data_7PGF # _entry.id 7PGF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.359 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PGF pdb_00007pgf 10.2210/pdb7pgf/pdb WWPDB D_1292117651 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'SAT09 antibody complex' 7PGP unspecified PDB 'ANT05 antibody complex' 7PG8 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7PGF _pdbx_database_status.recvd_initial_deposition_date 2021-08-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lolicato, M.' 1 0000-0002-2022-7961 'Arrigoni, C.' 2 0000-0003-1917-1750 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1545-9985 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 537 _citation.page_last 548 _citation.title 'Quaternary structure independent folding of voltage-gated ion channel pore domain subunits.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41594-022-00775-x _citation.pdbx_database_id_PubMed 35655098 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Arrigoni, C.' 1 ? primary 'Lolicato, M.' 2 ? primary 'Shaya, D.' 3 ? primary 'Rohaim, A.' 4 ? primary 'Findeisen, F.' 5 ? primary 'Fong, L.K.' 6 ? primary 'Colleran, C.M.' 7 ? primary 'Dominik, P.' 8 ? primary 'Kim, S.S.' 9 ? primary 'Schuermann, J.P.' 10 ? primary 'DeGrado, W.F.' 11 ? primary 'Grabe, M.' 12 ? primary 'Kossiakoff, A.A.' 13 ? primary 'Minor Jr., D.L.' 14 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7PGF _cell.details ? _cell.formula_units_Z ? _cell.length_a 133.682 _cell.length_a_esd ? _cell.length_b 133.682 _cell.length_b_esd ? _cell.length_c 130.744 _cell.length_c_esd ? _cell.volume 2023480.173 _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7PGF _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall 'P 61 2 (x,y,z+5/12)' _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ion transporter' _entity.formula_weight 15512.957 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation 'E56D, S57D, M60D' _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GFITALPGMASVFLLMTIIFYIGAVIATKLFAASFPDWFGDLGLSAYTLFQIMTLDDWSDGIVRPVMQVYPYAWLFFVPF IMITTFAVVNLLVGLIVNSMQDAHHAEDGERTDAYRDEVLARLEQIDQRLNALGETKK ; _entity_poly.pdbx_seq_one_letter_code_can ;GFITALPGMASVFLLMTIIFYIGAVIATKLFAASFPDWFGDLGLSAYTLFQIMTLDDWSDGIVRPVMQVYPYAWLFFVPF IMITTFAVVNLLVGLIVNSMQDAHHAEDGERTDAYRDEVLARLEQIDQRLNALGETKK ; _entity_poly.pdbx_strand_id C,D _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PHE n 1 3 ILE n 1 4 THR n 1 5 ALA n 1 6 LEU n 1 7 PRO n 1 8 GLY n 1 9 MET n 1 10 ALA n 1 11 SER n 1 12 VAL n 1 13 PHE n 1 14 LEU n 1 15 LEU n 1 16 MET n 1 17 THR n 1 18 ILE n 1 19 ILE n 1 20 PHE n 1 21 TYR n 1 22 ILE n 1 23 GLY n 1 24 ALA n 1 25 VAL n 1 26 ILE n 1 27 ALA n 1 28 THR n 1 29 LYS n 1 30 LEU n 1 31 PHE n 1 32 ALA n 1 33 ALA n 1 34 SER n 1 35 PHE n 1 36 PRO n 1 37 ASP n 1 38 TRP n 1 39 PHE n 1 40 GLY n 1 41 ASP n 1 42 LEU n 1 43 GLY n 1 44 LEU n 1 45 SER n 1 46 ALA n 1 47 TYR n 1 48 THR n 1 49 LEU n 1 50 PHE n 1 51 GLN n 1 52 ILE n 1 53 MET n 1 54 THR n 1 55 LEU n 1 56 ASP n 1 57 ASP n 1 58 TRP n 1 59 SER n 1 60 ASP n 1 61 GLY n 1 62 ILE n 1 63 VAL n 1 64 ARG n 1 65 PRO n 1 66 VAL n 1 67 MET n 1 68 GLN n 1 69 VAL n 1 70 TYR n 1 71 PRO n 1 72 TYR n 1 73 ALA n 1 74 TRP n 1 75 LEU n 1 76 PHE n 1 77 PHE n 1 78 VAL n 1 79 PRO n 1 80 PHE n 1 81 ILE n 1 82 MET n 1 83 ILE n 1 84 THR n 1 85 THR n 1 86 PHE n 1 87 ALA n 1 88 VAL n 1 89 VAL n 1 90 ASN n 1 91 LEU n 1 92 LEU n 1 93 VAL n 1 94 GLY n 1 95 LEU n 1 96 ILE n 1 97 VAL n 1 98 ASN n 1 99 SER n 1 100 MET n 1 101 GLN n 1 102 ASP n 1 103 ALA n 1 104 HIS n 1 105 HIS n 1 106 ALA n 1 107 GLU n 1 108 ASP n 1 109 GLY n 1 110 GLU n 1 111 ARG n 1 112 THR n 1 113 ASP n 1 114 ALA n 1 115 TYR n 1 116 ARG n 1 117 ASP n 1 118 GLU n 1 119 VAL n 1 120 LEU n 1 121 ALA n 1 122 ARG n 1 123 LEU n 1 124 GLU n 1 125 GLN n 1 126 ILE n 1 127 ASP n 1 128 GLN n 1 129 ARG n 1 130 LEU n 1 131 ASN n 1 132 ALA n 1 133 LEU n 1 134 GLY n 1 135 GLU n 1 136 THR n 1 137 LYS n 1 138 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 138 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene HW563_01415 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Ruegeria pomeroyi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 89184 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A7Y7EFG5_9RHOB _struct_ref.pdbx_db_accession A0A7Y7EFG5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GFITALPGMASVFLLMTIIFYIGAVIATKLFAASFPDWFGDLGLSAYTLFQIMTLESWSMGIVRPVMQVYPYAWLFFVPF IMITTFAVVNLLVGLIVNSMQDAHHAEDGERTDAYRDEVLARLEQIDQRLNALGETKK ; _struct_ref.pdbx_align_begin 118 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7PGF C 1 ? 138 ? A0A7Y7EFG5 118 ? 255 ? 121 258 2 1 7PGF D 1 ? 138 ? A0A7Y7EFG5 118 ? 255 ? 121 258 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7PGF ASP C 56 ? UNP A0A7Y7EFG5 GLU 173 'engineered mutation' 176 1 1 7PGF ASP C 57 ? UNP A0A7Y7EFG5 SER 174 'engineered mutation' 177 2 1 7PGF ASP C 60 ? UNP A0A7Y7EFG5 MET 177 'engineered mutation' 180 3 2 7PGF ASP D 56 ? UNP A0A7Y7EFG5 GLU 173 'engineered mutation' 176 4 2 7PGF ASP D 57 ? UNP A0A7Y7EFG5 SER 174 'engineered mutation' 177 5 2 7PGF ASP D 60 ? UNP A0A7Y7EFG5 MET 177 'engineered mutation' 180 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PGF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 5.43 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 77.37 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;CaVSp1p purified in DM was concentrated to 13 mg mL-1 and reconstituted in bicelles prior crystallization to a final bicelle concentration of 8%. Native crystals grew in 25% PEG4000, 200 mM MgCl2, 100 mM MES, pH 6.5 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR CCD 130 mm' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-10-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.11587 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.11587 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 139.32 _reflns.entry_id 7PGF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.5 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9000 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.17 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.5 _reflns.pdbx_Rmerge_I_obs 0.156 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.5 _reflns_shell.d_res_low 3.622 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 879 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.126 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 153.64 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7PGF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.50 _refine.ls_d_res_low 14.93 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9000 _refine.ls_number_reflns_R_free 423 _refine.ls_number_reflns_R_work 8577 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.86 _refine.ls_percent_reflns_R_free 4.70 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2658 _refine.ls_R_factor_R_free 0.2897 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2646 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 37.3678 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5953 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.50 _refine_hist.d_res_low 14.93 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2031 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2031 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0100 ? 2080 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.4487 ? 2841 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0756 ? 337 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0119 ? 357 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 8.1736 ? 279 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.50 4.00 . . 145 2786 99.97 . . . 0.4222 . 0.3787 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.00 5.01 . . 139 2827 99.93 . . . 0.3293 . 0.2756 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.01 14.93 . . 139 2964 99.68 . . . 0.2337 . 0.2333 . . . . . . . . . . . # loop_ _struct_ncs_oper.code _struct_ncs_oper.id _struct_ncs_oper.matrix[1][1] _struct_ncs_oper.matrix[1][2] _struct_ncs_oper.matrix[1][3] _struct_ncs_oper.matrix[2][1] _struct_ncs_oper.matrix[2][2] _struct_ncs_oper.matrix[2][3] _struct_ncs_oper.matrix[3][1] _struct_ncs_oper.matrix[3][2] _struct_ncs_oper.matrix[3][3] _struct_ncs_oper.vector[1] _struct_ncs_oper.vector[2] _struct_ncs_oper.vector[3] _struct_ncs_oper.details given 1 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 ? given 2 0.754624 0.421710 0.502697 0.442207 0.239151 -0.864442 -0.484764 0.874624 -0.006014 -38.151619 68.417992 -55.393169 ? # loop_ _struct_ncs_dom.id _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.details 1 1 ? 2 1 ? # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id 1 1 ? ? ? ? ;(chain 'C' and ((resid 121 through 123 and (name N or name CA or name C or name O or name CB )) or resid 124 through 132 or resid 134 through 170 or resid 172 through 176 or resid 182 through 183 or (resid 184 and (name N or name CA or name C or name O or name CB )) or resid 185 through 205 or resid 207 through 248 or (resid 249 and (name N or name CA or name C or name O or name CB )) or resid 250 through 254)) ; 1 ? ? ? ? ? ? ? ? ? 1 2 ? ? ? ? ;(chain 'D' and (resid 121 through 132 or (resid 134 and (name N or name CA or name C or name O or name CB )) or resid 135 through 170 or resid 172 through 176 or resid 182 through 205 or resid 207 through 254)) ; 2 ? ? ? ? ? ? ? ? ? # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7PGF _struct.title 'Calcium-selective Sp1 channel pore domain only' _struct.pdbx_structure_determination_methodology ? _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PGF _struct_keywords.text 'ion channel membrane protein transport protein antibody complex, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 4 ? ALA A 32 ? THR C 124 ALA C 152 1 ? 29 HELX_P HELX_P2 AA2 PHE A 35 ? GLY A 40 ? PHE C 155 GLY C 160 1 ? 6 HELX_P HELX_P3 AA3 ASP A 41 ? LEU A 55 ? ASP C 161 LEU C 175 1 ? 15 HELX_P HELX_P4 AA4 VAL A 63 ? TYR A 70 ? VAL C 183 TYR C 190 1 ? 8 HELX_P HELX_P5 AA5 ALA A 73 ? HIS A 105 ? ALA C 193 HIS C 225 1 ? 33 HELX_P HELX_P6 AA6 ALA A 106 ? ASN A 131 ? ALA C 226 ASN C 251 1 ? 26 HELX_P HELX_P7 AA7 THR B 4 ? ALA B 32 ? THR D 124 ALA D 152 1 ? 29 HELX_P HELX_P8 AA8 PHE B 35 ? GLY B 40 ? PHE D 155 GLY D 160 1 ? 6 HELX_P HELX_P9 AA9 ASP B 41 ? LEU B 55 ? ASP D 161 LEU D 175 1 ? 15 HELX_P HELX_P10 AB1 SER B 59 ? TYR B 70 ? SER D 179 TYR D 190 1 ? 12 HELX_P HELX_P11 AB2 ALA B 73 ? HIS B 105 ? ALA D 193 HIS D 225 1 ? 33 HELX_P HELX_P12 AB3 ALA B 106 ? ASN B 131 ? ALA D 226 ASN D 251 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 1 _struct_mon_prot_cis.label_asym_id B _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 121 _struct_mon_prot_cis.auth_asym_id D _struct_mon_prot_cis.pdbx_label_comp_id_2 PHE _struct_mon_prot_cis.pdbx_label_seq_id_2 2 _struct_mon_prot_cis.pdbx_label_asym_id_2 B _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PHE _struct_mon_prot_cis.pdbx_auth_seq_id_2 122 _struct_mon_prot_cis.pdbx_auth_asym_id_2 D _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 29.55 # _atom_sites.entry_id 7PGF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.007480 _atom_sites.fract_transf_matrix[1][2] 0.004319 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008638 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007649 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 121 121 GLY GLY C . n A 1 2 PHE 2 122 122 PHE PHE C . n A 1 3 ILE 3 123 123 ILE ILE C . n A 1 4 THR 4 124 124 THR THR C . n A 1 5 ALA 5 125 125 ALA ALA C . n A 1 6 LEU 6 126 126 LEU LEU C . n A 1 7 PRO 7 127 127 PRO PRO C . n A 1 8 GLY 8 128 128 GLY GLY C . n A 1 9 MET 9 129 129 MET MET C . n A 1 10 ALA 10 130 130 ALA ALA C . n A 1 11 SER 11 131 131 SER SER C . n A 1 12 VAL 12 132 132 VAL VAL C . n A 1 13 PHE 13 133 133 PHE PHE C . n A 1 14 LEU 14 134 134 LEU LEU C . n A 1 15 LEU 15 135 135 LEU LEU C . n A 1 16 MET 16 136 136 MET MET C . n A 1 17 THR 17 137 137 THR THR C . n A 1 18 ILE 18 138 138 ILE ILE C . n A 1 19 ILE 19 139 139 ILE ILE C . n A 1 20 PHE 20 140 140 PHE PHE C . n A 1 21 TYR 21 141 141 TYR TYR C . n A 1 22 ILE 22 142 142 ILE ILE C . n A 1 23 GLY 23 143 143 GLY GLY C . n A 1 24 ALA 24 144 144 ALA ALA C . n A 1 25 VAL 25 145 145 VAL VAL C . n A 1 26 ILE 26 146 146 ILE ILE C . n A 1 27 ALA 27 147 147 ALA ALA C . n A 1 28 THR 28 148 148 THR THR C . n A 1 29 LYS 29 149 149 LYS LYS C . n A 1 30 LEU 30 150 150 LEU LEU C . n A 1 31 PHE 31 151 151 PHE PHE C . n A 1 32 ALA 32 152 152 ALA ALA C . n A 1 33 ALA 33 153 153 ALA ALA C . n A 1 34 SER 34 154 154 SER SER C . n A 1 35 PHE 35 155 155 PHE PHE C . n A 1 36 PRO 36 156 156 PRO PRO C . n A 1 37 ASP 37 157 157 ASP ASP C . n A 1 38 TRP 38 158 158 TRP TRP C . n A 1 39 PHE 39 159 159 PHE PHE C . n A 1 40 GLY 40 160 160 GLY GLY C . n A 1 41 ASP 41 161 161 ASP ASP C . n A 1 42 LEU 42 162 162 LEU LEU C . n A 1 43 GLY 43 163 163 GLY GLY C . n A 1 44 LEU 44 164 164 LEU LEU C . n A 1 45 SER 45 165 165 SER SER C . n A 1 46 ALA 46 166 166 ALA ALA C . n A 1 47 TYR 47 167 167 TYR TYR C . n A 1 48 THR 48 168 168 THR THR C . n A 1 49 LEU 49 169 169 LEU LEU C . n A 1 50 PHE 50 170 170 PHE PHE C . n A 1 51 GLN 51 171 171 GLN ALA C . n A 1 52 ILE 52 172 172 ILE ILE C . n A 1 53 MET 53 173 173 MET MET C . n A 1 54 THR 54 174 174 THR THR C . n A 1 55 LEU 55 175 175 LEU LEU C . n A 1 56 ASP 56 176 176 ASP ASP C . n A 1 57 ASP 57 177 177 ASP SER C . n A 1 58 TRP 58 178 ? ? ? C . n A 1 59 SER 59 179 ? ? ? C . n A 1 60 ASP 60 180 ? ? ? C . n A 1 61 GLY 61 181 ? ? ? C . n A 1 62 ILE 62 182 182 ILE ILE C . n A 1 63 VAL 63 183 183 VAL VAL C . n A 1 64 ARG 64 184 184 ARG ARG C . n A 1 65 PRO 65 185 185 PRO PRO C . n A 1 66 VAL 66 186 186 VAL VAL C . n A 1 67 MET 67 187 187 MET MET C . n A 1 68 GLN 68 188 188 GLN GLN C . n A 1 69 VAL 69 189 189 VAL VAL C . n A 1 70 TYR 70 190 190 TYR TYR C . n A 1 71 PRO 71 191 191 PRO PRO C . n A 1 72 TYR 72 192 192 TYR TYR C . n A 1 73 ALA 73 193 193 ALA ALA C . n A 1 74 TRP 74 194 194 TRP TRP C . n A 1 75 LEU 75 195 195 LEU LEU C . n A 1 76 PHE 76 196 196 PHE PHE C . n A 1 77 PHE 77 197 197 PHE PHE C . n A 1 78 VAL 78 198 198 VAL VAL C . n A 1 79 PRO 79 199 199 PRO PRO C . n A 1 80 PHE 80 200 200 PHE PHE C . n A 1 81 ILE 81 201 201 ILE ILE C . n A 1 82 MET 82 202 202 MET MET C . n A 1 83 ILE 83 203 203 ILE ILE C . n A 1 84 THR 84 204 204 THR THR C . n A 1 85 THR 85 205 205 THR THR C . n A 1 86 PHE 86 206 206 PHE PHE C . n A 1 87 ALA 87 207 207 ALA ALA C . n A 1 88 VAL 88 208 208 VAL VAL C . n A 1 89 VAL 89 209 209 VAL VAL C . n A 1 90 ASN 90 210 210 ASN ASN C . n A 1 91 LEU 91 211 211 LEU LEU C . n A 1 92 LEU 92 212 212 LEU LEU C . n A 1 93 VAL 93 213 213 VAL VAL C . n A 1 94 GLY 94 214 214 GLY GLY C . n A 1 95 LEU 95 215 215 LEU LEU C . n A 1 96 ILE 96 216 216 ILE ILE C . n A 1 97 VAL 97 217 217 VAL VAL C . n A 1 98 ASN 98 218 218 ASN ASN C . n A 1 99 SER 99 219 219 SER SER C . n A 1 100 MET 100 220 220 MET MET C . n A 1 101 GLN 101 221 221 GLN GLN C . n A 1 102 ASP 102 222 222 ASP ASP C . n A 1 103 ALA 103 223 223 ALA ALA C . n A 1 104 HIS 104 224 224 HIS HIS C . n A 1 105 HIS 105 225 225 HIS HIS C . n A 1 106 ALA 106 226 226 ALA ALA C . n A 1 107 GLU 107 227 227 GLU GLU C . n A 1 108 ASP 108 228 228 ASP ASP C . n A 1 109 GLY 109 229 229 GLY GLY C . n A 1 110 GLU 110 230 230 GLU GLU C . n A 1 111 ARG 111 231 231 ARG ARG C . n A 1 112 THR 112 232 232 THR THR C . n A 1 113 ASP 113 233 233 ASP ASP C . n A 1 114 ALA 114 234 234 ALA ALA C . n A 1 115 TYR 115 235 235 TYR TYR C . n A 1 116 ARG 116 236 236 ARG ARG C . n A 1 117 ASP 117 237 237 ASP ASP C . n A 1 118 GLU 118 238 238 GLU GLU C . n A 1 119 VAL 119 239 239 VAL VAL C . n A 1 120 LEU 120 240 240 LEU LEU C . n A 1 121 ALA 121 241 241 ALA ALA C . n A 1 122 ARG 122 242 242 ARG ARG C . n A 1 123 LEU 123 243 243 LEU LEU C . n A 1 124 GLU 124 244 244 GLU GLU C . n A 1 125 GLN 125 245 245 GLN GLN C . n A 1 126 ILE 126 246 246 ILE ILE C . n A 1 127 ASP 127 247 247 ASP ASP C . n A 1 128 GLN 128 248 248 GLN GLN C . n A 1 129 ARG 129 249 249 ARG ARG C . n A 1 130 LEU 130 250 250 LEU LEU C . n A 1 131 ASN 131 251 251 ASN ASN C . n A 1 132 ALA 132 252 252 ALA ALA C . n A 1 133 LEU 133 253 253 LEU LEU C . n A 1 134 GLY 134 254 254 GLY GLY C . n A 1 135 GLU 135 255 ? ? ? C . n A 1 136 THR 136 256 ? ? ? C . n A 1 137 LYS 137 257 ? ? ? C . n A 1 138 LYS 138 258 ? ? ? C . n B 1 1 GLY 1 121 121 GLY GLY D . n B 1 2 PHE 2 122 122 PHE PHE D . n B 1 3 ILE 3 123 123 ILE ILE D . n B 1 4 THR 4 124 124 THR THR D . n B 1 5 ALA 5 125 125 ALA ALA D . n B 1 6 LEU 6 126 126 LEU LEU D . n B 1 7 PRO 7 127 127 PRO PRO D . n B 1 8 GLY 8 128 128 GLY GLY D . n B 1 9 MET 9 129 129 MET MET D . n B 1 10 ALA 10 130 130 ALA ALA D . n B 1 11 SER 11 131 131 SER SER D . n B 1 12 VAL 12 132 132 VAL VAL D . n B 1 13 PHE 13 133 133 PHE PHE D . n B 1 14 LEU 14 134 134 LEU LEU D . n B 1 15 LEU 15 135 135 LEU LEU D . n B 1 16 MET 16 136 136 MET MET D . n B 1 17 THR 17 137 137 THR THR D . n B 1 18 ILE 18 138 138 ILE ILE D . n B 1 19 ILE 19 139 139 ILE ILE D . n B 1 20 PHE 20 140 140 PHE PHE D . n B 1 21 TYR 21 141 141 TYR TYR D . n B 1 22 ILE 22 142 142 ILE ILE D . n B 1 23 GLY 23 143 143 GLY GLY D . n B 1 24 ALA 24 144 144 ALA ALA D . n B 1 25 VAL 25 145 145 VAL VAL D . n B 1 26 ILE 26 146 146 ILE ILE D . n B 1 27 ALA 27 147 147 ALA ALA D . n B 1 28 THR 28 148 148 THR THR D . n B 1 29 LYS 29 149 149 LYS LYS D . n B 1 30 LEU 30 150 150 LEU LEU D . n B 1 31 PHE 31 151 151 PHE PHE D . n B 1 32 ALA 32 152 152 ALA ALA D . n B 1 33 ALA 33 153 153 ALA ALA D . n B 1 34 SER 34 154 154 SER SER D . n B 1 35 PHE 35 155 155 PHE PHE D . n B 1 36 PRO 36 156 156 PRO PRO D . n B 1 37 ASP 37 157 157 ASP ASP D . n B 1 38 TRP 38 158 158 TRP TRP D . n B 1 39 PHE 39 159 159 PHE PHE D . n B 1 40 GLY 40 160 160 GLY GLY D . n B 1 41 ASP 41 161 161 ASP ASP D . n B 1 42 LEU 42 162 162 LEU LEU D . n B 1 43 GLY 43 163 163 GLY GLY D . n B 1 44 LEU 44 164 164 LEU LEU D . n B 1 45 SER 45 165 165 SER SER D . n B 1 46 ALA 46 166 166 ALA ALA D . n B 1 47 TYR 47 167 167 TYR TYR D . n B 1 48 THR 48 168 168 THR THR D . n B 1 49 LEU 49 169 169 LEU LEU D . n B 1 50 PHE 50 170 170 PHE PHE D . n B 1 51 GLN 51 171 171 GLN GLN D . n B 1 52 ILE 52 172 172 ILE ILE D . n B 1 53 MET 53 173 173 MET MET D . n B 1 54 THR 54 174 174 THR THR D . n B 1 55 LEU 55 175 175 LEU LEU D . n B 1 56 ASP 56 176 176 ASP ASP D . n B 1 57 ASP 57 177 177 ASP ASP D . n B 1 58 TRP 58 178 178 TRP TRP D . n B 1 59 SER 59 179 179 SER SER D . n B 1 60 ASP 60 180 180 ASP ASP D . n B 1 61 GLY 61 181 181 GLY GLY D . n B 1 62 ILE 62 182 182 ILE ILE D . n B 1 63 VAL 63 183 183 VAL VAL D . n B 1 64 ARG 64 184 184 ARG ARG D . n B 1 65 PRO 65 185 185 PRO PRO D . n B 1 66 VAL 66 186 186 VAL VAL D . n B 1 67 MET 67 187 187 MET MET D . n B 1 68 GLN 68 188 188 GLN GLN D . n B 1 69 VAL 69 189 189 VAL VAL D . n B 1 70 TYR 70 190 190 TYR TYR D . n B 1 71 PRO 71 191 191 PRO PRO D . n B 1 72 TYR 72 192 192 TYR TYR D . n B 1 73 ALA 73 193 193 ALA ALA D . n B 1 74 TRP 74 194 194 TRP TRP D . n B 1 75 LEU 75 195 195 LEU LEU D . n B 1 76 PHE 76 196 196 PHE PHE D . n B 1 77 PHE 77 197 197 PHE PHE D . n B 1 78 VAL 78 198 198 VAL VAL D . n B 1 79 PRO 79 199 199 PRO PRO D . n B 1 80 PHE 80 200 200 PHE PHE D . n B 1 81 ILE 81 201 201 ILE ILE D . n B 1 82 MET 82 202 202 MET MET D . n B 1 83 ILE 83 203 203 ILE ILE D . n B 1 84 THR 84 204 204 THR THR D . n B 1 85 THR 85 205 205 THR THR D . n B 1 86 PHE 86 206 206 PHE PHE D . n B 1 87 ALA 87 207 207 ALA ALA D . n B 1 88 VAL 88 208 208 VAL VAL D . n B 1 89 VAL 89 209 209 VAL VAL D . n B 1 90 ASN 90 210 210 ASN ASN D . n B 1 91 LEU 91 211 211 LEU LEU D . n B 1 92 LEU 92 212 212 LEU LEU D . n B 1 93 VAL 93 213 213 VAL VAL D . n B 1 94 GLY 94 214 214 GLY GLY D . n B 1 95 LEU 95 215 215 LEU LEU D . n B 1 96 ILE 96 216 216 ILE ILE D . n B 1 97 VAL 97 217 217 VAL VAL D . n B 1 98 ASN 98 218 218 ASN ASN D . n B 1 99 SER 99 219 219 SER SER D . n B 1 100 MET 100 220 220 MET MET D . n B 1 101 GLN 101 221 221 GLN GLN D . n B 1 102 ASP 102 222 222 ASP ASP D . n B 1 103 ALA 103 223 223 ALA ALA D . n B 1 104 HIS 104 224 224 HIS HIS D . n B 1 105 HIS 105 225 225 HIS HIS D . n B 1 106 ALA 106 226 226 ALA ALA D . n B 1 107 GLU 107 227 227 GLU GLU D . n B 1 108 ASP 108 228 228 ASP ASP D . n B 1 109 GLY 109 229 229 GLY GLY D . n B 1 110 GLU 110 230 230 GLU GLU D . n B 1 111 ARG 111 231 231 ARG ARG D . n B 1 112 THR 112 232 232 THR THR D . n B 1 113 ASP 113 233 233 ASP ASP D . n B 1 114 ALA 114 234 234 ALA ALA D . n B 1 115 TYR 115 235 235 TYR TYR D . n B 1 116 ARG 116 236 236 ARG ARG D . n B 1 117 ASP 117 237 237 ASP ASP D . n B 1 118 GLU 118 238 238 GLU GLU D . n B 1 119 VAL 119 239 239 VAL VAL D . n B 1 120 LEU 120 240 240 LEU LEU D . n B 1 121 ALA 121 241 241 ALA ALA D . n B 1 122 ARG 122 242 242 ARG ARG D . n B 1 123 LEU 123 243 243 LEU LEU D . n B 1 124 GLU 124 244 244 GLU GLU D . n B 1 125 GLN 125 245 245 GLN GLN D . n B 1 126 ILE 126 246 246 ILE ILE D . n B 1 127 ASP 127 247 247 ASP ASP D . n B 1 128 GLN 128 248 248 GLN GLN D . n B 1 129 ARG 129 249 249 ARG ARG D . n B 1 130 LEU 130 250 250 LEU LEU D . n B 1 131 ASN 131 251 251 ASN ASN D . n B 1 132 ALA 132 252 252 ALA ALA D . n B 1 133 LEU 133 253 253 LEU LEU D . n B 1 134 GLY 134 254 254 GLY GLY D . n B 1 135 GLU 135 255 ? ? ? D . n B 1 136 THR 136 256 ? ? ? D . n B 1 137 LYS 137 257 ? ? ? D . n B 1 138 LYS 138 258 ? ? ? D . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email daniel.minor@ucsf.edu _pdbx_contact_author.name_first Daniel _pdbx_contact_author.name_last Minor _pdbx_contact_author.name_mi 'L. Jr.' _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5998-4214 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-08 2 'Structure model' 1 1 2022-06-15 3 'Structure model' 1 2 2022-06-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_citation.journal_volume' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 6 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 D _pdbx_validate_close_contact.auth_comp_id_1 LEU _pdbx_validate_close_contact.auth_seq_id_1 175 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 N _pdbx_validate_close_contact.auth_asym_id_2 D _pdbx_validate_close_contact.auth_comp_id_2 ASP _pdbx_validate_close_contact.auth_seq_id_2 177 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NH2 _pdbx_validate_symm_contact.auth_asym_id_1 C _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 249 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 D _pdbx_validate_symm_contact.auth_comp_id_2 ALA _pdbx_validate_symm_contact.auth_seq_id_2 153 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 7_455 _pdbx_validate_symm_contact.dist 2.19 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG C ASN 210 ? ? OD1 C ASN 210 ? ? 1.101 1.235 -0.134 0.022 N 2 1 CG C ASN 210 ? ? ND2 C ASN 210 ? ? 1.157 1.324 -0.167 0.025 N 3 1 CG D ASN 210 ? ? OD1 D ASN 210 ? ? 1.101 1.235 -0.134 0.022 N 4 1 CG D ASN 210 ? ? ND2 D ASN 210 ? ? 1.147 1.324 -0.177 0.025 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB C ASP 161 ? ? CG C ASP 161 ? ? OD1 C ASP 161 ? ? 124.03 118.30 5.73 0.90 N 2 1 CA C ARG 242 ? ? CB C ARG 242 ? ? CG C ARG 242 ? ? 129.18 113.40 15.78 2.20 N 3 1 CB C ARG 242 ? ? CG C ARG 242 ? ? CD C ARG 242 ? ? 131.04 111.60 19.44 2.60 N 4 1 CA C LEU 253 ? ? CB C LEU 253 ? ? CG C LEU 253 ? ? 131.26 115.30 15.96 2.30 N 5 1 C D GLY 121 ? ? N D PHE 122 ? ? CA D PHE 122 ? ? 140.04 121.70 18.34 2.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE C 122 ? ? -38.84 -19.96 2 1 TRP C 158 ? ? -144.42 21.60 3 1 ASP C 161 ? ? -37.57 141.43 4 1 LEU C 175 ? ? 76.75 -10.48 5 1 TYR C 192 ? ? 58.08 11.65 6 1 PHE D 122 ? ? 60.40 -33.34 7 1 ILE D 123 ? ? -140.37 -15.21 8 1 TRP D 158 ? ? -144.52 21.92 9 1 LEU D 175 ? ? 75.07 -26.81 10 1 ASP D 176 ? ? -3.42 47.48 11 1 ASP D 177 ? ? 54.63 -15.25 12 1 TYR D 192 ? ? 57.99 11.54 13 1 ASN D 251 ? ? -69.11 1.83 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 GLY C 121 ? ? PHE C 122 ? ? 135.14 2 1 TRP C 158 ? ? PHE C 159 ? ? 146.19 3 1 TRP D 158 ? ? PHE D 159 ? ? 148.27 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ASN C 218 ? ? 0.090 'SIDE CHAIN' 2 1 ASN D 218 ? ? 0.086 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 C PHE 122 ? CG ? A PHE 2 CG 2 1 Y 1 C PHE 122 ? CD1 ? A PHE 2 CD1 3 1 Y 1 C PHE 122 ? CD2 ? A PHE 2 CD2 4 1 Y 1 C PHE 122 ? CE1 ? A PHE 2 CE1 5 1 Y 1 C PHE 122 ? CE2 ? A PHE 2 CE2 6 1 Y 1 C PHE 122 ? CZ ? A PHE 2 CZ 7 1 Y 1 C LEU 134 ? CG ? A LEU 14 CG 8 1 Y 1 C LEU 134 ? CD1 ? A LEU 14 CD1 9 1 Y 1 C LEU 134 ? CD2 ? A LEU 14 CD2 10 1 Y 1 C LYS 149 ? CG ? A LYS 29 CG 11 1 Y 1 C LYS 149 ? CD ? A LYS 29 CD 12 1 Y 1 C LYS 149 ? CE ? A LYS 29 CE 13 1 Y 1 C LYS 149 ? NZ ? A LYS 29 NZ 14 1 Y 1 C GLN 171 ? CG ? A GLN 51 CG 15 1 Y 1 C GLN 171 ? CD ? A GLN 51 CD 16 1 Y 1 C GLN 171 ? OE1 ? A GLN 51 OE1 17 1 Y 1 C GLN 171 ? NE2 ? A GLN 51 NE2 18 1 Y 1 C ASP 177 ? CG ? A ASP 57 CG 19 1 Y 1 C ASP 177 ? OD1 ? A ASP 57 OD1 20 1 Y 1 C ASP 177 ? OD2 ? A ASP 57 OD2 21 1 Y 1 D PHE 122 ? CG ? B PHE 2 CG 22 1 Y 1 D PHE 122 ? CD1 ? B PHE 2 CD1 23 1 Y 1 D PHE 122 ? CD2 ? B PHE 2 CD2 24 1 Y 1 D PHE 122 ? CE1 ? B PHE 2 CE1 25 1 Y 1 D PHE 122 ? CE2 ? B PHE 2 CE2 26 1 Y 1 D PHE 122 ? CZ ? B PHE 2 CZ 27 1 Y 1 D ILE 123 ? CG1 ? B ILE 3 CG1 28 1 Y 1 D ILE 123 ? CG2 ? B ILE 3 CG2 29 1 Y 1 D ILE 123 ? CD1 ? B ILE 3 CD1 30 1 Y 1 D LYS 149 ? CG ? B LYS 29 CG 31 1 Y 1 D LYS 149 ? CD ? B LYS 29 CD 32 1 Y 1 D LYS 149 ? CE ? B LYS 29 CE 33 1 Y 1 D LYS 149 ? NZ ? B LYS 29 NZ 34 1 Y 1 D TRP 178 ? CG ? B TRP 58 CG 35 1 Y 1 D TRP 178 ? CD1 ? B TRP 58 CD1 36 1 Y 1 D TRP 178 ? CD2 ? B TRP 58 CD2 37 1 Y 1 D TRP 178 ? NE1 ? B TRP 58 NE1 38 1 Y 1 D TRP 178 ? CE2 ? B TRP 58 CE2 39 1 Y 1 D TRP 178 ? CE3 ? B TRP 58 CE3 40 1 Y 1 D TRP 178 ? CZ2 ? B TRP 58 CZ2 41 1 Y 1 D TRP 178 ? CZ3 ? B TRP 58 CZ3 42 1 Y 1 D TRP 178 ? CH2 ? B TRP 58 CH2 43 1 Y 1 D ASP 180 ? CG ? B ASP 60 CG 44 1 Y 1 D ASP 180 ? OD1 ? B ASP 60 OD1 45 1 Y 1 D ASP 180 ? OD2 ? B ASP 60 OD2 46 1 Y 1 D ARG 184 ? CG ? B ARG 64 CG 47 1 Y 1 D ARG 184 ? CD ? B ARG 64 CD 48 1 Y 1 D ARG 184 ? NE ? B ARG 64 NE 49 1 Y 1 D ARG 184 ? CZ ? B ARG 64 CZ 50 1 Y 1 D ARG 184 ? NH1 ? B ARG 64 NH1 51 1 Y 1 D ARG 184 ? NH2 ? B ARG 64 NH2 52 1 Y 1 D ARG 249 ? CG ? B ARG 129 CG 53 1 Y 1 D ARG 249 ? CD ? B ARG 129 CD 54 1 Y 1 D ARG 249 ? NE ? B ARG 129 NE 55 1 Y 1 D ARG 249 ? CZ ? B ARG 129 CZ 56 1 Y 1 D ARG 249 ? NH1 ? B ARG 129 NH1 57 1 Y 1 D ARG 249 ? NH2 ? B ARG 129 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 C TRP 178 ? A TRP 58 2 1 Y 1 C SER 179 ? A SER 59 3 1 Y 1 C ASP 180 ? A ASP 60 4 1 Y 1 C GLY 181 ? A GLY 61 5 1 Y 1 C GLU 255 ? A GLU 135 6 1 Y 1 C THR 256 ? A THR 136 7 1 Y 1 C LYS 257 ? A LYS 137 8 1 Y 1 C LYS 258 ? A LYS 138 9 1 Y 1 D GLU 255 ? B GLU 135 10 1 Y 1 D THR 256 ? B THR 136 11 1 Y 1 D LYS 257 ? B LYS 137 12 1 Y 1 D LYS 258 ? B LYS 138 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Heart, Lung, and Blood Institute (NIH/NHLBI)' 'United States' ? 1 'National Institutes of Health/National Institute on Deafness and Other Communication Disorders (NIH/NIDCD)' 'United States' ? 2 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' ? 3 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #