14 1 Y 1 A MET 35 ? SD ? A MET 27 SD 15 1 Y 1 A MET 35 ? CE ? A MET 27 CE 16 1 Y 1 A LYS 49 ? CE ? A LYS 41 CE 17 1 Y 1 A LYS 49 ? NZ ? A LYS 41 NZ 18 1 Y 1 A GLU 53 ? CD ? A GLU 45 CD 19 1 Y 1 A GLU 53 ? OE1 ? A GLU 45 OE1 20 1 Y 1 A GLU 53 ? OE2 ? A GLU 45 OE2 21 1 Y 1 A PHE 67 ? CG ? A PHE 59 CG 22 1 Y 1 A PHE 67 ? CD1 ? A PHE 59 CD1 23 1 Y 1 A PHE 67 ? CD2 ? A PHE 59 CD2 24 1 Y 1 A PHE 67 ? CE1 ? A PHE 59 CE1 25 1 Y 1 A PHE 67 ? CE2 ? A PHE 59 CE2 26 1 Y 1 A PHE 67 ? CZ ? A PHE 59 CZ 27 1 Y 1 A TYR 68 ? CG ? A TYR 60 CG 28 1 Y 1 A TYR 68 ? CD1 ? A TYR 60 CD1 29 1 Y 1 A TYR 68 ? CD2 ? A TYR 60 CD2 30 1 Y 1 A TYR 68 ? CE1 ? A TYR 60 CE1 31 1 Y 1 A TYR 68 ? CE2 ? A TYR 60 CE2 32 1 Y 1 A TYR 68 ? CZ ? A TYR 60 CZ 33 1 Y 1 A TYR 68 ? OH ? A TYR 60 OH 34 1 Y 1 A GLN 88 ? CD ? A GLN 80 CD 35 1 Y 1 A GLN 88 ? OE1 ? A GLN 80 OE1 36 1 Y 1 A GLN 88 ? NE2 ? A GLN 80 NE2 37 1 Y 1 A LYS 118 ? CE ? A LYS 110 CE 38 1 Y 1 A LYS 118 ? NZ ? A LYS 110 NZ 39 1 Y 1 A GLU 125 ? CG ? A GLU 117 CG 40 1 Y 1 A GLU 125 ? CD ? A GLU 117 CD 41 1 Y 1 A GLU 125 ? OE1 ? A GLU 117 OE1 42 1 Y 1 A GLU 125 ? OE2 ? A GLU 117 OE2 43 1 Y 1 A GLN 132 ? CD ? A GLN 124 CD 44 1 Y 1 A GLN 132 ? OE1 ? A GLN 124 OE1 45 1 Y 1 A GLN 132 ? NE2 ? A GLN 124 NE2 46 1 Y 1 A LYS 138 ? CE ? A LYS 130 CE 47 1 Y 1 A LYS 138 ? NZ ? A LYS 130 NZ 48 1 Y 1 B SER 21 ? OG ? B SER 13 OG 49 1 Y 1 B LEU 25 ? CG ? B LEU 17 CG 50 1 Y 1 B LEU 25 ? CD1 ? B LEU 17 CD1 51 1 Y 1 B LEU 25 ? CD2 ? B LEU 17 CD2 52 1 Y 1 B ILE 28 ? CG1 ? B ILE 20 CG1 53 1 Y 1 B ILE 28 ? CG2 ? B ILE 20 CG2 54 1 Y 1 B ILE 28 ? CD1 ? B ILE 20 CD1 55 1 Y 1 B ASN 29 ? CG ? B ASN 21 CG 56 1 Y 1 B ASN 29 ? OD1 ? B ASN 21 OD1 57 1 Y 1 B ASN 29 ? ND2 ? B ASN 21 ND2 58 1 Y 1 B ASP 34 ? CG ? B ASP 26 CG 59 1 Y 1 B ASP 34 ? OD1 ? B ASP 26 OD1 60 1 Y 1 B ASP 34 ? OD2 ? B ASP 26 OD2 61 1 Y 1 B MET 35 ? CG ? B MET 27 CG 62 1 Y 1 B MET 35 ? SD ? B MET 27 SD 63 1 Y 1 B MET 35 ? CE ? B MET 27 CE 64 1 Y 1 B LYS 49 ? CE ? B LYS 41 CE 65 1 Y 1 B LYS 49 ? NZ ? B LYS 41 NZ 66 1 Y 1 B GLU 53 ? CD ? B GLU 45 CD 67 1 Y 1 B GLU 53 ? OE1 ? B GLU 45 OE1 68 1 Y 1 B GLU 53 ? OE2 ? B GLU 45 OE2 69 1 Y 1 B LYS 101 ? NZ ? B LYS 93 NZ 70 1 Y 1 B LYS 118 ? CD ? B LYS 110 CD 71 1 Y 1 B LYS 118 ? CE ? B LYS 110 CE 72 1 Y 1 B LYS 118 ? NZ ? B LYS 110 NZ 73 1 Y 1 B LEU 121 ? CG ? B LEU 113 CG 74 1 Y 1 B LEU 121 ? CD1 ? B LEU 113 CD1 75 1 Y 1 B LEU 121 ? CD2 ? B LEU 113 CD2 76 1 Y 1 B LYS 124 ? CE ? B LYS 116 CE 77 1 Y 1 B LYS 124 ? NZ ? B LYS 116 NZ 78 1 Y 1 B GLU 125 ? CD ? B GLU 117 CD 79 1 Y 1 B GLU 125 ? OE1 ? B GLU 117 OE1 80 1 Y 1 B GLU 125 ? OE2 ? B GLU 117 OE2 81 1 Y 1 B LYS 138 ? CE ? B LYS 130 CE 82 1 Y 1 B LYS 138 ? NZ ? B LYS 130 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 1.2 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 1.2 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 7.0.047 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.8.9 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7P42 _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.629 _cell.length_a_esd ? _cell.length_b 57.629 _cell.length_b_esd ? _cell.length_c 159.246 _cell.length_c_esd ? _cell.volume 458016.719 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7P42 _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ;P 32 2" ; _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7P42 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.39 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.64 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details '25 Grad' _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;30 % PEG 4000, 0.1 M TRIS pH 8.0, 0.3 M magnesium chloride ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-05-29 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 19.69 _reflns.entry_id 7P42 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.50 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 50346 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.055 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.39 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.50 _reflns_shell.d_res_low 1.58 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.76 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 7774 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value 0.795 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.911 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 27.29 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7P42 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.50 _refine.ls_d_res_low 31.12 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 49972 _refine.ls_number_reflns_R_free 2498 _refine.ls_number_reflns_R_work 47474 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.27 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1979 _refine.ls_R_factor_R_free 0.2186 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1967 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6scb _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.0458 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1437 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.50 _refine_hist.d_res_low 31.12 _refine_hist.number_atoms_solvent 213 _refine_hist.number_atoms_total 2417 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2163 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 41 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0057 ? 2390 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7797 ? 3259 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0742 ? 352 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0054 ? 444 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 19.9239 ? 861 ? f_dihedral_angle_d ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.50 _refine_ls_shell.d_res_low 1.53 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 129 _refine_ls_shell.number_reflns_R_work 2434 _refine_ls_shell.percent_reflns_obs 92.80 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3048 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2853 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # loop_ _struct_ncs_dom.id _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.details 1 1 ? 2 1 ? # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 2 A ILE 8 . A TYR 32 . A ILE 16 A TYR 40 ? ;(chain 'A' and (resid 16 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 33 or (resid 34 through 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE )) or resid 102 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 125 through 130 or resid 132 through 144 or resid 146 through 149)) ; 1 1 3 A TYR 34 . A TYR 34 . A TYR 42 A TYR 42 ? ;(chain 'A' and (resid 16 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 33 or (resid 34 through 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE )) or resid 102 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 125 through 130 or resid 132 through 144 or resid 146 through 149)) ; 1 1 4 A ASP 37 . A ASN 40 . A ASP 45 A ASN 48 ? ;(chain 'A' and (resid 16 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 33 or (resid 34 through 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE )) or resid 102 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 125 through 130 or resid 132 through 144 or resid 146 through 149)) ; 1 1 5 A GLY 42 . A PHE 51 . A GLY 50 A PHE 59 ? ;(chain 'A' and (resid 16 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 33 or (resid 34 through 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE )) or resid 102 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 125 through 130 or resid 132 through 144 or resid 146 through 149)) ; 1 1 6 A PHE 53 . A ASN 61 . A PHE 61 A ASN 69 ? ;(chain 'A' and (resid 16 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 33 or (resid 34 through 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE )) or resid 102 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 125 through 130 or resid 132 through 144 or resid 146 through 149)) ; 1 1 7 A ASP 63 . A TYR 64 . A ASP 71 A TYR 72 ? ;(chain 'A' and (resid 16 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 33 or (resid 34 through 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE )) or resid 102 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 125 through 130 or resid 132 through 144 or resid 146 through 149)) ; 1 1 8 A MET 66 . A ALA 69 . A MET 74 A ALA 77 ? ;(chain 'A' and (resid 16 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 33 or (resid 34 through 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE )) or resid 102 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 125 through 130 or resid 132 through 144 or resid 146 through 149)) ; 1 1 9 A TYR 72 . A VAL 122 . A TYR 80 A VAL 130 ? ;(chain 'A' and (resid 16 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 33 or (resid 34 through 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE )) or resid 102 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 125 through 130 or resid 132 through 144 or resid 146 through 149)) ; 1 1 10 A GLN 124 . A GLN 136 . A GLN 132 A GLN 144 ? ;(chain 'A' and (resid 16 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 33 or (resid 34 through 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE )) or resid 102 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 125 through 130 or resid 132 through 144 or resid 146 through 149)) ; 1 1 11 A TYR 138 . A ASP 140 . A TYR 146 A ASP 148 ? ;(chain 'A' and (resid 16 through 24 or (resid 25 and (name N or name CA or name C or name O or name CB )) or resid 26 through 27 or (resid 28 through 30 and (name N or name CA or name C or name O or name CB )) or resid 31 through 33 or (resid 34 through 35 and (name N or name CA or name C or name O or name CB )) or resid 36 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 100 or (resid 101 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE )) or resid 102 through 117 or (resid 118 and (name N or name CA or name C or name O or name CB or name CG )) or resid 119 through 120 or (resid 121 and (name N or name CA or name C or name O or name CB )) or resid 122 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 125 through 130 or resid 132 through 144 or resid 146 through 149)) ; 1 2 12 B ILE 8 . B TYR 32 . B ILE 16 B TYR 40 ? ;(chain 'B' and ((resid 16 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 66 or (resid 67 through 68 and (name N or name CA or name C or name O or name CB )) or resid 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 130 or (resid 132 and (name N or name CA or name C or name O or name CB or name CG )) or resid 133 through 144 or resid 146 through 149)) ; 1 2 13 B TYR 34 . B TYR 34 . B TYR 42 B TYR 42 ? ;(chain 'B' and ((resid 16 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 66 or (resid 67 through 68 and (name N or name CA or name C or name O or name CB )) or resid 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 130 or (resid 132 and (name N or name CA or name C or name O or name CB or name CG )) or resid 133 through 144 or resid 146 through 149)) ; 1 2 14 B ASP 37 . B ASN 40 . B ASP 45 B ASN 48 ? ;(chain 'B' and ((resid 16 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 66 or (resid 67 through 68 and (name N or name CA or name C or name O or name CB )) or resid 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 130 or (resid 132 and (name N or name CA or name C or name O or name CB or name CG )) or resid 133 through 144 or resid 146 through 149)) ; 1 2 15 B GLY 42 . B PHE 51 . B GLY 50 B PHE 59 ? ;(chain 'B' and ((resid 16 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 66 or (resid 67 through 68 and (name N or name CA or name C or name O or name CB )) or resid 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 130 or (resid 132 and (name N or name CA or name C or name O or name CB or name CG )) or resid 133 through 144 or resid 146 through 149)) ; 1 2 16 B PHE 53 . B ASN 61 . B PHE 61 B ASN 69 ? ;(chain 'B' and ((resid 16 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 66 or (resid 67 through 68 and (name N or name CA or name C or name O or name CB )) or resid 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 130 or (resid 132 and (name N or name CA or name C or name O or name CB or name CG )) or resid 133 through 144 or resid 146 through 149)) ; 1 2 17 B ASP 63 . B TYR 64 . B ASP 71 B TYR 72 ? ;(chain 'B' and ((resid 16 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 66 or (resid 67 through 68 and (name N or name CA or name C or name O or name CB )) or resid 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 130 or (resid 132 and (name N or name CA or name C or name O or name CB or name CG )) or resid 133 through 144 or resid 146 through 149)) ; 1 2 18 B MET 66 . B ALA 69 . B MET 74 B ALA 77 ? ;(chain 'B' and ((resid 16 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 66 or (resid 67 through 68 and (name N or name CA or name C or name O or name CB )) or resid 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 130 or (resid 132 and (name N or name CA or name C or name O or name CB or name CG )) or resid 133 through 144 or resid 146 through 149)) ; 1 2 19 B TYR 72 . B VAL 122 . B TYR 80 B VAL 130 ? ;(chain 'B' and ((resid 16 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 66 or (resid 67 through 68 and (name N or name CA or name C or name O or name CB )) or resid 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 130 or (resid 132 and (name N or name CA or name C or name O or name CB or name CG )) or resid 133 through 144 or resid 146 through 149)) ; 1 2 20 B GLN 124 . B GLN 136 . B GLN 132 B GLN 144 ? ;(chain 'B' and ((resid 16 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 66 or (resid 67 through 68 and (name N or name CA or name C or name O or name CB )) or resid 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 130 or (resid 132 and (name N or name CA or name C or name O or name CB or name CG )) or resid 133 through 144 or resid 146 through 149)) ; 1 2 21 B TYR 138 . B ASP 140 . B TYR 146 B ASP 148 ? ;(chain 'B' and ((resid 16 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 40 or resid 42 through 43 or resid 45 through 48 or resid 50 through 59 or resid 61 through 66 or (resid 67 through 68 and (name N or name CA or name C or name O or name CB )) or resid 69 or resid 71 through 72 or resid 74 through 78 or resid 80 through 87 or (resid 88 and (name N or name CA or name C or name O or name CB or name CG )) or resid 89 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 130 or (resid 132 and (name N or name CA or name C or name O or name CB or name CG )) or resid 133 through 144 or resid 146 through 149)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7P42 _struct.title 'Crystal structure of IpgC in complex with a follow-up compound based on J2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7P42 _struct_keywords.text 'IpgC, Chaperone, Shigella, Follow-up compound' _struct_keywords.pdbx_keywords CHAPERONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? G N N 2 ? H N N 3 ? I N N 3 ? J N N 6 ? K N N 5 ? L N N 7 ? M N N 7 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IPGC_SHIFL _struct_ref.pdbx_db_accession P0A2U4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQA ADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQ ; _struct_ref.pdbx_align_begin 10 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7P42 A 2 ? 143 ? P0A2U4 10 ? 151 ? 10 151 2 1 7P42 B 2 ? 143 ? P0A2U4 10 ? 151 ? 10 151 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7P42 GLY A 1 ? UNP P0A2U4 ? ? 'expression tag' 9 1 2 7P42 GLY B 1 ? UNP P0A2U4 ? ? 'expression tag' 9 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3260 ? 1 MORE -47 ? 1 'SSA (A^2)' 14110 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 8 ? GLY A 14 ? ILE A 16 GLY A 22 1 ? 7 HELX_P HELX_P2 AA2 PRO A 24 ? LYS A 41 ? PRO A 32 LYS A 49 1 ? 18 HELX_P HELX_P3 AA3 ARG A 43 ? ASP A 58 ? ARG A 51 ASP A 66 1 ? 16 HELX_P HELX_P4 AA4 ASN A 61 ? LYS A 75 ? ASN A 69 LYS A 83 1 ? 15 HELX_P HELX_P5 AA5 GLN A 77 ? LYS A 93 ? GLN A 85 LYS A 101 1 ? 17 HELX_P HELX_P6 AA6 TYR A 96 ? LEU A 109 ? TYR A 104 LEU A 117 1 ? 14 HELX_P HELX_P7 AA7 ALA A 111 ? SER A 126 ? ALA A 119 SER A 134 1 ? 16 HELX_P HELX_P8 AA8 ASP A 128 ? ILE A 142 ? ASP A 136 ILE A 150 1 ? 15 HELX_P HELX_P9 AA9 SER B 2 ? SER B 13 ? SER B 10 SER B 21 1 ? 12 HELX_P HELX_P10 AB1 PRO B 24 ? LYS B 41 ? PRO B 32 LYS B 49 1 ? 18 HELX_P HELX_P11 AB2 ARG B 43 ? ASP B 58 ? ARG B 51 ASP B 66 1 ? 16 HELX_P HELX_P12 AB3 ASN B 61 ? LYS B 75 ? ASN B 69 LYS B 83 1 ? 15 HELX_P HELX_P13 AB4 GLN B 77 ? GLY B 92 ? GLN B 85 GLY B 100 1 ? 16 HELX_P HELX_P14 AB5 TYR B 96 ? LEU B 109 ? TYR B 104 LEU B 117 1 ? 14 HELX_P HELX_P15 AB6 ALA B 111 ? SER B 126 ? ALA B 119 SER B 134 1 ? 16 HELX_P HELX_P16 AB7 ASP B 128 ? ILE B 142 ? ASP B 136 ILE B 150 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? C MG . MG ? ? ? 1_555 L HOH . O ? ? A MG 201 A HOH 389 1_555 ? ? ? ? ? ? ? 2.067 ? ? metalc2 metalc ? ? C MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 201 B HOH 319 6_454 ? ? ? ? ? ? ? 2.238 ? ? metalc3 metalc ? ? C MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 201 B HOH 330 6_454 ? ? ? ? ? ? ? 2.102 ? ? metalc4 metalc ? ? C MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 201 B HOH 342 6_454 ? ? ? ? ? ? ? 1.941 ? ? metalc5 metalc ? ? C MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 201 B HOH 363 6_454 ? ? ? ? ? ? ? 2.070 ? ? metalc6 metalc ? ? C MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 201 B HOH 381 6_454 ? ? ? ? ? ? ? 1.977 ? ? metalc7 metalc ? ? L HOH . O ? ? ? 6_444 G MG . MG ? ? A HOH 312 B MG 201 1_555 ? ? ? ? ? ? ? 2.034 ? ? metalc8 metalc ? ? L HOH . O ? ? ? 6_444 G MG . MG ? ? A HOH 341 B MG 201 1_555 ? ? ? ? ? ? ? 2.043 ? ? metalc9 metalc ? ? B SER 33 OG A ? ? 1_555 G MG . MG ? ? B SER 41 B MG 201 1_555 ? ? ? ? ? ? ? 2.341 ? ? metalc10 metalc ? ? G MG . MG ? ? ? 1_555 M HOH . O ? ? B MG 201 B HOH 325 1_555 ? ? ? ? ? ? ? 2.173 ? ? metalc11 metalc ? ? G MG . MG ? ? ? 1_555 M HOH . O ? ? B MG 201 B HOH 327 1_555 ? ? ? ? ? ? ? 1.980 ? ? metalc12 metalc ? ? G MG . MG ? ? ? 1_555 M HOH . O ? ? B MG 201 B HOH 340 1_555 ? ? ? ? ? ? ? 2.043 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? L HOH . ? A HOH 389 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O ? M HOH . ? B HOH 319 ? 6_454 174.1 ? 2 O ? L HOH . ? A HOH 389 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O ? M HOH . ? B HOH 330 ? 6_454 96.6 ? 3 O ? M HOH . ? B HOH 319 ? 6_454 MG ? C MG . ? A MG 201 ? 1_555 O ? M HOH . ? B HOH 330 ? 6_454 87.9 ? 4 O ? L HOH . ? A HOH 389 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O ? M HOH . ? B HOH 342 ? 6_454 90.4 ? 5 O ? M HOH . ? B HOH 319 ? 6_454 MG ? C MG . ? A MG 201 ? 1_555 O ? M HOH . ? B HOH 342 ? 6_454 85.5 ? 6 O ? M HOH . ? B HOH 330 ? 6_454 MG ? C MG . ? A MG 201 ? 1_555 O ? M HOH . ? B HOH 342 ? 6_454 94.0 ? 7 O ? L HOH . ? A HOH 389 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O ? M HOH . ? B HOH 363 ? 6_454 97.0 ? 8 O ? M HOH . ? B HOH 319 ? 6_454 MG ? C MG . ? A MG 201 ? 1_555 O ? M HOH . ? B HOH 363 ? 6_454 87.3 ? 9 O ? M HOH . ? B HOH 330 ? 6_454 MG ? C MG . ? A MG 201 ? 1_555 O ? M HOH . ? B HOH 363 ? 6_454 83.8 ? 10 O ? M HOH . ? B HOH 342 ? 6_454 MG ? C MG . ? A MG 201 ? 1_555 O ? M HOH . ? B HOH 363 ? 6_454 172.6 ? 11 O ? L HOH . ? A HOH 389 ? 1_555 MG ? C MG . ? A MG 201 ? 1_555 O ? M HOH . ? B HOH 381 ? 6_454 86.7 ? 12 O ? M HOH . ? B HOH 319 ? 6_454 MG ? C MG . ? A MG 201 ? 1_555 O ? M HOH . ? B HOH 381 ? 6_454 89.1 ? 13 O ? M HOH . ? B HOH 330 ? 6_454 MG ? C MG . ? A MG 201 ? 1_555 O ? M HOH . ? B HOH 381 ? 6_454 173.0 ? 14 O ? M HOH . ? B HOH 342 ? 6_454 MG ? C MG . ? A MG 201 ? 1_555 O ? M HOH . ? B HOH 381 ? 6_454 92.1 ? 15 O ? M HOH . ? B HOH 363 ? 6_454 MG ? C MG . ? A MG 201 ? 1_555 O ? M HOH . ? B HOH 381 ? 6_454 89.7 ? 16 O ? L HOH . ? A HOH 312 ? 6_444 MG ? G MG . ? B MG 201 ? 1_555 O ? L HOH . ? A HOH 341 ? 6_444 91.2 ? 17 O ? L HOH . ? A HOH 312 ? 6_444 MG ? G MG . ? B MG 201 ? 1_555 OG A B SER 33 ? B SER 41 ? 1_555 177.0 ? 18 O ? L HOH . ? A HOH 341 ? 6_444 MG ? G MG . ? B MG 201 ? 1_555 OG A B SER 33 ? B SER 41 ? 1_555 88.9 ? 19 O ? L HOH . ? A HOH 312 ? 6_444 MG ? G MG . ? B MG 201 ? 1_555 O ? M HOH . ? B HOH 325 ? 1_555 92.2 ? 20 O ? L HOH . ? A HOH 341 ? 6_444 MG ? G MG . ? B MG 201 ? 1_555 O ? M HOH . ? B HOH 325 ? 1_555 155.9 ? 21 OG A B SER 33 ? B SER 41 ? 1_555 MG ? G MG . ? B MG 201 ? 1_555 O ? M HOH . ? B HOH 325 ? 1_555 86.6 ? 22 O ? L HOH . ? A HOH 312 ? 6_444 MG ? G MG . ? B MG 201 ? 1_555 O ? M HOH . ? B HOH 327 ? 1_555 106.7 ? 23 O ? L HOH . ? A HOH 341 ? 6_444 MG ? G MG . ? B MG 201 ? 1_555 O ? M HOH . ? B HOH 327 ? 1_555 103.4 ? 24 OG A B SER 33 ? B SER 41 ? 1_555 MG ? G MG . ? B MG 201 ? 1_555 O ? M HOH . ? B HOH 327 ? 1_555 76.2 ? 25 O ? M HOH . ? B HOH 325 ? 1_555 MG ? G MG . ? B MG 201 ? 1_555 O ? M HOH . ? B HOH 327 ? 1_555 98.5 ? 26 O ? L HOH . ? A HOH 312 ? 6_444 MG ? G MG . ? B MG 201 ? 1_555 O ? M HOH . ? B HOH 340 ? 1_555 89.9 ? 27 O ? L HOH . ? A HOH 341 ? 6_444 MG ? G MG . ? B MG 201 ? 1_555 O ? M HOH . ? B HOH 340 ? 1_555 78.3 ? 28 OG A B SER 33 ? B SER 41 ? 1_555 MG ? G MG . ? B MG 201 ? 1_555 O ? M HOH . ? B HOH 340 ? 1_555 87.2 ? 29 O ? M HOH . ? B HOH 325 ? 1_555 MG ? G MG . ? B MG 201 ? 1_555 O ? M HOH . ? B HOH 340 ? 1_555 77.8 ? 30 O ? M HOH . ? B HOH 327 ? 1_555 MG ? G MG . ? B MG 201 ? 1_555 O ? M HOH . ? B HOH 340 ? 1_555 163.3 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 101 ? ? 67.55 -52.90 2 1 SER B 21 ? ? 54.75 5.94 3 1 TYR B 68 ? ? -92.32 41.93 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+2/3 3 -x+y,-x,z+1/3 4 x-y,-y,-z+1/3 5 -x,-x+y,-z+2/3 6 y,x,-z # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -39.212 13.319 -2.142 0.232700809813 0.393133012204 0.39951236019 -0.0431108862897 0.0236321444517 -0.0150890834778 3.18666634299 5.44335373344 9.22515474886 0.673229008771 0.0913615334898 1.72144296571 0.053220460439 -0.268908632888 0.152280529362 0.152507137839 -0.842754701524 0.200566544311 -0.0238056096529 0.300542970403 -0.946487541908 'X-RAY DIFFRACTION' 2 ? refined -34.830 22.604 -6.030 0.340667264669 0.328770969401 0.267437684119 0.059034274563 -0.0144580357237 -0.0130805733858 5.34102720236 5.71852291232 3.06899267368 0.829157870389 3.21539804879 -1.96775932652 -0.0529209967993 0.19563450208 -0.0549449352185 0.067751534736 0.0132170603287 0.638731550171 -0.334472329311 -0.602908869035 -0.780870487733 'X-RAY DIFFRACTION' 3 ? refined -21.208 23.364 -8.312 0.259373169879 0.200081669833 0.158848391825 -0.0524691672355 0.00958261202869 0.000113240751193 6.14297756592 3.40349232827 8.93658811499 1.94487629443 6.59786490166 0.96554217229 -0.325808317461 0.0624316424076 0.223605394336 0.274244336994 0.490834776724 0.105482091489 -0.314393312749 -0.75501657463 0.147305887578 'X-RAY DIFFRACTION' 4 ? refined -26.052 13.640 -7.076 0.171524757461 0.121350746956 0.113410369393 -0.0274383708001 -0.000661773392016 -0.00555010421579 2.25233602881 1.54857280473 3.25700793014 -0.24400628489 -0.97674637571 0.497314730858 0.0201185649545 -0.0363736473475 0.0186346345968 -0.00295138685536 -0.018030489095 0.0228591858313 0.0162182877007 -0.00243693344953 0.0215431901563 'X-RAY DIFFRACTION' 5 ? refined -13.420 12.035 -9.141 0.183015196626 0.27793396346 0.170477258913 -0.0727681694317 -0.0291733354321 -0.0319528963423 6.30269530613 7.72561756654 3.72252300237 -1.04785274475 -3.78421295928 1.17943363391 0.100276475058 0.0578109262029 -0.104482040115 -0.984948703476 0.482777216259 -0.299315844974 0.277150651175 -0.465901594623 0.699726441591 'X-RAY DIFFRACTION' 6 ? refined -13.700 4.889 -11.557 0.201971962058 0.203245769828 0.255161132964 -0.060339072852 -0.031437168559 -0.00379412823075 5.6408594266 4.00749469577 7.81172395158 2.55781654651 -4.58742719833 -2.63993362846 -0.180687818936 0.041098932572 0.172946588736 -0.258141077237 -0.71204984055 -0.808649542216 -0.0596466848826 -0.281450437861 0.51103821593 'X-RAY DIFFRACTION' 7 ? refined -18.777 5.487 -19.409 0.215929931098 0.128076467349 0.164269677397 -0.0283339485525 0.011981281151 -0.00768135042064 6.49765729026 0.843146377506 1.10795686847 0.800420921907 -0.495535809355 -0.328793158834 -0.0377344459244 0.00168823135394 0.036415583881 -0.0114863493656 -0.174179122171 -0.040341867805 -0.0507178231077 -0.00961829993334 0.00565843222171 'X-RAY DIFFRACTION' 8 ? refined -17.958 3.427 -28.849 0.239696374338 0.174126181192 0.179324221108 -0.0534316306125 0.0507051904309 -0.0257393315147 7.87745015131 4.01420779986 8.06602094456 -3.1908093485 6.92446007198 -2.55797669485 0.190759074492 -0.033249096178 -0.129199788505 0.348742862474 -0.337548423774 0.000767435524832 -0.388650297631 0.618789721114 0.0875910886718 'X-RAY DIFFRACTION' 9 ? refined -14.587 10.642 -30.908 0.220552190067 0.261427899918 0.206010924719 -0.0807636451276 0.0486330631451 0.0181113055923 8.40720729534 7.42714097148 2.28416957593 -6.60169592202 2.97097822857 -1.86463640829 0.285277639977 -0.285550427556 0.0124208649359 0.574538047545 0.197707325705 -0.493592482973 -0.355116767291 -0.0871714358386 0.223285972954 'X-RAY DIFFRACTION' 10 ? refined -26.225 1.826 -4.428 0.305021255545 0.185972902498 0.185205130042 -0.030365681247 0.0108068843402 0.0398683084598 7.30383651962 9.79512439405 6.62588015911 5.87489119453 1.58134356302 4.64178178543 0.47288896433 -0.414509628257 -0.0767232857741 -0.433020022704 -0.0971838088614 -0.260276335474 0.521212807308 0.206307250928 -0.0180279836644 'X-RAY DIFFRACTION' 11 ? refined -15.390 -13.769 -3.099 0.391320459176 0.794678206423 0.658321042652 -0.0826029332067 -0.136671303344 0.092223516053 3.24771900039 8.15296564144 4.13918680253 4.75433098077 0.885646913929 3.43420196972 -0.733150833623 -1.05409748873 1.56595238023 0.502829317394 1.28290678301 -0.28539866038 -0.171779510762 -0.551310295557 -0.755872898924 'X-RAY DIFFRACTION' 12 ? refined -29.796 -21.352 -9.947 0.306260980272 0.191692817443 0.139675090727 0.0147215087004 0.0421353816086 -0.0116267040752 9.8154275179 2.24379311131 4.76186661431 2.49536199331 1.05864691784 -0.112519935892 -0.12981362746 0.0672110553211 0.0470210693391 0.0968219146763 -0.454055368306 -0.132937719972 -0.282074071138 0.360020985224 0.0376262440084 'X-RAY DIFFRACTION' 13 ? refined -29.376 -11.188 -6.687 0.213111608809 0.149516116522 0.141336108955 0.0167535452298 0.0159600440457 0.00631760076628 5.33965452069 4.61750554366 5.88933601968 3.46294221355 0.0384131410924 -0.28603644309 0.0881992798243 0.00948665751047 -0.093873148614 -0.017341990499 0.021501957002 -0.117393416255 0.134821843136 -0.0224861989591 0.0563375346588 'X-RAY DIFFRACTION' 14 ? refined -33.225 -7.242 -16.162 0.148200527035 0.139941223684 0.0992261435989 -0.0265251867806 0.00287401712231 -0.0121486214289 5.22087566437 4.69423910923 3.89958891356 -1.41792376909 1.40555706472 -1.70061914961 -0.0305260569775 0.0562355817155 -0.0069287880675 -0.169200889865 -0.0326838958693 0.153762358772 0.0786867158067 0.0916337744529 -0.150076096361 'X-RAY DIFFRACTION' 15 ? refined -22.257 -5.769 -24.639 0.279708003386 0.416838388719 0.290857401829 0.0229271434813 -0.0277378652348 -0.0300996369956 8.93827580022 9.11149758827 4.33930609957 5.4438283068 5.25627698564 5.8120869544 -0.156508469552 0.714781689955 -0.517987554596 0.0617369388977 -0.264861069686 -1.18625262043 -0.14063202165 0.502785700437 1.8551860562 'X-RAY DIFFRACTION' 16 ? refined -38.082 -2.558 -25.888 0.191687601023 0.133748653368 0.153937412885 -0.0117167003684 -0.0429372969105 -0.00763224066097 6.78832033655 3.55902816885 9.05708924972 -2.38215680448 -3.39203773326 -0.509117018557 -0.00595751260842 0.140257025774 -0.136084053679 -0.0464315097979 0.060063953988 0.328736278848 -0.135753435814 -0.146530117903 -0.460069628707 'X-RAY DIFFRACTION' 17 ? refined -31.324 -2.224 -34.338 0.299244795675 0.251367165238 0.197696843928 -0.0321070617356 -0.0282282999734 0.0205106644701 5.70395827215 5.89583241224 8.07000370605 -3.11975522903 -5.453426587 4.72535121654 0.0406125958083 0.141421172166 -0.128812261968 0.361075955577 0.571533652012 -0.179023805385 -0.412776641409 -0.590929126685 0.0931051406333 'X-RAY DIFFRACTION' 18 ? refined -37.003 -8.031 -35.655 0.252599720315 0.284304893369 0.207636712524 -0.0331204221403 -0.0289682261873 -0.0129995404471 6.46169782658 8.39271220992 6.16354299252 -5.55391372163 -5.1461982775 4.54787438018 0.186808824517 -0.379247183509 0.187349999632 0.357306593564 -0.311170154261 0.426134493769 -0.221339765395 0.293515910525 -0.470985643211 'X-RAY DIFFRACTION' 19 ? refined -38.226 3.137 3.478 0.756553981125 0.528429454194 1.00351128501 -0.131803142364 -0.246430824974 0.292586915395 3.1647154297 4.49778135688 4.16510845396 -2.45031701786 2.32586536187 -4.12064700283 -0.358763885719 0.232216389485 0.104738853913 0.096222235641 -0.0103765234805 0.838828444763 -1.14224147506 1.17413868826 0.0356358931477 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 24 A 32 '( CHAIN A AND RESID 24:32 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 33 A 39 '( CHAIN A AND RESID 33:39 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 40 A 53 '( CHAIN A AND RESID 40:53 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 54 A 78 '( CHAIN A AND RESID 54:78 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 79 A 85 '( CHAIN A AND RESID 79:85 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 86 A 89 '( CHAIN A AND RESID 86:89 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 90 A 121 '( CHAIN A AND RESID 90:121 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 A 122 A 134 '( CHAIN A AND RESID 122:134 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 9 9 A 135 A 151 '( CHAIN A AND RESID 135:151 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 10 10 B 9 B 21 '( CHAIN B AND RESID 9:21 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 11 11 B 28 B 33 '( CHAIN B AND RESID 28:33 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 12 12 B 34 B 51 '( CHAIN B AND RESID 34:51 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 13 13 B 52 B 68 '( CHAIN B AND RESID 52:68 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 14 14 B 69 B 98 '( CHAIN B AND RESID 69:98 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 15 15 B 99 B 103 '( CHAIN B AND RESID 99:103 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 16 16 B 104 B 124 '( CHAIN B AND RESID 104:124 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 17 17 B 125 B 134 '( CHAIN B AND RESID 125:134 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 18 18 B 135 B 150 '( CHAIN B AND RESID 135:150 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 19 19 A 16 A 23 '( CHAIN A AND RESID 16:23 )' ? ? ? ? ? # _pdbx_entry_details.entry_id 7P42 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 9 ? A GLY 1 2 1 Y 1 A SER 10 ? A SER 2 3 1 Y 1 A ILE 11 ? A ILE 3 4 1 Y 1 A SER 12 ? A SER 4 5 1 Y 1 A THR 13 ? A THR 5 6 1 Y 1 A ALA 14 ? A ALA 6 7 1 Y 1 A VAL 15 ? A VAL 7 8 1 Y 1 B GLN 151 ? B GLN 143 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 5I8 N N Y N 1 5I8 C C N N 2 5I8 C1 C Y N 3 5I8 C10 C Y N 4 5I8 C11 C Y N 5 5I8 C12 C Y N 6 5I8 C13 C N N 7 5I8 C2 C Y N 8 5I8 C3 C Y N 9 5I8 C4 C N N 10 5I8 C5 C Y N 11 5I8 C6 C N N 12 5I8 C7 C Y N 13 5I8 C8 C Y N 14 5I8 C9 C Y N 15 5I8 N1 N Y N 16 5I8 N2 N N N 17 5I8 N3 N N N 18 5I8 H1 H N N 19 5I8 H2 H N N 20 5I8 H3 H N N 21 5I8 H4 H N N 22 5I8 H5 H N N 23 5I8 H6 H N N 24 5I8 H7 H N N 25 5I8 H8 H N N 26 5I8 H9 H N N 27 5I8 H10 H N N 28 5I8 H11 H N N 29 5I8 H12 H N N 30 5I8 H13 H N N 31 5I8 H14 H N N 32 ALA N N N N 33 ALA CA C N S 34 ALA C C N N 35 ALA O O N N 36 ALA CB C N N 37 ALA OXT O N N 38 ALA H H N N 39 ALA H2 H N N 40 ALA HA H N N 41 ALA HB1 H N N 42 ALA HB2 H N N 43 ALA HB3 H N N 44 ALA HXT H N N 45 ARG N N N N 46 ARG CA C N S 47 ARG C C N N 48 ARG O O N N 49 ARG CB C N N 50 ARG CG C N N 51 ARG CD C N N 52 ARG NE N N N 53 ARG CZ C N N 54 ARG NH1 N N N 55 ARG NH2 N N N 56 ARG OXT O N N 57 ARG H H N N 58 ARG H2 H N N 59 ARG HA H N N 60 ARG HB2 H N N 61 ARG HB3 H N N 62 ARG HG2 H N N 63 ARG HG3 H N N 64 ARG HD2 H N N 65 ARG HD3 H N N 66 ARG HE H N N 67 ARG HH11 H N N 68 ARG HH12 H N N 69 ARG HH21 H N N 70 ARG HH22 H N N 71 ARG HXT H N N 72 ASN N N N N 73 ASN CA C N S 74 ASN C C N N 75 ASN O O N N 76 ASN CB C N N 77 ASN CG C N N 78 ASN OD1 O N N 79 ASN ND2 N N N 80 ASN OXT O N N 81 ASN H H N N 82 ASN H2 H N N 83 ASN HA H N N 84 ASN HB2 H N N 85 ASN HB3 H N N 86 ASN HD21 H N N 87 ASN HD22 H N N 88 ASN HXT H N N 89 ASP N N N N 90 ASP CA C N S 91 ASP C C N N 92 ASP O O N N 93 ASP CB C N N 94 ASP CG C N N 95 ASP OD1 O N N 96 ASP OD2 O N N 97 ASP OXT O N N 98 ASP H H N N 99 ASP H2 H N N 100 ASP HA H N N 101 ASP HB2 H N N 102 ASP HB3 H N N 103 ASP HD2 H N N 104 ASP HXT H N N 105 CL CL CL N N 106 CYS N N N N 107 CYS CA C N R 108 CYS C C N N 109 CYS O O N N 110 CYS CB C N N 111 CYS SG S N N 112 CYS OXT O N N 113 CYS H H N N 114 CYS H2 H N N 115 CYS HA H N N 116 CYS HB2 H N N 117 CYS HB3 H N N 118 CYS HG H N N 119 CYS HXT H N N 120 DMS S S N N 121 DMS O O N N 122 DMS C1 C N N 123 DMS C2 C N N 124 DMS H11 H N N 125 DMS H12 H N N 126 DMS H13 H N N 127 DMS H21 H N N 128 DMS H22 H N N 129 DMS H23 H N N 130 GLN N N N N 131 GLN CA C N S 132 GLN C C N N 133 GLN O O N N 134 GLN CB C N N 135 GLN CG C N N 136 GLN CD C N N 137 GLN OE1 O N N 138 GLN NE2 N N N 139 GLN OXT O N N 140 GLN H H N N 141 GLN H2 H N N 142 GLN HA H N N 143 GLN HB2 H N N 144 GLN HB3 H N N 145 GLN HG2 H N N 146 GLN HG3 H N N 147 GLN HE21 H N N 148 GLN HE22 H N N 149 GLN HXT H N N 150 GLU N N N N 151 GLU CA C N S 152 GLU C C N N 153 GLU O O N N 154 GLU CB C N N 155 GLU CG C N N 156 GLU CD C N N 157 GLU OE1 O N N 158 GLU OE2 O N N 159 GLU OXT O N N 160 GLU H H N N 161 GLU H2 H N N 162 GLU HA H N N 163 GLU HB2 H N N 164 GLU HB3 H N N 165 GLU HG2 H N N 166 GLU HG3 H N N 167 GLU HE2 H N N 168 GLU HXT H N N 169 GLY N N N N 170 GLY CA C N N 171 GLY C C N N 172 GLY O O N N 173 GLY OXT O N N 174 GLY H H N N 175 GLY H2 H N N 176 GLY HA2 H N N 177 GLY HA3 H N N 178 GLY HXT H N N 179 HIS N N N N 180 HIS CA C N S 181 HIS C C N N 182 HIS O O N N 183 HIS CB C N N 184 HIS CG C Y N 185 HIS ND1 N Y N 186 HIS CD2 C Y N 187 HIS CE1 C Y N 188 HIS NE2 N Y N 189 HIS OXT O N N 190 HIS H H N N 191 HIS H2 H N N 192 HIS HA H N N 193 HIS HB2 H N N 194 HIS HB3 H N N 195 HIS HD1 H N N 196 HIS HD2 H N N 197 HIS HE1 H N N 198 HIS HE2 H N N 199 HIS HXT H N N 200 HOH O O N N 201 HOH H1 H N N 202 HOH H2 H N N 203 ILE N N N N 204 ILE CA C N S 205 ILE C C N N 206 ILE O O N N 207 ILE CB C N S 208 ILE CG1 C N N 209 ILE CG2 C N N 210 ILE CD1 C N N 211 ILE OXT O N N 212 ILE H H N N 213 ILE H2 H N N 214 ILE HA H N N 215 ILE HB H N N 216 ILE HG12 H N N 217 ILE HG13 H N N 218 ILE HG21 H N N 219 ILE HG22 H N N 220 ILE HG23 H N N 221 ILE HD11 H N N 222 ILE HD12 H N N 223 ILE HD13 H N N 224 ILE HXT H N N 225 LEU N N N N 226 LEU CA C N S 227 LEU C C N N 228 LEU O O N N 229 LEU CB C N N 230 LEU CG C N N 231 LEU CD1 C N N 232 LEU CD2 C N N 233 LEU OXT O N N 234 LEU H H N N 235 LEU H2 H N N 236 LEU HA H N N 237 LEU HB2 H N N 238 LEU HB3 H N N 239 LEU HG H N N 240 LEU HD11 H N N 241 LEU HD12 H N N 242 LEU HD13 H N N 243 LEU HD21 H N N 244 LEU HD22 H N N 245 LEU HD23 H N N 246 LEU HXT H N N 247 LYS N N N N 248 LYS CA C N S 249 LYS C C N N 250 LYS O O N N 251 LYS CB C N N 252 LYS CG C N N 253 LYS CD C N N 254 LYS CE C N N 255 LYS NZ N N N 256 LYS OXT O N N 257 LYS H H N N 258 LYS H2 H N N 259 LYS HA H N N 260 LYS HB2 H N N 261 LYS HB3 H N N 262 LYS HG2 H N N 263 LYS HG3 H N N 264 LYS HD2 H N N 265 LYS HD3 H N N 266 LYS HE2 H N N 267 LYS HE3 H N N 268 LYS HZ1 H N N 269 LYS HZ2 H N N 270 LYS HZ3 H N N 271 LYS HXT H N N 272 MET N N N N 273 MET CA C N S 274 MET C C N N 275 MET O O N N 276 MET CB C N N 277 MET CG C N N 278 MET SD S N N 279 MET CE C N N 280 MET OXT O N N 281 MET H H N N 282 MET H2 H N N 283 MET HA H N N 284 MET HB2 H N N 285 MET HB3 H N N 286 MET HG2 H N N 287 MET HG3 H N N 288 MET HE1 H N N 289 MET HE2 H N N 290 MET HE3 H N N 291 MET HXT H N N 292 MG MG MG N N 293 PEG C1 C N N 294 PEG O1 O N N 295 PEG C2 C N N 296 PEG O2 O N N 297 PEG C3 C N N 298 PEG C4 C N N 299 PEG O4 O N N 300 PEG H11 H N N 301 PEG H12 H N N 302 PEG HO1 H N N 303 PEG H21 H N N 304 PEG H22 H N N 305 PEG H31 H N N 306 PEG H32 H N N 307 PEG H41 H N N 308 PEG H42 H N N 309 PEG HO4 H N N 310 PHE N N N N 311 PHE CA C N S 312 PHE C C N N 313 PHE O O N N 314 PHE CB C N N 315 PHE CG C Y N 316 PHE CD1 C Y N 317 PHE CD2 C Y N 318 PHE CE1 C Y N 319 PHE CE2 C Y N 320 PHE CZ C Y N 321 PHE OXT O N N 322 PHE H H N N 323 PHE H2 H N N 324 PHE HA H N N 325 PHE HB2 H N N 326 PHE HB3 H N N 327 PHE HD1 H N N 328 PHE HD2 H N N 329 PHE HE1 H N N 330 PHE HE2 H N N 331 PHE HZ H N N 332 PHE HXT H N N 333 PRO N N N N 334 PRO CA C N S 335 PRO C C N N 336 PRO O O N N 337 PRO CB C N N 338 PRO CG C N N 339 PRO CD C N N 340 PRO OXT O N N 341 PRO H H N N 342 PRO HA H N N 343 PRO HB2 H N N 344 PRO HB3 H N N 345 PRO HG2 H N N 346 PRO HG3 H N N 347 PRO HD2 H N N 348 PRO HD3 H N N 349 PRO HXT H N N 350 SER N N N N 351 SER CA C N S 352 SER C C N N 353 SER O O N N 354 SER CB C N N 355 SER OG O N N 356 SER OXT O N N 357 SER H H N N 358 SER H2 H N N 359 SER HA H N N 360 SER HB2 H N N 361 SER HB3 H N N 362 SER HG H N N 363 SER HXT H N N 364 THR N N N N 365 THR CA C N S 366 THR C C N N 367 THR O O N N 368 THR CB C N R 369 THR OG1 O N N 370 THR CG2 C N N 371 THR OXT O N N 372 THR H H N N 373 THR H2 H N N 374 THR HA H N N 375 THR HB H N N 376 THR HG1 H N N 377 THR HG21 H N N 378 THR HG22 H N N 379 THR HG23 H N N 380 THR HXT H N N 381 TYR N N N N 382 TYR CA C N S 383 TYR C C N N 384 TYR O O N N 385 TYR CB C N N 386 TYR CG C Y N 387 TYR CD1 C Y N 388 TYR CD2 C Y N 389 TYR CE1 C Y N 390 TYR CE2 C Y N 391 TYR CZ C Y N 392 TYR OH O N N 393 TYR OXT O N N 394 TYR H H N N 395 TYR H2 H N N 396 TYR HA H N N 397 TYR HB2 H N N 398 TYR HB3 H N N 399 TYR HD1 H N N 400 TYR HD2 H N N 401 TYR HE1 H N N 402 TYR HE2 H N N 403 TYR HH H N N 404 TYR HXT H N N 405 VAL N N N N 406 VAL CA C N S 407 VAL C C N N 408 VAL O O N N 409 VAL CB C N N 410 VAL CG1 C N N 411 VAL CG2 C N N 412 VAL OXT O N N 413 VAL H H N N 414 VAL H2 H N N 415 VAL HA H N N 416 VAL HB H N N 417 VAL HG11 H N N 418 VAL HG12 H N N 419 VAL HG13 H N N 420 VAL HG21 H N N 421 VAL HG22 H N N 422 VAL HG23 H N N 423 VAL HXT H N N 424 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 5I8 C10 C11 doub Y N 1 5I8 C10 C9 sing Y N 2 5I8 C11 C12 sing Y N 3 5I8 C9 C8 doub Y N 4 5I8 N3 C13 doub N N 5 5I8 C12 C13 sing N N 6 5I8 C12 C7 doub Y N 7 5I8 C13 N2 sing N N 8 5I8 C8 C7 sing Y N 9 5I8 C7 C6 sing N N 10 5I8 N2 C6 sing N N 11 5I8 N2 C5 sing N N 12 5I8 N C5 doub Y N 13 5I8 N C3 sing Y N 14 5I8 C4 C3 sing N N 15 5I8 C5 N1 sing Y N 16 5I8 C3 C2 doub Y N 17 5I8 N1 C1 doub Y N 18 5I8 C2 C1 sing Y N 19 5I8 C1 C sing N N 20 5I8 C H1 sing N N 21 5I8 C H2 sing N N 22 5I8 C H3 sing N N 23 5I8 C10 H4 sing N N 24 5I8 C11 H5 sing N N 25 5I8 C2 H6 sing N N 26 5I8 C4 H7 sing N N 27 5I8 C4 H8 sing N N 28 5I8 C4 H9 sing N N 29 5I8 C6 H10 sing N N 30 5I8 C6 H11 sing N N 31 5I8 C8 H12 sing N N 32 5I8 C9 H13 sing N N 33 5I8 N3 H14 sing N N 34 ALA N CA sing N N 35 ALA N H sing N N 36 ALA N H2 sing N N 37 ALA CA C sing N N 38 ALA CA CB sing N N 39 ALA CA HA sing N N 40 ALA C O doub N N 41 ALA C OXT sing N N 42 ALA CB HB1 sing N N 43 ALA CB HB2 sing N N 44 ALA CB HB3 sing N N 45 ALA OXT HXT sing N N 46 ARG N CA sing N N 47 ARG N H sing N N 48 ARG N H2 sing N N 49 ARG CA C sing N N 50 ARG CA CB sing N N 51 ARG CA HA sing N N 52 ARG C O doub N N 53 ARG C OXT sing N N 54 ARG CB CG sing N N 55 ARG CB HB2 sing N N 56 ARG CB HB3 sing N N 57 ARG CG CD sing N N 58 ARG CG HG2 sing N N 59 ARG CG HG3 sing N N 60 ARG CD NE sing N N 61 ARG CD HD2 sing N N 62 ARG CD HD3 sing N N 63 ARG NE CZ sing N N 64 ARG NE HE sing N N 65 ARG CZ NH1 sing N N 66 ARG CZ NH2 doub N N 67 ARG NH1 HH11 sing N N 68 ARG NH1 HH12 sing N N 69 ARG NH2 HH21 sing N N 70 ARG NH2 HH22 sing N N 71 ARG OXT HXT sing N N 72 ASN N CA sing N N 73 ASN N H sing N N 74 ASN N H2 sing N N 75 ASN CA C sing N N 76 ASN CA CB sing N N 77 ASN CA HA sing N N 78 ASN C O doub N N 79 ASN C OXT sing N N 80 ASN CB CG sing N N 81 ASN CB HB2 sing N N 82 ASN CB HB3 sing N N 83 ASN CG OD1 doub N N 84 ASN CG ND2 sing N N 85 ASN ND2 HD21 sing N N 86 ASN ND2 HD22 sing N N 87 ASN OXT HXT sing N N 88 ASP N CA sing N N 89 ASP N H sing N N 90 ASP N H2 sing N N 91 ASP CA C sing N N 92 ASP CA CB sing N N 93 ASP CA HA sing N N 94 ASP C O doub N N 95 ASP C OXT sing N N 96 ASP CB CG sing N N 97 ASP CB HB2 sing N N 98 ASP CB HB3 sing N N 99 ASP CG OD1 doub N N 100 ASP CG OD2 sing N N 101 ASP OD2 HD2 sing N N 102 ASP OXT HXT sing N N 103 CYS N CA sing N N 104 CYS N H sing N N 105 CYS N H2 sing N N 106 CYS CA C sing N N 107 CYS CA CB sing N N 108 CYS CA HA sing N N 109 CYS C O doub N N 110 CYS C OXT sing N N 111 CYS CB SG sing N N 112 CYS CB HB2 sing N N 113 CYS CB HB3 sing N N 114 CYS SG HG sing N N 115 CYS OXT HXT sing N N 116 DMS S O doub N N 117 DMS S C1 sing N N 118 DMS S C2 sing N N 119 DMS C1 H11 sing N N 120 DMS C1 H12 sing N N 121 DMS C1 H13 sing N N 122 DMS C2 H21 sing N N 123 DMS C2 H22 sing N N 124 DMS C2 H23 sing N N 125 GLN N CA sing N N 126 GLN N H sing N N 127 GLN N H2 sing N N 128 GLN CA C sing N N 129 GLN CA CB sing N N 130 GLN CA HA sing N N 131 GLN C O doub N N 132 GLN C OXT sing N N 133 GLN CB CG sing N N 134 GLN CB HB2 sing N N 135 GLN CB HB3 sing N N 136 GLN CG CD sing N N 137 GLN CG HG2 sing N N 138 GLN CG HG3 sing N N 139 GLN CD OE1 doub N N 140 GLN CD NE2 sing N N 141 GLN NE2 HE21 sing N N 142 GLN NE2 HE22 sing N N 143 GLN OXT HXT sing N N 144 GLU N CA sing N N 145 GLU N H sing N N 146 GLU N H2 sing N N 147 GLU CA C sing N N 148 GLU CA CB sing N N 149 GLU CA HA sing N N 150 GLU C O doub N N 151 GLU C OXT sing N N 152 GLU CB CG sing N N 153 GLU CB HB2 sing N N 154 GLU CB HB3 sing N N 155 GLU CG CD sing N N 156 GLU CG HG2 sing N N 157 GLU CG HG3 sing N N 158 GLU CD OE1 doub N N 159 GLU CD OE2 sing N N 160 GLU OE2 HE2 sing N N 161 GLU OXT HXT sing N N 162 GLY N CA sing N N 163 GLY N H sing N N 164 GLY N H2 sing N N 165 GLY CA C sing N N 166 GLY CA HA2 sing N N 167 GLY CA HA3 sing N N 168 GLY C O doub N N 169 GLY C OXT sing N N 170 GLY OXT HXT sing N N 171 HIS N CA sing N N 172 HIS N H sing N N 173 HIS N H2 sing N N 174 HIS CA C sing N N 175 HIS CA CB sing N N 176 HIS CA HA sing N N 177 HIS C O doub N N 178 HIS C OXT sing N N 179 HIS CB CG sing N N 180 HIS CB HB2 sing N N 181 HIS CB HB3 sing N N 182 HIS CG ND1 sing Y N 183 HIS CG CD2 doub Y N 184 HIS ND1 CE1 doub Y N 185 HIS ND1 HD1 sing N N 186 HIS CD2 NE2 sing Y N 187 HIS CD2 HD2 sing N N 188 HIS CE1 NE2 sing Y N 189 HIS CE1 HE1 sing N N 190 HIS NE2 HE2 sing N N 191 HIS OXT HXT sing N N 192 HOH O H1 sing N N 193 HOH O H2 sing N N 194 ILE N CA sing N N 195 ILE N H sing N N 196 ILE N H2 sing N N 197 ILE CA C sing N N 198 ILE CA CB sing N N 199 ILE CA HA sing N N 200 ILE C O doub N N 201 ILE C OXT sing N N 202 ILE CB CG1 sing N N 203 ILE CB CG2 sing N N 204 ILE CB HB sing N N 205 ILE CG1 CD1 sing N N 206 ILE CG1 HG12 sing N N 207 ILE CG1 HG13 sing N N 208 ILE CG2 HG21 sing N N 209 ILE CG2 HG22 sing N N 210 ILE CG2 HG23 sing N N 211 ILE CD1 HD11 sing N N 212 ILE CD1 HD12 sing N N 213 ILE CD1 HD13 sing N N 214 ILE OXT HXT sing N N 215 LEU N CA sing N N 216 LEU N H sing N N 217 LEU N H2 sing N N 218 LEU CA C sing N N 219 LEU CA CB sing N N 220 LEU CA HA sing N N 221 LEU C O doub N N 222 LEU C OXT sing N N 223 LEU CB CG sing N N 224 LEU CB HB2 sing N N 225 LEU CB HB3 sing N N 226 LEU CG CD1 sing N N 227 LEU CG CD2 sing N N 228 LEU CG HG sing N N 229 LEU CD1 HD11 sing N N 230 LEU CD1 HD12 sing N N 231 LEU CD1 HD13 sing N N 232 LEU CD2 HD21 sing N N 233 LEU CD2 HD22 sing N N 234 LEU CD2 HD23 sing N N 235 LEU OXT HXT sing N N 236 LYS N CA sing N N 237 LYS N H sing N N 238 LYS N H2 sing N N 239 LYS CA C sing N N 240 LYS CA CB sing N N 241 LYS CA HA sing N N 242 LYS C O doub N N 243 LYS C OXT sing N N 244 LYS CB CG sing N N 245 LYS CB HB2 sing N N 246 LYS CB HB3 sing N N 247 LYS CG CD sing N N 248 LYS CG HG2 sing N N 249 LYS CG HG3 sing N N 250 LYS CD CE sing N N 251 LYS CD HD2 sing N N 252 LYS CD HD3 sing N N 253 LYS CE NZ sing N N 254 LYS CE HE2 sing N N 255 LYS CE HE3 sing N N 256 LYS NZ HZ1 sing N N 257 LYS NZ HZ2 sing N N 258 LYS NZ HZ3 sing N N 259 LYS OXT HXT sing N N 260 MET N CA sing N N 261 MET N H sing N N 262 MET N H2 sing N N 263 MET CA C sing N N 264 MET CA CB sing N N 265 MET CA HA sing N N 266 MET C O doub N N 267 MET C OXT sing N N 268 MET CB CG sing N N 269 MET CB HB2 sing N N 270 MET CB HB3 sing N N 271 MET CG SD sing N N 272 MET CG HG2 sing N N 273 MET CG HG3 sing N N 274 MET SD CE sing N N 275 MET CE HE1 sing N N 276 MET CE HE2 sing N N 277 MET CE HE3 sing N N 278 MET OXT HXT sing N N 279 PEG C1 O1 sing N N 280 PEG C1 C2 sing N N 281 PEG C1 H11 sing N N 282 PEG C1 H12 sing N N 283 PEG O1 HO1 sing N N 284 PEG C2 O2 sing N N 285 PEG C2 H21 sing N N 286 PEG C2 H22 sing N N 287 PEG O2 C3 sing N N 288 PEG C3 C4 sing N N 289 PEG C3 H31 sing N N 290 PEG C3 H32 sing N N 291 PEG C4 O4 sing N N 292 PEG C4 H41 sing N N 293 PEG C4 H42 sing N N 294 PEG O4 HO4 sing N N 295 PHE N CA sing N N 296 PHE N H sing N N 297 PHE N H2 sing N N 298 PHE CA C sing N N 299 PHE CA CB sing N N 300 PHE CA HA sing N N 301 PHE C O doub N N 302 PHE C OXT sing N N 303 PHE CB CG sing N N 304 PHE CB HB2 sing N N 305 PHE CB HB3 sing N N 306 PHE CG CD1 doub Y N 307 PHE CG CD2 sing Y N 308 PHE CD1 CE1 sing Y N 309 PHE CD1 HD1 sing N N 310 PHE CD2 CE2 doub Y N 311 PHE CD2 HD2 sing N N 312 PHE CE1 CZ doub Y N 313 PHE CE1 HE1 sing N N 314 PHE CE2 CZ sing Y N 315 PHE CE2 HE2 sing N N 316 PHE CZ HZ sing N N 317 PHE OXT HXT sing N N 318 PRO N CA sing N N 319 PRO N CD sing N N 320 PRO N H sing N N 321 PRO CA C sing N N 322 PRO CA CB sing N N 323 PRO CA HA sing N N 324 PRO C O doub N N 325 PRO C OXT sing N N 326 PRO CB CG sing N N 327 PRO CB HB2 sing N N 328 PRO CB HB3 sing N N 329 PRO CG CD sing N N 330 PRO CG HG2 sing N N 331 PRO CG HG3 sing N N 332 PRO CD HD2 sing N N 333 PRO CD HD3 sing N N 334 PRO OXT HXT sing N N 335 SER N CA sing N N 336 SER N H sing N N 337 SER N H2 sing N N 338 SER CA C sing N N 339 SER CA CB sing N N 340 SER CA HA sing N N 341 SER C O doub N N 342 SER C OXT sing N N 343 SER CB OG sing N N 344 SER CB HB2 sing N N 345 SER CB HB3 sing N N 346 SER OG HG sing N N 347 SER OXT HXT sing N N 348 THR N CA sing N N 349 THR N H sing N N 350 THR N H2 sing N N 351 THR CA C sing N N 352 THR CA CB sing N N 353 THR CA HA sing N N 354 THR C O doub N N 355 THR C OXT sing N N 356 THR CB OG1 sing N N 357 THR CB CG2 sing N N 358 THR CB HB sing N N 359 THR OG1 HG1 sing N N 360 THR CG2 HG21 sing N N 361 THR CG2 HG22 sing N N 362 THR CG2 HG23 sing N N 363 THR OXT HXT sing N N 364 TYR N CA sing N N 365 TYR N H sing N N 366 TYR N H2 sing N N 367 TYR CA C sing N N 368 TYR CA CB sing N N 369 TYR CA HA sing N N 370 TYR C O doub N N 371 TYR C OXT sing N N 372 TYR CB CG sing N N 373 TYR CB HB2 sing N N 374 TYR CB HB3 sing N N 375 TYR CG CD1 doub Y N 376 TYR CG CD2 sing Y N 377 TYR CD1 CE1 sing Y N 378 TYR CD1 HD1 sing N N 379 TYR CD2 CE2 doub Y N 380 TYR CD2 HD2 sing N N 381 TYR CE1 CZ doub Y N 382 TYR CE1 HE1 sing N N 383 TYR CE2 CZ sing Y N 384 TYR CE2 HE2 sing N N 385 TYR CZ OH sing N N 386 TYR OH HH sing N N 387 TYR OXT HXT sing N N 388 VAL N CA sing N N 389 VAL N H sing N N 390 VAL N H2 sing N N 391 VAL CA C sing N N 392 VAL CA CB sing N N 393 VAL CA HA sing N N 394 VAL C O doub N N 395 VAL C OXT sing N N 396 VAL CB CG1 sing N N 397 VAL CB CG2 sing N N 398 VAL CB HB sing N N 399 VAL CG1 HG11 sing N N 400 VAL CG1 HG12 sing N N 401 VAL CG1 HG13 sing N N 402 VAL CG2 HG21 sing N N 403 VAL CG2 HG22 sing N N 404 VAL CG2 HG23 sing N N 405 VAL OXT HXT sing N N 406 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6SCB _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 32 2 1' _space_group.name_Hall ;P 32 2" ; _space_group.IT_number 154 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 7P42 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017352 _atom_sites.fract_transf_matrix[1][2] 0.010018 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020037 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006280 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source BR ? ? 25.79822 9.11301 ? ? 1.35700 25.34896 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 ? ? 2.59044 63.03566 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_