data_7PF7 # _entry.id 7PF7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PF7 pdb_00007pf7 10.2210/pdb7pf7/pdb WWPDB D_1292117213 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-12-08 2 'Structure model' 1 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7PF7 _pdbx_database_status.recvd_initial_deposition_date 2021-08-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hemmings, A.M.' 1 0000-0003-3053-3134 'Bradley, J.M.' 2 0000-0003-1635-4455 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Microbiology (Reading, Engl.)' _citation.journal_id_ASTM MROBEO _citation.journal_id_CSD 2076 _citation.journal_id_ISSN 1465-2080 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 167 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Key carboxylate residues for iron transit through the prokaryotic ferritin Syn Ftn.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1099/mic.0.001105 _citation.pdbx_database_id_PubMed 34825885 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bradley, J.M.' 1 ? primary 'Fair, J.' 2 ? primary 'Hemmings, A.M.' 3 ? primary 'Le Brun, N.E.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Ferritin 20188.346 1 1.16.3.2 D65A ferritin ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 3 ? ? ? ? 4 water nat water 18.015 212 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MATDVAQGPNGRALAESMNPDLLSAIQQHISIERYASVTYLAMSIWCAERELAGFYQFFDGEAKAEQSHAVHFTQYLIAR SQSNDLQTLDAPRQNWDSLASLMATAFQMEADTTSSIQSVYALAERNSDTRTTVFLDPLIEAQIQSEDQFAYLLGRVKFA NGDPTALLVIDNELRAGQTQRG ; _entity_poly.pdbx_seq_one_letter_code_can ;MATDVAQGPNGRALAESMNPDLLSAIQQHISIERYASVTYLAMSIWCAERELAGFYQFFDGEAKAEQSHAVHFTQYLIAR SQSNDLQTLDAPRQNWDSLASLMATAFQMEADTTSSIQSVYALAERNSDTRTTVFLDPLIEAQIQSEDQFAYLLGRVKFA NGDPTALLVIDNELRAGQTQRG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 'SODIUM ION' NA 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 THR n 1 4 ASP n 1 5 VAL n 1 6 ALA n 1 7 GLN n 1 8 GLY n 1 9 PRO n 1 10 ASN n 1 11 GLY n 1 12 ARG n 1 13 ALA n 1 14 LEU n 1 15 ALA n 1 16 GLU n 1 17 SER n 1 18 MET n 1 19 ASN n 1 20 PRO n 1 21 ASP n 1 22 LEU n 1 23 LEU n 1 24 SER n 1 25 ALA n 1 26 ILE n 1 27 GLN n 1 28 GLN n 1 29 HIS n 1 30 ILE n 1 31 SER n 1 32 ILE n 1 33 GLU n 1 34 ARG n 1 35 TYR n 1 36 ALA n 1 37 SER n 1 38 VAL n 1 39 THR n 1 40 TYR n 1 41 LEU n 1 42 ALA n 1 43 MET n 1 44 SER n 1 45 ILE n 1 46 TRP n 1 47 CYS n 1 48 ALA n 1 49 GLU n 1 50 ARG n 1 51 GLU n 1 52 LEU n 1 53 ALA n 1 54 GLY n 1 55 PHE n 1 56 TYR n 1 57 GLN n 1 58 PHE n 1 59 PHE n 1 60 ASP n 1 61 GLY n 1 62 GLU n 1 63 ALA n 1 64 LYS n 1 65 ALA n 1 66 GLU n 1 67 GLN n 1 68 SER n 1 69 HIS n 1 70 ALA n 1 71 VAL n 1 72 HIS n 1 73 PHE n 1 74 THR n 1 75 GLN n 1 76 TYR n 1 77 LEU n 1 78 ILE n 1 79 ALA n 1 80 ARG n 1 81 SER n 1 82 GLN n 1 83 SER n 1 84 ASN n 1 85 ASP n 1 86 LEU n 1 87 GLN n 1 88 THR n 1 89 LEU n 1 90 ASP n 1 91 ALA n 1 92 PRO n 1 93 ARG n 1 94 GLN n 1 95 ASN n 1 96 TRP n 1 97 ASP n 1 98 SER n 1 99 LEU n 1 100 ALA n 1 101 SER n 1 102 LEU n 1 103 MET n 1 104 ALA n 1 105 THR n 1 106 ALA n 1 107 PHE n 1 108 GLN n 1 109 MET n 1 110 GLU n 1 111 ALA n 1 112 ASP n 1 113 THR n 1 114 THR n 1 115 SER n 1 116 SER n 1 117 ILE n 1 118 GLN n 1 119 SER n 1 120 VAL n 1 121 TYR n 1 122 ALA n 1 123 LEU n 1 124 ALA n 1 125 GLU n 1 126 ARG n 1 127 ASN n 1 128 SER n 1 129 ASP n 1 130 THR n 1 131 ARG n 1 132 THR n 1 133 THR n 1 134 VAL n 1 135 PHE n 1 136 LEU n 1 137 ASP n 1 138 PRO n 1 139 LEU n 1 140 ILE n 1 141 GLU n 1 142 ALA n 1 143 GLN n 1 144 ILE n 1 145 GLN n 1 146 SER n 1 147 GLU n 1 148 ASP n 1 149 GLN n 1 150 PHE n 1 151 ALA n 1 152 TYR n 1 153 LEU n 1 154 LEU n 1 155 GLY n 1 156 ARG n 1 157 VAL n 1 158 LYS n 1 159 PHE n 1 160 ALA n 1 161 ASN n 1 162 GLY n 1 163 ASP n 1 164 PRO n 1 165 THR n 1 166 ALA n 1 167 LEU n 1 168 LEU n 1 169 VAL n 1 170 ILE n 1 171 ASP n 1 172 ASN n 1 173 GLU n 1 174 LEU n 1 175 ARG n 1 176 ALA n 1 177 GLY n 1 178 GLN n 1 179 THR n 1 180 GLN n 1 181 ARG n 1 182 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 182 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene sync_1539 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain CC9311 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Synechococcus sp. (strain CC9311)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 64471 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 GLN 145 145 145 GLN GLN A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 PHE 150 150 150 PHE PHE A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 ASN 172 172 172 ASN ASN A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 GLN 178 178 178 GLN GLN A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 GLN 180 180 180 GLN GLN A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 GLY 182 182 182 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 201 1 CL CL A . C 3 NA 1 202 1 NA NA A . D 3 NA 1 203 2 NA NA A . E 3 NA 1 204 3 NA NA A . F 4 HOH 1 301 155 HOH HOH A . F 4 HOH 2 302 57 HOH HOH A . F 4 HOH 3 303 130 HOH HOH A . F 4 HOH 4 304 152 HOH HOH A . F 4 HOH 5 305 132 HOH HOH A . F 4 HOH 6 306 153 HOH HOH A . F 4 HOH 7 307 156 HOH HOH A . F 4 HOH 8 308 41 HOH HOH A . F 4 HOH 9 309 113 HOH HOH A . F 4 HOH 10 310 161 HOH HOH A . F 4 HOH 11 311 56 HOH HOH A . F 4 HOH 12 312 197 HOH HOH A . F 4 HOH 13 313 63 HOH HOH A . F 4 HOH 14 314 76 HOH HOH A . F 4 HOH 15 315 143 HOH HOH A . F 4 HOH 16 316 7 HOH HOH A . F 4 HOH 17 317 118 HOH HOH A . F 4 HOH 18 318 119 HOH HOH A . F 4 HOH 19 319 23 HOH HOH A . F 4 HOH 20 320 131 HOH HOH A . F 4 HOH 21 321 68 HOH HOH A . F 4 HOH 22 322 5 HOH HOH A . F 4 HOH 23 323 27 HOH HOH A . F 4 HOH 24 324 182 HOH HOH A . F 4 HOH 25 325 135 HOH HOH A . F 4 HOH 26 326 86 HOH HOH A . F 4 HOH 27 327 166 HOH HOH A . F 4 HOH 28 328 93 HOH HOH A . F 4 HOH 29 329 72 HOH HOH A . F 4 HOH 30 330 105 HOH HOH A . F 4 HOH 31 331 170 HOH HOH A . F 4 HOH 32 332 127 HOH HOH A . F 4 HOH 33 333 65 HOH HOH A . F 4 HOH 34 334 64 HOH HOH A . F 4 HOH 35 335 73 HOH HOH A . F 4 HOH 36 336 16 HOH HOH A . F 4 HOH 37 337 168 HOH HOH A . F 4 HOH 38 338 70 HOH HOH A . F 4 HOH 39 339 22 HOH HOH A . F 4 HOH 40 340 49 HOH HOH A . F 4 HOH 41 341 101 HOH HOH A . F 4 HOH 42 342 103 HOH HOH A . F 4 HOH 43 343 12 HOH HOH A . F 4 HOH 44 344 90 HOH HOH A . F 4 HOH 45 345 136 HOH HOH A . F 4 HOH 46 346 28 HOH HOH A . F 4 HOH 47 347 31 HOH HOH A . F 4 HOH 48 348 158 HOH HOH A . F 4 HOH 49 349 13 HOH HOH A . F 4 HOH 50 350 58 HOH HOH A . F 4 HOH 51 351 78 HOH HOH A . F 4 HOH 52 352 88 HOH HOH A . F 4 HOH 53 353 42 HOH HOH A . F 4 HOH 54 354 84 HOH HOH A . F 4 HOH 55 355 20 HOH HOH A . F 4 HOH 56 356 191 HOH HOH A . F 4 HOH 57 357 26 HOH HOH A . F 4 HOH 58 358 81 HOH HOH A . F 4 HOH 59 359 128 HOH HOH A . F 4 HOH 60 360 96 HOH HOH A . F 4 HOH 61 361 92 HOH HOH A . F 4 HOH 62 362 14 HOH HOH A . F 4 HOH 63 363 36 HOH HOH A . F 4 HOH 64 364 125 HOH HOH A . F 4 HOH 65 365 122 HOH HOH A . F 4 HOH 66 366 8 HOH HOH A . F 4 HOH 67 367 187 HOH HOH A . F 4 HOH 68 368 71 HOH HOH A . F 4 HOH 69 369 126 HOH HOH A . F 4 HOH 70 370 61 HOH HOH A . F 4 HOH 71 371 190 HOH HOH A . F 4 HOH 72 372 47 HOH HOH A . F 4 HOH 73 373 137 HOH HOH A . F 4 HOH 74 374 85 HOH HOH A . F 4 HOH 75 375 100 HOH HOH A . F 4 HOH 76 376 34 HOH HOH A . F 4 HOH 77 377 35 HOH HOH A . F 4 HOH 78 378 97 HOH HOH A . F 4 HOH 79 379 110 HOH HOH A . F 4 HOH 80 380 11 HOH HOH A . F 4 HOH 81 381 80 HOH HOH A . F 4 HOH 82 382 198 HOH HOH A . F 4 HOH 83 383 87 HOH HOH A . F 4 HOH 84 384 123 HOH HOH A . F 4 HOH 85 385 18 HOH HOH A . F 4 HOH 86 386 29 HOH HOH A . F 4 HOH 87 387 111 HOH HOH A . F 4 HOH 88 388 209 HOH HOH A . F 4 HOH 89 389 69 HOH HOH A . F 4 HOH 90 390 83 HOH HOH A . F 4 HOH 91 391 142 HOH HOH A . F 4 HOH 92 392 32 HOH HOH A . F 4 HOH 93 393 104 HOH HOH A . F 4 HOH 94 394 112 HOH HOH A . F 4 HOH 95 395 184 HOH HOH A . F 4 HOH 96 396 174 HOH HOH A . F 4 HOH 97 397 176 HOH HOH A . F 4 HOH 98 398 3 HOH HOH A . F 4 HOH 99 399 25 HOH HOH A . F 4 HOH 100 400 117 HOH HOH A . F 4 HOH 101 401 60 HOH HOH A . F 4 HOH 102 402 106 HOH HOH A . F 4 HOH 103 403 40 HOH HOH A . F 4 HOH 104 404 157 HOH HOH A . F 4 HOH 105 405 33 HOH HOH A . F 4 HOH 106 406 30 HOH HOH A . F 4 HOH 107 407 19 HOH HOH A . F 4 HOH 108 408 66 HOH HOH A . F 4 HOH 109 409 4 HOH HOH A . F 4 HOH 110 410 38 HOH HOH A . F 4 HOH 111 411 75 HOH HOH A . F 4 HOH 112 412 193 HOH HOH A . F 4 HOH 113 413 2 HOH HOH A . F 4 HOH 114 414 48 HOH HOH A . F 4 HOH 115 415 146 HOH HOH A . F 4 HOH 116 416 45 HOH HOH A . F 4 HOH 117 417 162 HOH HOH A . F 4 HOH 118 418 6 HOH HOH A . F 4 HOH 119 419 139 HOH HOH A . F 4 HOH 120 420 177 HOH HOH A . F 4 HOH 121 421 77 HOH HOH A . F 4 HOH 122 422 208 HOH HOH A . F 4 HOH 123 423 194 HOH HOH A . F 4 HOH 124 424 147 HOH HOH A . F 4 HOH 125 425 179 HOH HOH A . F 4 HOH 126 426 9 HOH HOH A . F 4 HOH 127 427 200 HOH HOH A . F 4 HOH 128 428 151 HOH HOH A . F 4 HOH 129 429 21 HOH HOH A . F 4 HOH 130 430 140 HOH HOH A . F 4 HOH 131 431 124 HOH HOH A . F 4 HOH 132 432 24 HOH HOH A . F 4 HOH 133 433 99 HOH HOH A . F 4 HOH 134 434 145 HOH HOH A . F 4 HOH 135 435 160 HOH HOH A . F 4 HOH 136 436 10 HOH HOH A . F 4 HOH 137 437 188 HOH HOH A . F 4 HOH 138 438 109 HOH HOH A . F 4 HOH 139 439 15 HOH HOH A . F 4 HOH 140 440 43 HOH HOH A . F 4 HOH 141 441 189 HOH HOH A . F 4 HOH 142 442 178 HOH HOH A . F 4 HOH 143 443 1 HOH HOH A . F 4 HOH 144 444 144 HOH HOH A . F 4 HOH 145 445 115 HOH HOH A . F 4 HOH 146 446 120 HOH HOH A . F 4 HOH 147 447 195 HOH HOH A . F 4 HOH 148 448 129 HOH HOH A . F 4 HOH 149 449 51 HOH HOH A . F 4 HOH 150 450 150 HOH HOH A . F 4 HOH 151 451 192 HOH HOH A . F 4 HOH 152 452 164 HOH HOH A . F 4 HOH 153 453 54 HOH HOH A . F 4 HOH 154 454 199 HOH HOH A . F 4 HOH 155 455 207 HOH HOH A . F 4 HOH 156 456 201 HOH HOH A . F 4 HOH 157 457 55 HOH HOH A . F 4 HOH 158 458 107 HOH HOH A . F 4 HOH 159 459 172 HOH HOH A . F 4 HOH 160 460 183 HOH HOH A . F 4 HOH 161 461 181 HOH HOH A . F 4 HOH 162 462 196 HOH HOH A . F 4 HOH 163 463 210 HOH HOH A . F 4 HOH 164 464 50 HOH HOH A . F 4 HOH 165 465 39 HOH HOH A . F 4 HOH 166 466 37 HOH HOH A . F 4 HOH 167 467 116 HOH HOH A . F 4 HOH 168 468 67 HOH HOH A . F 4 HOH 169 469 202 HOH HOH A . F 4 HOH 170 470 186 HOH HOH A . F 4 HOH 171 471 82 HOH HOH A . F 4 HOH 172 472 53 HOH HOH A . F 4 HOH 173 473 79 HOH HOH A . F 4 HOH 174 474 154 HOH HOH A . F 4 HOH 175 475 175 HOH HOH A . F 4 HOH 176 476 74 HOH HOH A . F 4 HOH 177 477 169 HOH HOH A . F 4 HOH 178 478 173 HOH HOH A . F 4 HOH 179 479 163 HOH HOH A . F 4 HOH 180 480 167 HOH HOH A . F 4 HOH 181 481 44 HOH HOH A . F 4 HOH 182 482 185 HOH HOH A . F 4 HOH 183 483 205 HOH HOH A . F 4 HOH 184 484 180 HOH HOH A . F 4 HOH 185 485 94 HOH HOH A . F 4 HOH 186 486 141 HOH HOH A . F 4 HOH 187 487 89 HOH HOH A . F 4 HOH 188 488 95 HOH HOH A . F 4 HOH 189 489 171 HOH HOH A . F 4 HOH 190 490 149 HOH HOH A . F 4 HOH 191 491 138 HOH HOH A . F 4 HOH 192 492 98 HOH HOH A . F 4 HOH 193 493 134 HOH HOH A . F 4 HOH 194 494 17 HOH HOH A . F 4 HOH 195 495 59 HOH HOH A . F 4 HOH 196 496 108 HOH HOH A . F 4 HOH 197 497 165 HOH HOH A . F 4 HOH 198 498 211 HOH HOH A . F 4 HOH 199 499 212 HOH HOH A . F 4 HOH 200 500 133 HOH HOH A . F 4 HOH 201 501 148 HOH HOH A . F 4 HOH 202 502 62 HOH HOH A . F 4 HOH 203 503 204 HOH HOH A . F 4 HOH 204 504 114 HOH HOH A . F 4 HOH 205 505 46 HOH HOH A . F 4 HOH 206 506 91 HOH HOH A . F 4 HOH 207 507 52 HOH HOH A . F 4 HOH 208 508 206 HOH HOH A . F 4 HOH 209 509 121 HOH HOH A . F 4 HOH 210 510 102 HOH HOH A . F 4 HOH 211 511 203 HOH HOH A . F 4 HOH 212 512 159 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1_2155 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7PF7 _cell.details ? _cell.formula_units_Z ? _cell.length_a 177.140 _cell.length_a_esd ? _cell.length_b 177.140 _cell.length_b_esd ? _cell.length_c 177.140 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 96 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7PF7 _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PF7 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.87 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.11 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.000 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2M NaCl' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-12-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7PF7 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.690 _reflns.d_resolution_low 53.330 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 27095 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 78.200 _reflns.pdbx_Rmerge_I_obs 0.070 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 42.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.071 _reflns.pdbx_Rpim_I_all 0.008 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 2119682 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.690 1.730 ? ? 146252 ? ? ? 1939 100.000 ? ? ? ? 4.264 ? ? ? ? ? ? ? ? 75.400 ? ? ? 1.500 4.292 0.491 ? 1 1 0.779 ? ? ? ? ? ? ? ? ? ? 7.560 53.330 ? ? 24247 ? ? ? 388 98.700 ? ? ? ? 0.022 ? ? ? ? ? ? ? ? 62.500 ? ? ? 167.600 0.023 0.003 ? 2 1 1.000 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 71.070 _refine.B_iso_mean 31.8964 _refine.B_iso_min 22.420 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7PF7 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.7000 _refine.ls_d_res_low 40.6390 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 26762 _refine.ls_number_reflns_R_free 1327 _refine.ls_number_reflns_R_work 25435 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9800 _refine.ls_percent_reflns_R_free 4.9600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1829 _refine.ls_R_factor_R_free 0.2080 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1816 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'pdbid 5OUW' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.0400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.7000 _refine_hist.d_res_low 40.6390 _refine_hist.number_atoms_solvent 212 _refine_hist.number_atoms_total 1606 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 178 _refine_hist.pdbx_B_iso_mean_ligand 43.29 _refine_hist.pdbx_B_iso_mean_solvent 41.56 _refine_hist.pdbx_number_atoms_protein 1390 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 1454 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.712 ? 1980 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.043 ? 220 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 266 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.645 ? 882 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.7001 1.7682 . . 136 2758 100.0000 . . . 0.2647 0.0000 0.2725 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7682 1.8487 . . 145 2758 100.0000 . . . 0.3247 0.0000 0.2548 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8487 1.9461 . . 138 2782 100.0000 . . . 0.3249 0.0000 0.2280 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9461 2.0681 . . 147 2771 100.0000 . . . 0.2585 0.0000 0.2191 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0681 2.2277 . . 138 2810 100.0000 . . . 0.2201 0.0000 0.1964 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2277 2.4519 . . 160 2783 100.0000 . . . 0.2165 0.0000 0.1947 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4519 2.8066 . . 153 2831 100.0000 . . . 0.2264 0.0000 0.1847 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8066 3.5357 . . 150 2867 100.0000 . . . 0.1875 0.0000 0.1706 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5357 40.6390 . . 160 3075 100.0000 . . . 0.1861 0.0000 0.1643 . . . . . . . . . . . # _struct.entry_id 7PF7 _struct.title 'Apo structure of SynFtn variant D65A' _struct.pdbx_model_details 'structure determined from crystals of SynFtn D65A that have not been soaked in Fe2+' _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PF7 _struct_keywords.text 'iron binding protein, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q0I9X8_SYNS3 _struct_ref.pdbx_db_accession Q0I9X8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MATDVAQGPNGRALAESMNPDLLSAIQQHISIERYASVTYLAMSIWCAERELAGFYQFFDGEAKDEQSHAVHFTQYLIAR SQSNDLQTLDAPRQNWDSLASLMATAFQMEADTTSSIQSVYALAERNSDTRTTVFLDPLIEAQIQSEDQFAYLLGRVKFA NGDPTALLVIDNELRAGQTQRG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7PF7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 182 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q0I9X8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 182 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 182 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7PF7 _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 65 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q0I9X8 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 65 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 65 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 98270 ? 1 MORE -943 ? 1 'SSA (A^2)' 131540 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_545 -x,-y-1,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -177.1400000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_545 x,-y-1,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -177.1400000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 21_555 z,y,-x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 22_545 z,-y-1,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -177.1400000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 23_555 -z,y,x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 24_545 -z,-y-1,-x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -177.1400000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 29_545 z,x-1/2,y+1/2 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -88.5700000000 0.0000000000 1.0000000000 0.0000000000 88.5700000000 10 'crystal symmetry operation' 30_544 z,-x-1/2,-y-1/2 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -88.5700000000 0.0000000000 -1.0000000000 0.0000000000 -88.5700000000 11 'crystal symmetry operation' 31_545 -z,-x-1/2,y+1/2 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -88.5700000000 0.0000000000 1.0000000000 0.0000000000 88.5700000000 12 'crystal symmetry operation' 32_544 -z,x-1/2,-y-1/2 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -88.5700000000 0.0000000000 -1.0000000000 0.0000000000 -88.5700000000 13 'crystal symmetry operation' 41_544 x,z-1/2,-y-1/2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 -88.5700000000 0.0000000000 -1.0000000000 0.0000000000 -88.5700000000 14 'crystal symmetry operation' 42_545 -x,z-1/2,y+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 -88.5700000000 0.0000000000 1.0000000000 0.0000000000 88.5700000000 15 'crystal symmetry operation' 43_544 -x,-z-1/2,-y-1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -88.5700000000 0.0000000000 -1.0000000000 0.0000000000 -88.5700000000 16 'crystal symmetry operation' 44_545 x,-z-1/2,y+1/2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -88.5700000000 0.0000000000 1.0000000000 0.0000000000 88.5700000000 17 'crystal symmetry operation' 81_545 y+1/2,z-1/2,x 0.0000000000 1.0000000000 0.0000000000 88.5700000000 0.0000000000 0.0000000000 1.0000000000 -88.5700000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 18 'crystal symmetry operation' 82_445 -y-1/2,z-1/2,-x 0.0000000000 -1.0000000000 0.0000000000 -88.5700000000 0.0000000000 0.0000000000 1.0000000000 -88.5700000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 83_545 y+1/2,-z-1/2,-x 0.0000000000 1.0000000000 0.0000000000 88.5700000000 0.0000000000 0.0000000000 -1.0000000000 -88.5700000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 84_445 -y-1/2,-z-1/2,x 0.0000000000 -1.0000000000 0.0000000000 -88.5700000000 0.0000000000 0.0000000000 -1.0000000000 -88.5700000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 85_545 y+1/2,x-1/2,-z 0.0000000000 1.0000000000 0.0000000000 88.5700000000 1.0000000000 0.0000000000 0.0000000000 -88.5700000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 22 'crystal symmetry operation' 86_445 -y-1/2,-x-1/2,-z 0.0000000000 -1.0000000000 0.0000000000 -88.5700000000 -1.0000000000 0.0000000000 0.0000000000 -88.5700000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 23 'crystal symmetry operation' 87_545 y+1/2,-x-1/2,z 0.0000000000 1.0000000000 0.0000000000 88.5700000000 -1.0000000000 0.0000000000 0.0000000000 -88.5700000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 24 'crystal symmetry operation' 88_445 -y-1/2,x-1/2,z 0.0000000000 -1.0000000000 0.0000000000 -88.5700000000 1.0000000000 0.0000000000 0.0000000000 -88.5700000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 19 ? ARG A 50 ? ASN A 19 ARG A 50 1 ? 32 HELX_P HELX_P2 AA2 LEU A 52 ? ARG A 80 ? LEU A 52 ARG A 80 1 ? 29 HELX_P HELX_P3 AA3 SER A 98 ? ASN A 127 ? SER A 98 ASN A 127 1 ? 30 HELX_P HELX_P4 AA4 ASP A 129 ? ASN A 161 ? ASP A 129 ASN A 161 1 ? 33 HELX_P HELX_P5 AA5 ASP A 163 ? ALA A 176 ? ASP A 163 ALA A 176 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A SER 24 O A ? ? 1_555 D NA . NA ? ? A SER 24 A NA 203 1_555 ? ? ? ? ? ? ? 2.827 ? ? metalc2 metalc ? ? A SER 24 O B ? ? 1_555 D NA . NA ? ? A SER 24 A NA 203 1_555 ? ? ? ? ? ? ? 2.826 ? ? metalc3 metalc ? ? A SER 24 OG A ? ? 1_555 D NA . NA ? ? A SER 24 A NA 203 1_555 ? ? ? ? ? ? ? 3.168 ? ? metalc4 metalc ? ? A TYR 121 OH ? ? ? 1_555 E NA . NA ? ? A TYR 121 A NA 204 83_545 ? ? ? ? ? ? ? 2.889 ? ? metalc5 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 204 A HOH 396 32_544 ? ? ? ? ? ? ? 2.893 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O A A SER 24 ? A SER 24 ? 1_555 NA ? D NA . ? A NA 203 ? 1_555 O B A SER 24 ? A SER 24 ? 1_555 0.2 ? 2 O A A SER 24 ? A SER 24 ? 1_555 NA ? D NA . ? A NA 203 ? 1_555 OG A A SER 24 ? A SER 24 ? 1_555 64.3 ? 3 O B A SER 24 ? A SER 24 ? 1_555 NA ? D NA . ? A NA 203 ? 1_555 OG A A SER 24 ? A SER 24 ? 1_555 64.4 ? 4 OH ? A TYR 121 ? A TYR 121 ? 1_555 NA ? E NA . ? A NA 204 ? 83_545 O ? F HOH . ? A HOH 396 ? 32_544 51.9 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 474 ? ? O A HOH 483 ? ? 1.95 2 1 O A HOH 454 ? ? O A HOH 459 ? ? 1.97 3 1 O A HOH 371 ? ? O A HOH 470 ? ? 2.06 4 1 O A HOH 359 ? ? O A HOH 452 ? ? 2.08 5 1 O A HOH 406 ? ? O A HOH 502 ? ? 2.10 6 1 OD1 A ASP 90 ? ? O A HOH 301 ? ? 2.17 7 1 O A HOH 356 ? ? O A HOH 456 ? ? 2.18 8 1 O A HOH 365 ? ? O A HOH 475 ? ? 2.18 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 454 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 492 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 21_555 _pdbx_validate_symm_contact.dist 1.95 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A NA 202 ? C NA . 2 1 A HOH 401 ? F HOH . 3 1 A HOH 507 ? F HOH . 4 1 A HOH 512 ? F HOH . # _phasing.method MR # _pdbx_entry_details.entry_id 7PF7 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 512 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.84 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A THR 3 ? A THR 3 4 1 Y 1 A ASP 4 ? A ASP 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 NA NA NA N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 VAL N N N N 374 VAL CA C N S 375 VAL C C N N 376 VAL O O N N 377 VAL CB C N N 378 VAL CG1 C N N 379 VAL CG2 C N N 380 VAL OXT O N N 381 VAL H H N N 382 VAL H2 H N N 383 VAL HA H N N 384 VAL HB H N N 385 VAL HG11 H N N 386 VAL HG12 H N N 387 VAL HG13 H N N 388 VAL HG21 H N N 389 VAL HG22 H N N 390 VAL HG23 H N N 391 VAL HXT H N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Biotechnology and Biological Sciences Research Council (BBSRC)' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number BB/R002363/1 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5OUW _pdbx_initial_refinement_model.details 'pdbid 5OUW' # _atom_sites.entry_id 7PF7 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.005645 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005645 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005645 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N NA O S # loop_