data_7PGI # _entry.id 7PGI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PGI pdb_00007pgi 10.2210/pdb7pgi/pdb WWPDB D_1292117656 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-08 2 'Structure model' 1 1 2022-06-15 3 'Structure model' 1 2 2022-06-29 4 'Structure model' 1 3 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_citation.journal_volume' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7PGI _pdbx_database_status.recvd_initial_deposition_date 2021-08-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'NaVAb1p detergent (DM)' 7PGG unspecified PDB 'CaVSp1p (bicelles)' 7PGF unspecified PDB 'NaVAe1/Sp1CTDp :SAT09 complex' 7PGP unspecified PDB 'NaVAe1/Sp1CTDp :ANT05 complex' 7PG8 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lolicato, M.' 1 0000-0002-2022-7961 'Arrigoni, C.' 2 0000-0003-1917-1750 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1545-9985 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 537 _citation.page_last 548 _citation.title 'Quaternary structure independent folding of voltage-gated ion channel pore domain subunits.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41594-022-00775-x _citation.pdbx_database_id_PubMed 35655098 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Arrigoni, C.' 1 ? primary 'Lolicato, M.' 2 ? primary 'Shaya, D.' 3 ? primary 'Rohaim, A.' 4 ? primary 'Findeisen, F.' 5 ? primary 'Fong, L.K.' 6 ? primary 'Colleran, C.M.' 7 ? primary 'Dominik, P.' 8 ? primary 'Kim, S.S.' 9 ? primary 'Schuermann, J.P.' 10 ? primary 'DeGrado, W.F.' 11 ? primary 'Grabe, M.' 12 ? primary 'Kossiakoff, A.A.' 13 ? primary 'Minor Jr., D.L.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ion transport protein' 16946.805 8 ? ? ? ? 2 non-polymer syn 'ACETATE ION' 59.044 6 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 4 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VESLMQALPGIGWTAALLLMMFYIFAVMGTELFGEAFPQWFGSLGASIYSLFQIMTLESWSMGIARPVMEVYPLAWIFFV PFILISSFMVLNLFIAIIVSATQEVHESEQRAEREANNLIAHDERQEMLDLMRAMHAKIVALEQQGKAGQ ; _entity_poly.pdbx_seq_one_letter_code_can ;VESLMQALPGIGWTAALLLMMFYIFAVMGTELFGEAFPQWFGSLGASIYSLFQIMTLESWSMGIARPVMEVYPLAWIFFV PFILISSFMVLNLFIAIIVSATQEVHESEQRAEREANNLIAHDERQEMLDLMRAMHAKIVALEQQGKAGQ ; _entity_poly.pdbx_strand_id A,B,C,D,E,F,G,H _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ACETATE ION' ACT 3 'SODIUM ION' NA 4 'MAGNESIUM ION' MG # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 GLU n 1 3 SER n 1 4 LEU n 1 5 MET n 1 6 GLN n 1 7 ALA n 1 8 LEU n 1 9 PRO n 1 10 GLY n 1 11 ILE n 1 12 GLY n 1 13 TRP n 1 14 THR n 1 15 ALA n 1 16 ALA n 1 17 LEU n 1 18 LEU n 1 19 LEU n 1 20 MET n 1 21 MET n 1 22 PHE n 1 23 TYR n 1 24 ILE n 1 25 PHE n 1 26 ALA n 1 27 VAL n 1 28 MET n 1 29 GLY n 1 30 THR n 1 31 GLU n 1 32 LEU n 1 33 PHE n 1 34 GLY n 1 35 GLU n 1 36 ALA n 1 37 PHE n 1 38 PRO n 1 39 GLN n 1 40 TRP n 1 41 PHE n 1 42 GLY n 1 43 SER n 1 44 LEU n 1 45 GLY n 1 46 ALA n 1 47 SER n 1 48 ILE n 1 49 TYR n 1 50 SER n 1 51 LEU n 1 52 PHE n 1 53 GLN n 1 54 ILE n 1 55 MET n 1 56 THR n 1 57 LEU n 1 58 GLU n 1 59 SER n 1 60 TRP n 1 61 SER n 1 62 MET n 1 63 GLY n 1 64 ILE n 1 65 ALA n 1 66 ARG n 1 67 PRO n 1 68 VAL n 1 69 MET n 1 70 GLU n 1 71 VAL n 1 72 TYR n 1 73 PRO n 1 74 LEU n 1 75 ALA n 1 76 TRP n 1 77 ILE n 1 78 PHE n 1 79 PHE n 1 80 VAL n 1 81 PRO n 1 82 PHE n 1 83 ILE n 1 84 LEU n 1 85 ILE n 1 86 SER n 1 87 SER n 1 88 PHE n 1 89 MET n 1 90 VAL n 1 91 LEU n 1 92 ASN n 1 93 LEU n 1 94 PHE n 1 95 ILE n 1 96 ALA n 1 97 ILE n 1 98 ILE n 1 99 VAL n 1 100 SER n 1 101 ALA n 1 102 THR n 1 103 GLN n 1 104 GLU n 1 105 VAL n 1 106 HIS n 1 107 GLU n 1 108 SER n 1 109 GLU n 1 110 GLN n 1 111 ARG n 1 112 ALA n 1 113 GLU n 1 114 ARG n 1 115 GLU n 1 116 ALA n 1 117 ASN n 1 118 ASN n 1 119 LEU n 1 120 ILE n 1 121 ALA n 1 122 HIS n 1 123 ASP n 1 124 GLU n 1 125 ARG n 1 126 GLN n 1 127 GLU n 1 128 MET n 1 129 LEU n 1 130 ASP n 1 131 LEU n 1 132 MET n 1 133 ARG n 1 134 ALA n 1 135 MET n 1 136 HIS n 1 137 ALA n 1 138 LYS n 1 139 ILE n 1 140 VAL n 1 141 ALA n 1 142 LEU n 1 143 GLU n 1 144 GLN n 1 145 GLN n 1 146 GLY n 1 147 LYS n 1 148 ALA n 1 149 GLY n 1 150 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 150 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ABO_1668 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 393595 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 132 ? ? ? A . n A 1 2 GLU 2 133 133 GLU GLU A . n A 1 3 SER 3 134 134 SER SER A . n A 1 4 LEU 4 135 135 LEU LEU A . n A 1 5 MET 5 136 136 MET MET A . n A 1 6 GLN 6 137 137 GLN GLN A . n A 1 7 ALA 7 138 138 ALA ALA A . n A 1 8 LEU 8 139 139 LEU LEU A . n A 1 9 PRO 9 140 140 PRO PRO A . n A 1 10 GLY 10 141 141 GLY GLY A . n A 1 11 ILE 11 142 142 ILE ILE A . n A 1 12 GLY 12 143 143 GLY GLY A . n A 1 13 TRP 13 144 144 TRP TRP A . n A 1 14 THR 14 145 145 THR THR A . n A 1 15 ALA 15 146 146 ALA ALA A . n A 1 16 ALA 16 147 147 ALA ALA A . n A 1 17 LEU 17 148 148 LEU LEU A . n A 1 18 LEU 18 149 149 LEU LEU A . n A 1 19 LEU 19 150 150 LEU LEU A . n A 1 20 MET 20 151 151 MET MET A . n A 1 21 MET 21 152 152 MET MET A . n A 1 22 PHE 22 153 153 PHE PHE A . n A 1 23 TYR 23 154 154 TYR TYR A . n A 1 24 ILE 24 155 155 ILE ILE A . n A 1 25 PHE 25 156 156 PHE PHE A . n A 1 26 ALA 26 157 157 ALA ALA A . n A 1 27 VAL 27 158 158 VAL VAL A . n A 1 28 MET 28 159 159 MET MET A . n A 1 29 GLY 29 160 160 GLY GLY A . n A 1 30 THR 30 161 161 THR THR A . n A 1 31 GLU 31 162 162 GLU GLU A . n A 1 32 LEU 32 163 163 LEU LEU A . n A 1 33 PHE 33 164 164 PHE PHE A . n A 1 34 GLY 34 165 165 GLY GLY A . n A 1 35 GLU 35 166 166 GLU GLU A . n A 1 36 ALA 36 167 167 ALA ALA A . n A 1 37 PHE 37 168 168 PHE PHE A . n A 1 38 PRO 38 169 169 PRO PRO A . n A 1 39 GLN 39 170 170 GLN GLN A . n A 1 40 TRP 40 171 171 TRP TRP A . n A 1 41 PHE 41 172 172 PHE PHE A . n A 1 42 GLY 42 173 173 GLY GLY A . n A 1 43 SER 43 174 174 SER SER A . n A 1 44 LEU 44 175 175 LEU LEU A . n A 1 45 GLY 45 176 176 GLY GLY A . n A 1 46 ALA 46 177 177 ALA ALA A . n A 1 47 SER 47 178 178 SER SER A . n A 1 48 ILE 48 179 179 ILE ILE A . n A 1 49 TYR 49 180 180 TYR TYR A . n A 1 50 SER 50 181 181 SER SER A . n A 1 51 LEU 51 182 182 LEU LEU A . n A 1 52 PHE 52 183 183 PHE PHE A . n A 1 53 GLN 53 184 184 GLN GLN A . n A 1 54 ILE 54 185 185 ILE ILE A . n A 1 55 MET 55 186 186 MET MET A . n A 1 56 THR 56 187 187 THR THR A . n A 1 57 LEU 57 188 188 LEU LEU A . n A 1 58 GLU 58 189 189 GLU GLU A . n A 1 59 SER 59 190 190 SER SER A . n A 1 60 TRP 60 191 191 TRP TRP A . n A 1 61 SER 61 192 192 SER ALA A . n A 1 62 MET 62 193 193 MET MET A . n A 1 63 GLY 63 194 194 GLY GLY A . n A 1 64 ILE 64 195 195 ILE ILE A . n A 1 65 ALA 65 196 196 ALA ALA A . n A 1 66 ARG 66 197 197 ARG ARG A . n A 1 67 PRO 67 198 198 PRO PRO A . n A 1 68 VAL 68 199 199 VAL VAL A . n A 1 69 MET 69 200 200 MET MET A . n A 1 70 GLU 70 201 201 GLU GLU A . n A 1 71 VAL 71 202 202 VAL VAL A . n A 1 72 TYR 72 203 203 TYR TYR A . n A 1 73 PRO 73 204 204 PRO PRO A . n A 1 74 LEU 74 205 205 LEU LEU A . n A 1 75 ALA 75 206 206 ALA ALA A . n A 1 76 TRP 76 207 207 TRP TRP A . n A 1 77 ILE 77 208 208 ILE ILE A . n A 1 78 PHE 78 209 209 PHE PHE A . n A 1 79 PHE 79 210 210 PHE PHE A . n A 1 80 VAL 80 211 211 VAL VAL A . n A 1 81 PRO 81 212 212 PRO PRO A . n A 1 82 PHE 82 213 213 PHE PHE A . n A 1 83 ILE 83 214 214 ILE ILE A . n A 1 84 LEU 84 215 215 LEU LEU A . n A 1 85 ILE 85 216 216 ILE ILE A . n A 1 86 SER 86 217 217 SER SER A . n A 1 87 SER 87 218 218 SER SER A . n A 1 88 PHE 88 219 219 PHE PHE A . n A 1 89 MET 89 220 220 MET MET A . n A 1 90 VAL 90 221 221 VAL VAL A . n A 1 91 LEU 91 222 222 LEU LEU A . n A 1 92 ASN 92 223 223 ASN ASN A . n A 1 93 LEU 93 224 224 LEU LEU A . n A 1 94 PHE 94 225 225 PHE PHE A . n A 1 95 ILE 95 226 226 ILE ILE A . n A 1 96 ALA 96 227 227 ALA ALA A . n A 1 97 ILE 97 228 228 ILE ILE A . n A 1 98 ILE 98 229 229 ILE ILE A . n A 1 99 VAL 99 230 230 VAL VAL A . n A 1 100 SER 100 231 231 SER SER A . n A 1 101 ALA 101 232 232 ALA ALA A . n A 1 102 THR 102 233 233 THR THR A . n A 1 103 GLN 103 234 234 GLN GLN A . n A 1 104 GLU 104 235 235 GLU GLU A . n A 1 105 VAL 105 236 236 VAL VAL A . n A 1 106 HIS 106 237 237 HIS HIS A . n A 1 107 GLU 107 238 238 GLU GLU A . n A 1 108 SER 108 239 239 SER SER A . n A 1 109 GLU 109 240 240 GLU GLU A . n A 1 110 GLN 110 241 241 GLN GLN A . n A 1 111 ARG 111 242 242 ARG ARG A . n A 1 112 ALA 112 243 243 ALA ALA A . n A 1 113 GLU 113 244 244 GLU GLU A . n A 1 114 ARG 114 245 245 ARG ARG A . n A 1 115 GLU 115 246 246 GLU GLU A . n A 1 116 ALA 116 247 247 ALA ALA A . n A 1 117 ASN 117 248 248 ASN ASN A . n A 1 118 ASN 118 249 249 ASN ASN A . n A 1 119 LEU 119 250 250 LEU LEU A . n A 1 120 ILE 120 251 251 ILE ILE A . n A 1 121 ALA 121 252 252 ALA ALA A . n A 1 122 HIS 122 253 253 HIS HIS A . n A 1 123 ASP 123 254 254 ASP ASP A . n A 1 124 GLU 124 255 255 GLU GLU A . n A 1 125 ARG 125 256 256 ARG ARG A . n A 1 126 GLN 126 257 257 GLN GLN A . n A 1 127 GLU 127 258 258 GLU GLU A . n A 1 128 MET 128 259 259 MET MET A . n A 1 129 LEU 129 260 260 LEU LEU A . n A 1 130 ASP 130 261 261 ASP ASP A . n A 1 131 LEU 131 262 262 LEU LEU A . n A 1 132 MET 132 263 263 MET MET A . n A 1 133 ARG 133 264 264 ARG ARG A . n A 1 134 ALA 134 265 265 ALA ALA A . n A 1 135 MET 135 266 266 MET MET A . n A 1 136 HIS 136 267 267 HIS HIS A . n A 1 137 ALA 137 268 268 ALA ALA A . n A 1 138 LYS 138 269 269 LYS LYS A . n A 1 139 ILE 139 270 270 ILE ILE A . n A 1 140 VAL 140 271 271 VAL VAL A . n A 1 141 ALA 141 272 272 ALA ALA A . n A 1 142 LEU 142 273 273 LEU LEU A . n A 1 143 GLU 143 274 274 GLU GLU A . n A 1 144 GLN 144 275 275 GLN GLN A . n A 1 145 GLN 145 276 276 GLN GLN A . n A 1 146 GLY 146 277 277 GLY GLY A . n A 1 147 LYS 147 278 278 LYS ALA A . n A 1 148 ALA 148 279 ? ? ? A . n A 1 149 GLY 149 280 ? ? ? A . n A 1 150 GLN 150 281 ? ? ? A . n B 1 1 VAL 1 132 ? ? ? B . n B 1 2 GLU 2 133 133 GLU GLU B . n B 1 3 SER 3 134 134 SER SER B . n B 1 4 LEU 4 135 135 LEU LEU B . n B 1 5 MET 5 136 136 MET MET B . n B 1 6 GLN 6 137 137 GLN GLN B . n B 1 7 ALA 7 138 138 ALA ALA B . n B 1 8 LEU 8 139 139 LEU LEU B . n B 1 9 PRO 9 140 140 PRO PRO B . n B 1 10 GLY 10 141 141 GLY GLY B . n B 1 11 ILE 11 142 142 ILE ILE B . n B 1 12 GLY 12 143 143 GLY GLY B . n B 1 13 TRP 13 144 144 TRP TRP B . n B 1 14 THR 14 145 145 THR THR B . n B 1 15 ALA 15 146 146 ALA ALA B . n B 1 16 ALA 16 147 147 ALA ALA B . n B 1 17 LEU 17 148 148 LEU LEU B . n B 1 18 LEU 18 149 149 LEU LEU B . n B 1 19 LEU 19 150 150 LEU LEU B . n B 1 20 MET 20 151 151 MET MET B . n B 1 21 MET 21 152 152 MET MET B . n B 1 22 PHE 22 153 153 PHE PHE B . n B 1 23 TYR 23 154 154 TYR TYR B . n B 1 24 ILE 24 155 155 ILE ILE B . n B 1 25 PHE 25 156 156 PHE PHE B . n B 1 26 ALA 26 157 157 ALA ALA B . n B 1 27 VAL 27 158 158 VAL VAL B . n B 1 28 MET 28 159 159 MET MET B . n B 1 29 GLY 29 160 160 GLY GLY B . n B 1 30 THR 30 161 161 THR THR B . n B 1 31 GLU 31 162 162 GLU GLU B . n B 1 32 LEU 32 163 163 LEU LEU B . n B 1 33 PHE 33 164 164 PHE PHE B . n B 1 34 GLY 34 165 165 GLY GLY B . n B 1 35 GLU 35 166 166 GLU GLU B . n B 1 36 ALA 36 167 167 ALA ALA B . n B 1 37 PHE 37 168 168 PHE PHE B . n B 1 38 PRO 38 169 169 PRO PRO B . n B 1 39 GLN 39 170 170 GLN GLN B . n B 1 40 TRP 40 171 171 TRP TRP B . n B 1 41 PHE 41 172 172 PHE PHE B . n B 1 42 GLY 42 173 173 GLY GLY B . n B 1 43 SER 43 174 174 SER SER B . n B 1 44 LEU 44 175 175 LEU LEU B . n B 1 45 GLY 45 176 176 GLY GLY B . n B 1 46 ALA 46 177 177 ALA ALA B . n B 1 47 SER 47 178 178 SER SER B . n B 1 48 ILE 48 179 179 ILE ILE B . n B 1 49 TYR 49 180 180 TYR TYR B . n B 1 50 SER 50 181 181 SER SER B . n B 1 51 LEU 51 182 182 LEU LEU B . n B 1 52 PHE 52 183 183 PHE PHE B . n B 1 53 GLN 53 184 184 GLN GLN B . n B 1 54 ILE 54 185 185 ILE ILE B . n B 1 55 MET 55 186 186 MET MET B . n B 1 56 THR 56 187 187 THR THR B . n B 1 57 LEU 57 188 188 LEU LEU B . n B 1 58 GLU 58 189 189 GLU GLU B . n B 1 59 SER 59 190 190 SER SER B . n B 1 60 TRP 60 191 191 TRP TRP B . n B 1 61 SER 61 192 192 SER ALA B . n B 1 62 MET 62 193 193 MET MET B . n B 1 63 GLY 63 194 194 GLY GLY B . n B 1 64 ILE 64 195 195 ILE ILE B . n B 1 65 ALA 65 196 196 ALA ALA B . n B 1 66 ARG 66 197 197 ARG ARG B . n B 1 67 PRO 67 198 198 PRO PRO B . n B 1 68 VAL 68 199 199 VAL VAL B . n B 1 69 MET 69 200 200 MET MET B . n B 1 70 GLU 70 201 201 GLU GLU B . n B 1 71 VAL 71 202 202 VAL VAL B . n B 1 72 TYR 72 203 203 TYR TYR B . n B 1 73 PRO 73 204 204 PRO PRO B . n B 1 74 LEU 74 205 205 LEU LEU B . n B 1 75 ALA 75 206 206 ALA ALA B . n B 1 76 TRP 76 207 207 TRP TRP B . n B 1 77 ILE 77 208 208 ILE ILE B . n B 1 78 PHE 78 209 209 PHE PHE B . n B 1 79 PHE 79 210 210 PHE PHE B . n B 1 80 VAL 80 211 211 VAL VAL B . n B 1 81 PRO 81 212 212 PRO PRO B . n B 1 82 PHE 82 213 213 PHE PHE B . n B 1 83 ILE 83 214 214 ILE ILE B . n B 1 84 LEU 84 215 215 LEU LEU B . n B 1 85 ILE 85 216 216 ILE ILE B . n B 1 86 SER 86 217 217 SER SER B . n B 1 87 SER 87 218 218 SER SER B . n B 1 88 PHE 88 219 219 PHE PHE B . n B 1 89 MET 89 220 220 MET MET B . n B 1 90 VAL 90 221 221 VAL VAL B . n B 1 91 LEU 91 222 222 LEU LEU B . n B 1 92 ASN 92 223 223 ASN ASN B . n B 1 93 LEU 93 224 224 LEU LEU B . n B 1 94 PHE 94 225 225 PHE PHE B . n B 1 95 ILE 95 226 226 ILE ILE B . n B 1 96 ALA 96 227 227 ALA ALA B . n B 1 97 ILE 97 228 228 ILE ILE B . n B 1 98 ILE 98 229 229 ILE ILE B . n B 1 99 VAL 99 230 230 VAL VAL B . n B 1 100 SER 100 231 231 SER SER B . n B 1 101 ALA 101 232 232 ALA ALA B . n B 1 102 THR 102 233 233 THR THR B . n B 1 103 GLN 103 234 234 GLN GLN B . n B 1 104 GLU 104 235 235 GLU GLU B . n B 1 105 VAL 105 236 236 VAL VAL B . n B 1 106 HIS 106 237 237 HIS HIS B . n B 1 107 GLU 107 238 238 GLU GLU B . n B 1 108 SER 108 239 239 SER SER B . n B 1 109 GLU 109 240 240 GLU GLU B . n B 1 110 GLN 110 241 241 GLN GLN B . n B 1 111 ARG 111 242 242 ARG ARG B . n B 1 112 ALA 112 243 243 ALA ALA B . n B 1 113 GLU 113 244 244 GLU GLU B . n B 1 114 ARG 114 245 245 ARG ARG B . n B 1 115 GLU 115 246 246 GLU GLU B . n B 1 116 ALA 116 247 247 ALA ALA B . n B 1 117 ASN 117 248 248 ASN ASN B . n B 1 118 ASN 118 249 249 ASN ASN B . n B 1 119 LEU 119 250 250 LEU LEU B . n B 1 120 ILE 120 251 251 ILE ILE B . n B 1 121 ALA 121 252 252 ALA ALA B . n B 1 122 HIS 122 253 253 HIS HIS B . n B 1 123 ASP 123 254 254 ASP ASP B . n B 1 124 GLU 124 255 255 GLU GLU B . n B 1 125 ARG 125 256 256 ARG ARG B . n B 1 126 GLN 126 257 257 GLN GLN B . n B 1 127 GLU 127 258 258 GLU GLU B . n B 1 128 MET 128 259 259 MET MET B . n B 1 129 LEU 129 260 260 LEU LEU B . n B 1 130 ASP 130 261 261 ASP ASP B . n B 1 131 LEU 131 262 262 LEU LEU B . n B 1 132 MET 132 263 263 MET MET B . n B 1 133 ARG 133 264 264 ARG ARG B . n B 1 134 ALA 134 265 265 ALA ALA B . n B 1 135 MET 135 266 266 MET MET B . n B 1 136 HIS 136 267 267 HIS HIS B . n B 1 137 ALA 137 268 268 ALA ALA B . n B 1 138 LYS 138 269 269 LYS LYS B . n B 1 139 ILE 139 270 270 ILE ILE B . n B 1 140 VAL 140 271 271 VAL VAL B . n B 1 141 ALA 141 272 272 ALA ALA B . n B 1 142 LEU 142 273 273 LEU LEU B . n B 1 143 GLU 143 274 274 GLU GLU B . n B 1 144 GLN 144 275 275 GLN GLN B . n B 1 145 GLN 145 276 276 GLN GLN B . n B 1 146 GLY 146 277 277 GLY GLY B . n B 1 147 LYS 147 278 278 LYS ALA B . n B 1 148 ALA 148 279 ? ? ? B . n B 1 149 GLY 149 280 ? ? ? B . n B 1 150 GLN 150 281 ? ? ? B . n C 1 1 VAL 1 132 ? ? ? C . n C 1 2 GLU 2 133 133 GLU GLU C . n C 1 3 SER 3 134 134 SER SER C . n C 1 4 LEU 4 135 135 LEU LEU C . n C 1 5 MET 5 136 136 MET MET C . n C 1 6 GLN 6 137 137 GLN GLN C . n C 1 7 ALA 7 138 138 ALA ALA C . n C 1 8 LEU 8 139 139 LEU LEU C . n C 1 9 PRO 9 140 140 PRO PRO C . n C 1 10 GLY 10 141 141 GLY GLY C . n C 1 11 ILE 11 142 142 ILE ILE C . n C 1 12 GLY 12 143 143 GLY GLY C . n C 1 13 TRP 13 144 144 TRP TRP C . n C 1 14 THR 14 145 145 THR THR C . n C 1 15 ALA 15 146 146 ALA ALA C . n C 1 16 ALA 16 147 147 ALA ALA C . n C 1 17 LEU 17 148 148 LEU LEU C . n C 1 18 LEU 18 149 149 LEU LEU C . n C 1 19 LEU 19 150 150 LEU LEU C . n C 1 20 MET 20 151 151 MET MET C . n C 1 21 MET 21 152 152 MET MET C . n C 1 22 PHE 22 153 153 PHE PHE C . n C 1 23 TYR 23 154 154 TYR TYR C . n C 1 24 ILE 24 155 155 ILE ILE C . n C 1 25 PHE 25 156 156 PHE PHE C . n C 1 26 ALA 26 157 157 ALA ALA C . n C 1 27 VAL 27 158 158 VAL VAL C . n C 1 28 MET 28 159 159 MET MET C . n C 1 29 GLY 29 160 160 GLY GLY C . n C 1 30 THR 30 161 161 THR THR C . n C 1 31 GLU 31 162 162 GLU GLU C . n C 1 32 LEU 32 163 163 LEU LEU C . n C 1 33 PHE 33 164 164 PHE PHE C . n C 1 34 GLY 34 165 165 GLY GLY C . n C 1 35 GLU 35 166 166 GLU GLU C . n C 1 36 ALA 36 167 167 ALA ALA C . n C 1 37 PHE 37 168 168 PHE PHE C . n C 1 38 PRO 38 169 169 PRO PRO C . n C 1 39 GLN 39 170 170 GLN GLN C . n C 1 40 TRP 40 171 171 TRP TRP C . n C 1 41 PHE 41 172 172 PHE PHE C . n C 1 42 GLY 42 173 173 GLY GLY C . n C 1 43 SER 43 174 174 SER SER C . n C 1 44 LEU 44 175 175 LEU LEU C . n C 1 45 GLY 45 176 176 GLY GLY C . n C 1 46 ALA 46 177 177 ALA ALA C . n C 1 47 SER 47 178 178 SER SER C . n C 1 48 ILE 48 179 179 ILE ILE C . n C 1 49 TYR 49 180 180 TYR TYR C . n C 1 50 SER 50 181 181 SER SER C . n C 1 51 LEU 51 182 182 LEU LEU C . n C 1 52 PHE 52 183 183 PHE PHE C . n C 1 53 GLN 53 184 184 GLN GLN C . n C 1 54 ILE 54 185 185 ILE ILE C . n C 1 55 MET 55 186 186 MET MET C . n C 1 56 THR 56 187 187 THR THR C . n C 1 57 LEU 57 188 188 LEU LEU C . n C 1 58 GLU 58 189 189 GLU GLU C . n C 1 59 SER 59 190 190 SER SER C . n C 1 60 TRP 60 191 191 TRP TRP C . n C 1 61 SER 61 192 192 SER ALA C . n C 1 62 MET 62 193 193 MET MET C . n C 1 63 GLY 63 194 194 GLY GLY C . n C 1 64 ILE 64 195 195 ILE ILE C . n C 1 65 ALA 65 196 196 ALA ALA C . n C 1 66 ARG 66 197 197 ARG ARG C . n C 1 67 PRO 67 198 198 PRO PRO C . n C 1 68 VAL 68 199 199 VAL VAL C . n C 1 69 MET 69 200 200 MET MET C . n C 1 70 GLU 70 201 201 GLU GLU C . n C 1 71 VAL 71 202 202 VAL VAL C . n C 1 72 TYR 72 203 203 TYR TYR C . n C 1 73 PRO 73 204 204 PRO PRO C . n C 1 74 LEU 74 205 205 LEU LEU C . n C 1 75 ALA 75 206 206 ALA ALA C . n C 1 76 TRP 76 207 207 TRP TRP C . n C 1 77 ILE 77 208 208 ILE ILE C . n C 1 78 PHE 78 209 209 PHE PHE C . n C 1 79 PHE 79 210 210 PHE PHE C . n C 1 80 VAL 80 211 211 VAL VAL C . n C 1 81 PRO 81 212 212 PRO PRO C . n C 1 82 PHE 82 213 213 PHE PHE C . n C 1 83 ILE 83 214 214 ILE ILE C . n C 1 84 LEU 84 215 215 LEU LEU C . n C 1 85 ILE 85 216 216 ILE ILE C . n C 1 86 SER 86 217 217 SER SER C . n C 1 87 SER 87 218 218 SER SER C . n C 1 88 PHE 88 219 219 PHE PHE C . n C 1 89 MET 89 220 220 MET MET C . n C 1 90 VAL 90 221 221 VAL VAL C . n C 1 91 LEU 91 222 222 LEU LEU C . n C 1 92 ASN 92 223 223 ASN ASN C . n C 1 93 LEU 93 224 224 LEU LEU C . n C 1 94 PHE 94 225 225 PHE PHE C . n C 1 95 ILE 95 226 226 ILE ILE C . n C 1 96 ALA 96 227 227 ALA ALA C . n C 1 97 ILE 97 228 228 ILE ILE C . n C 1 98 ILE 98 229 229 ILE ILE C . n C 1 99 VAL 99 230 230 VAL VAL C . n C 1 100 SER 100 231 231 SER SER C . n C 1 101 ALA 101 232 232 ALA ALA C . n C 1 102 THR 102 233 233 THR THR C . n C 1 103 GLN 103 234 234 GLN GLN C . n C 1 104 GLU 104 235 235 GLU GLU C . n C 1 105 VAL 105 236 236 VAL VAL C . n C 1 106 HIS 106 237 237 HIS HIS C . n C 1 107 GLU 107 238 238 GLU GLU C . n C 1 108 SER 108 239 239 SER SER C . n C 1 109 GLU 109 240 240 GLU GLU C . n C 1 110 GLN 110 241 241 GLN GLN C . n C 1 111 ARG 111 242 242 ARG ARG C . n C 1 112 ALA 112 243 243 ALA ALA C . n C 1 113 GLU 113 244 244 GLU GLU C . n C 1 114 ARG 114 245 245 ARG ARG C . n C 1 115 GLU 115 246 246 GLU GLU C . n C 1 116 ALA 116 247 247 ALA ALA C . n C 1 117 ASN 117 248 248 ASN ASN C . n C 1 118 ASN 118 249 249 ASN ASN C . n C 1 119 LEU 119 250 250 LEU LEU C . n C 1 120 ILE 120 251 251 ILE ILE C . n C 1 121 ALA 121 252 252 ALA ALA C . n C 1 122 HIS 122 253 253 HIS HIS C . n C 1 123 ASP 123 254 254 ASP ASP C . n C 1 124 GLU 124 255 255 GLU GLU C . n C 1 125 ARG 125 256 256 ARG ARG C . n C 1 126 GLN 126 257 257 GLN GLN C . n C 1 127 GLU 127 258 258 GLU GLU C . n C 1 128 MET 128 259 259 MET MET C . n C 1 129 LEU 129 260 260 LEU LEU C . n C 1 130 ASP 130 261 261 ASP ASP C . n C 1 131 LEU 131 262 262 LEU LEU C . n C 1 132 MET 132 263 263 MET MET C . n C 1 133 ARG 133 264 264 ARG ARG C . n C 1 134 ALA 134 265 265 ALA ALA C . n C 1 135 MET 135 266 266 MET MET C . n C 1 136 HIS 136 267 267 HIS HIS C . n C 1 137 ALA 137 268 268 ALA ALA C . n C 1 138 LYS 138 269 269 LYS LYS C . n C 1 139 ILE 139 270 270 ILE ILE C . n C 1 140 VAL 140 271 271 VAL VAL C . n C 1 141 ALA 141 272 272 ALA ALA C . n C 1 142 LEU 142 273 273 LEU LEU C . n C 1 143 GLU 143 274 274 GLU GLU C . n C 1 144 GLN 144 275 275 GLN GLN C . n C 1 145 GLN 145 276 276 GLN GLN C . n C 1 146 GLY 146 277 277 GLY GLY C . n C 1 147 LYS 147 278 278 LYS ALA C . n C 1 148 ALA 148 279 ? ? ? C . n C 1 149 GLY 149 280 ? ? ? C . n C 1 150 GLN 150 281 ? ? ? C . n D 1 1 VAL 1 132 132 VAL VAL D . n D 1 2 GLU 2 133 133 GLU GLU D . n D 1 3 SER 3 134 134 SER SER D . n D 1 4 LEU 4 135 135 LEU LEU D . n D 1 5 MET 5 136 136 MET MET D . n D 1 6 GLN 6 137 137 GLN GLN D . n D 1 7 ALA 7 138 138 ALA ALA D . n D 1 8 LEU 8 139 139 LEU LEU D . n D 1 9 PRO 9 140 140 PRO PRO D . n D 1 10 GLY 10 141 141 GLY GLY D . n D 1 11 ILE 11 142 142 ILE ILE D . n D 1 12 GLY 12 143 143 GLY GLY D . n D 1 13 TRP 13 144 144 TRP TRP D . n D 1 14 THR 14 145 145 THR THR D . n D 1 15 ALA 15 146 146 ALA ALA D . n D 1 16 ALA 16 147 147 ALA ALA D . n D 1 17 LEU 17 148 148 LEU LEU D . n D 1 18 LEU 18 149 149 LEU LEU D . n D 1 19 LEU 19 150 150 LEU LEU D . n D 1 20 MET 20 151 151 MET MET D . n D 1 21 MET 21 152 152 MET MET D . n D 1 22 PHE 22 153 153 PHE PHE D . n D 1 23 TYR 23 154 154 TYR TYR D . n D 1 24 ILE 24 155 155 ILE ILE D . n D 1 25 PHE 25 156 156 PHE PHE D . n D 1 26 ALA 26 157 157 ALA ALA D . n D 1 27 VAL 27 158 158 VAL VAL D . n D 1 28 MET 28 159 159 MET MET D . n D 1 29 GLY 29 160 160 GLY GLY D . n D 1 30 THR 30 161 161 THR THR D . n D 1 31 GLU 31 162 162 GLU GLU D . n D 1 32 LEU 32 163 163 LEU LEU D . n D 1 33 PHE 33 164 164 PHE PHE D . n D 1 34 GLY 34 165 165 GLY GLY D . n D 1 35 GLU 35 166 166 GLU GLU D . n D 1 36 ALA 36 167 167 ALA ALA D . n D 1 37 PHE 37 168 168 PHE PHE D . n D 1 38 PRO 38 169 169 PRO PRO D . n D 1 39 GLN 39 170 170 GLN GLN D . n D 1 40 TRP 40 171 171 TRP TRP D . n D 1 41 PHE 41 172 172 PHE PHE D . n D 1 42 GLY 42 173 173 GLY GLY D . n D 1 43 SER 43 174 174 SER SER D . n D 1 44 LEU 44 175 175 LEU LEU D . n D 1 45 GLY 45 176 176 GLY GLY D . n D 1 46 ALA 46 177 177 ALA ALA D . n D 1 47 SER 47 178 178 SER SER D . n D 1 48 ILE 48 179 179 ILE ILE D . n D 1 49 TYR 49 180 180 TYR TYR D . n D 1 50 SER 50 181 181 SER SER D . n D 1 51 LEU 51 182 182 LEU LEU D . n D 1 52 PHE 52 183 183 PHE PHE D . n D 1 53 GLN 53 184 184 GLN GLN D . n D 1 54 ILE 54 185 185 ILE ILE D . n D 1 55 MET 55 186 186 MET MET D . n D 1 56 THR 56 187 187 THR THR D . n D 1 57 LEU 57 188 188 LEU LEU D . n D 1 58 GLU 58 189 189 GLU GLU D . n D 1 59 SER 59 190 190 SER SER D . n D 1 60 TRP 60 191 191 TRP TRP D . n D 1 61 SER 61 192 192 SER ALA D . n D 1 62 MET 62 193 193 MET MET D . n D 1 63 GLY 63 194 194 GLY GLY D . n D 1 64 ILE 64 195 195 ILE ILE D . n D 1 65 ALA 65 196 196 ALA ALA D . n D 1 66 ARG 66 197 197 ARG ARG D . n D 1 67 PRO 67 198 198 PRO PRO D . n D 1 68 VAL 68 199 199 VAL VAL D . n D 1 69 MET 69 200 200 MET MET D . n D 1 70 GLU 70 201 201 GLU GLU D . n D 1 71 VAL 71 202 202 VAL VAL D . n D 1 72 TYR 72 203 203 TYR TYR D . n D 1 73 PRO 73 204 204 PRO PRO D . n D 1 74 LEU 74 205 205 LEU LEU D . n D 1 75 ALA 75 206 206 ALA ALA D . n D 1 76 TRP 76 207 207 TRP TRP D . n D 1 77 ILE 77 208 208 ILE ILE D . n D 1 78 PHE 78 209 209 PHE PHE D . n D 1 79 PHE 79 210 210 PHE PHE D . n D 1 80 VAL 80 211 211 VAL VAL D . n D 1 81 PRO 81 212 212 PRO PRO D . n D 1 82 PHE 82 213 213 PHE PHE D . n D 1 83 ILE 83 214 214 ILE ILE D . n D 1 84 LEU 84 215 215 LEU LEU D . n D 1 85 ILE 85 216 216 ILE ILE D . n D 1 86 SER 86 217 217 SER SER D . n D 1 87 SER 87 218 218 SER SER D . n D 1 88 PHE 88 219 219 PHE PHE D . n D 1 89 MET 89 220 220 MET MET D . n D 1 90 VAL 90 221 221 VAL VAL D . n D 1 91 LEU 91 222 222 LEU LEU D . n D 1 92 ASN 92 223 223 ASN ASN D . n D 1 93 LEU 93 224 224 LEU LEU D . n D 1 94 PHE 94 225 225 PHE PHE D . n D 1 95 ILE 95 226 226 ILE ILE D . n D 1 96 ALA 96 227 227 ALA ALA D . n D 1 97 ILE 97 228 228 ILE ILE D . n D 1 98 ILE 98 229 229 ILE ILE D . n D 1 99 VAL 99 230 230 VAL VAL D . n D 1 100 SER 100 231 231 SER SER D . n D 1 101 ALA 101 232 232 ALA ALA D . n D 1 102 THR 102 233 233 THR THR D . n D 1 103 GLN 103 234 234 GLN GLN D . n D 1 104 GLU 104 235 235 GLU GLU D . n D 1 105 VAL 105 236 236 VAL VAL D . n D 1 106 HIS 106 237 237 HIS HIS D . n D 1 107 GLU 107 238 238 GLU GLU D . n D 1 108 SER 108 239 239 SER SER D . n D 1 109 GLU 109 240 240 GLU GLU D . n D 1 110 GLN 110 241 241 GLN GLN D . n D 1 111 ARG 111 242 242 ARG ARG D . n D 1 112 ALA 112 243 243 ALA ALA D . n D 1 113 GLU 113 244 244 GLU GLU D . n D 1 114 ARG 114 245 245 ARG ARG D . n D 1 115 GLU 115 246 246 GLU GLU D . n D 1 116 ALA 116 247 247 ALA ALA D . n D 1 117 ASN 117 248 248 ASN ASN D . n D 1 118 ASN 118 249 249 ASN ASN D . n D 1 119 LEU 119 250 250 LEU LEU D . n D 1 120 ILE 120 251 251 ILE ILE D . n D 1 121 ALA 121 252 252 ALA ALA D . n D 1 122 HIS 122 253 253 HIS HIS D . n D 1 123 ASP 123 254 254 ASP ASP D . n D 1 124 GLU 124 255 255 GLU GLU D . n D 1 125 ARG 125 256 256 ARG ARG D . n D 1 126 GLN 126 257 257 GLN GLN D . n D 1 127 GLU 127 258 258 GLU GLU D . n D 1 128 MET 128 259 259 MET MET D . n D 1 129 LEU 129 260 260 LEU LEU D . n D 1 130 ASP 130 261 261 ASP ASP D . n D 1 131 LEU 131 262 262 LEU LEU D . n D 1 132 MET 132 263 263 MET MET D . n D 1 133 ARG 133 264 264 ARG ARG D . n D 1 134 ALA 134 265 265 ALA ALA D . n D 1 135 MET 135 266 266 MET MET D . n D 1 136 HIS 136 267 267 HIS HIS D . n D 1 137 ALA 137 268 268 ALA ALA D . n D 1 138 LYS 138 269 269 LYS LYS D . n D 1 139 ILE 139 270 270 ILE ILE D . n D 1 140 VAL 140 271 271 VAL VAL D . n D 1 141 ALA 141 272 272 ALA ALA D . n D 1 142 LEU 142 273 273 LEU LEU D . n D 1 143 GLU 143 274 274 GLU GLU D . n D 1 144 GLN 144 275 275 GLN GLN D . n D 1 145 GLN 145 276 276 GLN GLN D . n D 1 146 GLY 146 277 277 GLY GLY D . n D 1 147 LYS 147 278 278 LYS ALA D . n D 1 148 ALA 148 279 ? ? ? D . n D 1 149 GLY 149 280 ? ? ? D . n D 1 150 GLN 150 281 ? ? ? D . n E 1 1 VAL 1 132 132 VAL VAL E . n E 1 2 GLU 2 133 133 GLU GLU E . n E 1 3 SER 3 134 134 SER SER E . n E 1 4 LEU 4 135 135 LEU LEU E . n E 1 5 MET 5 136 136 MET MET E . n E 1 6 GLN 6 137 137 GLN GLN E . n E 1 7 ALA 7 138 138 ALA ALA E . n E 1 8 LEU 8 139 139 LEU LEU E . n E 1 9 PRO 9 140 140 PRO PRO E . n E 1 10 GLY 10 141 141 GLY GLY E . n E 1 11 ILE 11 142 142 ILE ILE E . n E 1 12 GLY 12 143 143 GLY GLY E . n E 1 13 TRP 13 144 144 TRP TRP E . n E 1 14 THR 14 145 145 THR THR E . n E 1 15 ALA 15 146 146 ALA ALA E . n E 1 16 ALA 16 147 147 ALA ALA E . n E 1 17 LEU 17 148 148 LEU LEU E . n E 1 18 LEU 18 149 149 LEU LEU E . n E 1 19 LEU 19 150 150 LEU LEU E . n E 1 20 MET 20 151 151 MET MET E . n E 1 21 MET 21 152 152 MET MET E . n E 1 22 PHE 22 153 153 PHE PHE E . n E 1 23 TYR 23 154 154 TYR TYR E . n E 1 24 ILE 24 155 155 ILE ILE E . n E 1 25 PHE 25 156 156 PHE PHE E . n E 1 26 ALA 26 157 157 ALA ALA E . n E 1 27 VAL 27 158 158 VAL VAL E . n E 1 28 MET 28 159 159 MET MET E . n E 1 29 GLY 29 160 160 GLY GLY E . n E 1 30 THR 30 161 161 THR THR E . n E 1 31 GLU 31 162 162 GLU GLU E . n E 1 32 LEU 32 163 163 LEU LEU E . n E 1 33 PHE 33 164 164 PHE PHE E . n E 1 34 GLY 34 165 165 GLY GLY E . n E 1 35 GLU 35 166 166 GLU GLU E . n E 1 36 ALA 36 167 167 ALA ALA E . n E 1 37 PHE 37 168 168 PHE PHE E . n E 1 38 PRO 38 169 169 PRO PRO E . n E 1 39 GLN 39 170 170 GLN GLN E . n E 1 40 TRP 40 171 171 TRP TRP E . n E 1 41 PHE 41 172 172 PHE PHE E . n E 1 42 GLY 42 173 173 GLY GLY E . n E 1 43 SER 43 174 174 SER SER E . n E 1 44 LEU 44 175 175 LEU LEU E . n E 1 45 GLY 45 176 176 GLY GLY E . n E 1 46 ALA 46 177 177 ALA ALA E . n E 1 47 SER 47 178 178 SER SER E . n E 1 48 ILE 48 179 179 ILE ILE E . n E 1 49 TYR 49 180 180 TYR TYR E . n E 1 50 SER 50 181 181 SER SER E . n E 1 51 LEU 51 182 182 LEU LEU E . n E 1 52 PHE 52 183 183 PHE PHE E . n E 1 53 GLN 53 184 184 GLN GLN E . n E 1 54 ILE 54 185 185 ILE ILE E . n E 1 55 MET 55 186 186 MET MET E . n E 1 56 THR 56 187 187 THR THR E . n E 1 57 LEU 57 188 188 LEU LEU E . n E 1 58 GLU 58 189 189 GLU GLU E . n E 1 59 SER 59 190 190 SER SER E . n E 1 60 TRP 60 191 191 TRP TRP E . n E 1 61 SER 61 192 192 SER ALA E . n E 1 62 MET 62 193 193 MET MET E . n E 1 63 GLY 63 194 194 GLY GLY E . n E 1 64 ILE 64 195 195 ILE ILE E . n E 1 65 ALA 65 196 196 ALA ALA E . n E 1 66 ARG 66 197 197 ARG ARG E . n E 1 67 PRO 67 198 198 PRO PRO E . n E 1 68 VAL 68 199 199 VAL VAL E . n E 1 69 MET 69 200 200 MET MET E . n E 1 70 GLU 70 201 201 GLU GLU E . n E 1 71 VAL 71 202 202 VAL VAL E . n E 1 72 TYR 72 203 203 TYR TYR E . n E 1 73 PRO 73 204 204 PRO PRO E . n E 1 74 LEU 74 205 205 LEU LEU E . n E 1 75 ALA 75 206 206 ALA ALA E . n E 1 76 TRP 76 207 207 TRP TRP E . n E 1 77 ILE 77 208 208 ILE ILE E . n E 1 78 PHE 78 209 209 PHE PHE E . n E 1 79 PHE 79 210 210 PHE PHE E . n E 1 80 VAL 80 211 211 VAL VAL E . n E 1 81 PRO 81 212 212 PRO PRO E . n E 1 82 PHE 82 213 213 PHE PHE E . n E 1 83 ILE 83 214 214 ILE ILE E . n E 1 84 LEU 84 215 215 LEU LEU E . n E 1 85 ILE 85 216 216 ILE ILE E . n E 1 86 SER 86 217 217 SER SER E . n E 1 87 SER 87 218 218 SER SER E . n E 1 88 PHE 88 219 219 PHE PHE E . n E 1 89 MET 89 220 220 MET MET E . n E 1 90 VAL 90 221 221 VAL VAL E . n E 1 91 LEU 91 222 222 LEU LEU E . n E 1 92 ASN 92 223 223 ASN ASN E . n E 1 93 LEU 93 224 224 LEU LEU E . n E 1 94 PHE 94 225 225 PHE PHE E . n E 1 95 ILE 95 226 226 ILE ILE E . n E 1 96 ALA 96 227 227 ALA ALA E . n E 1 97 ILE 97 228 228 ILE ILE E . n E 1 98 ILE 98 229 229 ILE ILE E . n E 1 99 VAL 99 230 230 VAL VAL E . n E 1 100 SER 100 231 231 SER SER E . n E 1 101 ALA 101 232 232 ALA ALA E . n E 1 102 THR 102 233 233 THR THR E . n E 1 103 GLN 103 234 234 GLN GLN E . n E 1 104 GLU 104 235 235 GLU GLU E . n E 1 105 VAL 105 236 236 VAL VAL E . n E 1 106 HIS 106 237 237 HIS HIS E . n E 1 107 GLU 107 238 238 GLU GLU E . n E 1 108 SER 108 239 239 SER SER E . n E 1 109 GLU 109 240 240 GLU GLU E . n E 1 110 GLN 110 241 241 GLN GLN E . n E 1 111 ARG 111 242 242 ARG ARG E . n E 1 112 ALA 112 243 243 ALA ALA E . n E 1 113 GLU 113 244 244 GLU GLU E . n E 1 114 ARG 114 245 245 ARG ARG E . n E 1 115 GLU 115 246 246 GLU GLU E . n E 1 116 ALA 116 247 247 ALA ALA E . n E 1 117 ASN 117 248 248 ASN ASN E . n E 1 118 ASN 118 249 249 ASN ASN E . n E 1 119 LEU 119 250 250 LEU LEU E . n E 1 120 ILE 120 251 251 ILE ILE E . n E 1 121 ALA 121 252 252 ALA ALA E . n E 1 122 HIS 122 253 253 HIS HIS E . n E 1 123 ASP 123 254 254 ASP ASP E . n E 1 124 GLU 124 255 255 GLU GLU E . n E 1 125 ARG 125 256 256 ARG ARG E . n E 1 126 GLN 126 257 257 GLN GLN E . n E 1 127 GLU 127 258 258 GLU GLU E . n E 1 128 MET 128 259 259 MET MET E . n E 1 129 LEU 129 260 260 LEU LEU E . n E 1 130 ASP 130 261 261 ASP ASP E . n E 1 131 LEU 131 262 262 LEU LEU E . n E 1 132 MET 132 263 263 MET MET E . n E 1 133 ARG 133 264 264 ARG ARG E . n E 1 134 ALA 134 265 265 ALA ALA E . n E 1 135 MET 135 266 266 MET MET E . n E 1 136 HIS 136 267 267 HIS HIS E . n E 1 137 ALA 137 268 268 ALA ALA E . n E 1 138 LYS 138 269 269 LYS LYS E . n E 1 139 ILE 139 270 270 ILE ILE E . n E 1 140 VAL 140 271 271 VAL VAL E . n E 1 141 ALA 141 272 272 ALA ALA E . n E 1 142 LEU 142 273 273 LEU LEU E . n E 1 143 GLU 143 274 274 GLU GLU E . n E 1 144 GLN 144 275 275 GLN GLN E . n E 1 145 GLN 145 276 276 GLN GLN E . n E 1 146 GLY 146 277 277 GLY GLY E . n E 1 147 LYS 147 278 278 LYS ALA E . n E 1 148 ALA 148 279 ? ? ? E . n E 1 149 GLY 149 280 ? ? ? E . n E 1 150 GLN 150 281 ? ? ? E . n F 1 1 VAL 1 132 ? ? ? F . n F 1 2 GLU 2 133 133 GLU GLU F . n F 1 3 SER 3 134 134 SER SER F . n F 1 4 LEU 4 135 135 LEU LEU F . n F 1 5 MET 5 136 136 MET MET F . n F 1 6 GLN 6 137 137 GLN GLN F . n F 1 7 ALA 7 138 138 ALA ALA F . n F 1 8 LEU 8 139 139 LEU LEU F . n F 1 9 PRO 9 140 140 PRO PRO F . n F 1 10 GLY 10 141 141 GLY GLY F . n F 1 11 ILE 11 142 142 ILE ILE F . n F 1 12 GLY 12 143 143 GLY GLY F . n F 1 13 TRP 13 144 144 TRP TRP F . n F 1 14 THR 14 145 145 THR THR F . n F 1 15 ALA 15 146 146 ALA ALA F . n F 1 16 ALA 16 147 147 ALA ALA F . n F 1 17 LEU 17 148 148 LEU LEU F . n F 1 18 LEU 18 149 149 LEU LEU F . n F 1 19 LEU 19 150 150 LEU LEU F . n F 1 20 MET 20 151 151 MET MET F . n F 1 21 MET 21 152 152 MET MET F . n F 1 22 PHE 22 153 153 PHE PHE F . n F 1 23 TYR 23 154 154 TYR TYR F . n F 1 24 ILE 24 155 155 ILE ILE F . n F 1 25 PHE 25 156 156 PHE PHE F . n F 1 26 ALA 26 157 157 ALA ALA F . n F 1 27 VAL 27 158 158 VAL VAL F . n F 1 28 MET 28 159 159 MET MET F . n F 1 29 GLY 29 160 160 GLY GLY F . n F 1 30 THR 30 161 161 THR THR F . n F 1 31 GLU 31 162 162 GLU GLU F . n F 1 32 LEU 32 163 163 LEU LEU F . n F 1 33 PHE 33 164 164 PHE PHE F . n F 1 34 GLY 34 165 165 GLY GLY F . n F 1 35 GLU 35 166 166 GLU GLU F . n F 1 36 ALA 36 167 167 ALA ALA F . n F 1 37 PHE 37 168 168 PHE PHE F . n F 1 38 PRO 38 169 169 PRO PRO F . n F 1 39 GLN 39 170 170 GLN GLN F . n F 1 40 TRP 40 171 171 TRP TRP F . n F 1 41 PHE 41 172 172 PHE PHE F . n F 1 42 GLY 42 173 173 GLY GLY F . n F 1 43 SER 43 174 174 SER SER F . n F 1 44 LEU 44 175 175 LEU LEU F . n F 1 45 GLY 45 176 176 GLY GLY F . n F 1 46 ALA 46 177 177 ALA ALA F . n F 1 47 SER 47 178 178 SER SER F . n F 1 48 ILE 48 179 179 ILE ILE F . n F 1 49 TYR 49 180 180 TYR TYR F . n F 1 50 SER 50 181 181 SER SER F . n F 1 51 LEU 51 182 182 LEU LEU F . n F 1 52 PHE 52 183 183 PHE PHE F . n F 1 53 GLN 53 184 184 GLN GLN F . n F 1 54 ILE 54 185 185 ILE ILE F . n F 1 55 MET 55 186 186 MET MET F . n F 1 56 THR 56 187 187 THR THR F . n F 1 57 LEU 57 188 188 LEU LEU F . n F 1 58 GLU 58 189 189 GLU GLU F . n F 1 59 SER 59 190 190 SER SER F . n F 1 60 TRP 60 191 191 TRP TRP F . n F 1 61 SER 61 192 192 SER ALA F . n F 1 62 MET 62 193 193 MET MET F . n F 1 63 GLY 63 194 194 GLY GLY F . n F 1 64 ILE 64 195 195 ILE ILE F . n F 1 65 ALA 65 196 196 ALA ALA F . n F 1 66 ARG 66 197 197 ARG ARG F . n F 1 67 PRO 67 198 198 PRO PRO F . n F 1 68 VAL 68 199 199 VAL VAL F . n F 1 69 MET 69 200 200 MET MET F . n F 1 70 GLU 70 201 201 GLU GLU F . n F 1 71 VAL 71 202 202 VAL VAL F . n F 1 72 TYR 72 203 203 TYR TYR F . n F 1 73 PRO 73 204 204 PRO PRO F . n F 1 74 LEU 74 205 205 LEU LEU F . n F 1 75 ALA 75 206 206 ALA ALA F . n F 1 76 TRP 76 207 207 TRP TRP F . n F 1 77 ILE 77 208 208 ILE ILE F . n F 1 78 PHE 78 209 209 PHE PHE F . n F 1 79 PHE 79 210 210 PHE PHE F . n F 1 80 VAL 80 211 211 VAL VAL F . n F 1 81 PRO 81 212 212 PRO PRO F . n F 1 82 PHE 82 213 213 PHE PHE F . n F 1 83 ILE 83 214 214 ILE ILE F . n F 1 84 LEU 84 215 215 LEU LEU F . n F 1 85 ILE 85 216 216 ILE ILE F . n F 1 86 SER 86 217 217 SER SER F . n F 1 87 SER 87 218 218 SER SER F . n F 1 88 PHE 88 219 219 PHE PHE F . n F 1 89 MET 89 220 220 MET MET F . n F 1 90 VAL 90 221 221 VAL VAL F . n F 1 91 LEU 91 222 222 LEU LEU F . n F 1 92 ASN 92 223 223 ASN ASN F . n F 1 93 LEU 93 224 224 LEU LEU F . n F 1 94 PHE 94 225 225 PHE PHE F . n F 1 95 ILE 95 226 226 ILE ILE F . n F 1 96 ALA 96 227 227 ALA ALA F . n F 1 97 ILE 97 228 228 ILE ILE F . n F 1 98 ILE 98 229 229 ILE ILE F . n F 1 99 VAL 99 230 230 VAL VAL F . n F 1 100 SER 100 231 231 SER SER F . n F 1 101 ALA 101 232 232 ALA ALA F . n F 1 102 THR 102 233 233 THR THR F . n F 1 103 GLN 103 234 234 GLN GLN F . n F 1 104 GLU 104 235 235 GLU GLU F . n F 1 105 VAL 105 236 236 VAL VAL F . n F 1 106 HIS 106 237 237 HIS HIS F . n F 1 107 GLU 107 238 238 GLU GLU F . n F 1 108 SER 108 239 239 SER SER F . n F 1 109 GLU 109 240 240 GLU GLU F . n F 1 110 GLN 110 241 241 GLN GLN F . n F 1 111 ARG 111 242 242 ARG ARG F . n F 1 112 ALA 112 243 243 ALA ALA F . n F 1 113 GLU 113 244 244 GLU GLU F . n F 1 114 ARG 114 245 245 ARG ARG F . n F 1 115 GLU 115 246 246 GLU GLU F . n F 1 116 ALA 116 247 247 ALA ALA F . n F 1 117 ASN 117 248 248 ASN ASN F . n F 1 118 ASN 118 249 249 ASN ASN F . n F 1 119 LEU 119 250 250 LEU LEU F . n F 1 120 ILE 120 251 251 ILE ILE F . n F 1 121 ALA 121 252 252 ALA ALA F . n F 1 122 HIS 122 253 253 HIS HIS F . n F 1 123 ASP 123 254 254 ASP ASP F . n F 1 124 GLU 124 255 255 GLU GLU F . n F 1 125 ARG 125 256 256 ARG ARG F . n F 1 126 GLN 126 257 257 GLN GLN F . n F 1 127 GLU 127 258 258 GLU GLU F . n F 1 128 MET 128 259 259 MET MET F . n F 1 129 LEU 129 260 260 LEU LEU F . n F 1 130 ASP 130 261 261 ASP ASP F . n F 1 131 LEU 131 262 262 LEU LEU F . n F 1 132 MET 132 263 263 MET MET F . n F 1 133 ARG 133 264 264 ARG ARG F . n F 1 134 ALA 134 265 265 ALA ALA F . n F 1 135 MET 135 266 266 MET MET F . n F 1 136 HIS 136 267 267 HIS HIS F . n F 1 137 ALA 137 268 268 ALA ALA F . n F 1 138 LYS 138 269 269 LYS LYS F . n F 1 139 ILE 139 270 270 ILE ILE F . n F 1 140 VAL 140 271 271 VAL VAL F . n F 1 141 ALA 141 272 272 ALA ALA F . n F 1 142 LEU 142 273 273 LEU LEU F . n F 1 143 GLU 143 274 274 GLU GLU F . n F 1 144 GLN 144 275 275 GLN GLN F . n F 1 145 GLN 145 276 276 GLN GLN F . n F 1 146 GLY 146 277 277 GLY GLY F . n F 1 147 LYS 147 278 278 LYS ALA F . n F 1 148 ALA 148 279 ? ? ? F . n F 1 149 GLY 149 280 ? ? ? F . n F 1 150 GLN 150 281 ? ? ? F . n G 1 1 VAL 1 132 ? ? ? G . n G 1 2 GLU 2 133 133 GLU GLU G . n G 1 3 SER 3 134 134 SER SER G . n G 1 4 LEU 4 135 135 LEU LEU G . n G 1 5 MET 5 136 136 MET MET G . n G 1 6 GLN 6 137 137 GLN GLN G . n G 1 7 ALA 7 138 138 ALA ALA G . n G 1 8 LEU 8 139 139 LEU LEU G . n G 1 9 PRO 9 140 140 PRO PRO G . n G 1 10 GLY 10 141 141 GLY GLY G . n G 1 11 ILE 11 142 142 ILE ILE G . n G 1 12 GLY 12 143 143 GLY GLY G . n G 1 13 TRP 13 144 144 TRP TRP G . n G 1 14 THR 14 145 145 THR THR G . n G 1 15 ALA 15 146 146 ALA ALA G . n G 1 16 ALA 16 147 147 ALA ALA G . n G 1 17 LEU 17 148 148 LEU LEU G . n G 1 18 LEU 18 149 149 LEU LEU G . n G 1 19 LEU 19 150 150 LEU LEU G . n G 1 20 MET 20 151 151 MET MET G . n G 1 21 MET 21 152 152 MET MET G . n G 1 22 PHE 22 153 153 PHE PHE G . n G 1 23 TYR 23 154 154 TYR TYR G . n G 1 24 ILE 24 155 155 ILE ILE G . n G 1 25 PHE 25 156 156 PHE PHE G . n G 1 26 ALA 26 157 157 ALA ALA G . n G 1 27 VAL 27 158 158 VAL VAL G . n G 1 28 MET 28 159 159 MET MET G . n G 1 29 GLY 29 160 160 GLY GLY G . n G 1 30 THR 30 161 161 THR THR G . n G 1 31 GLU 31 162 162 GLU GLU G . n G 1 32 LEU 32 163 163 LEU LEU G . n G 1 33 PHE 33 164 164 PHE PHE G . n G 1 34 GLY 34 165 165 GLY GLY G . n G 1 35 GLU 35 166 166 GLU GLU G . n G 1 36 ALA 36 167 167 ALA ALA G . n G 1 37 PHE 37 168 168 PHE PHE G . n G 1 38 PRO 38 169 169 PRO PRO G . n G 1 39 GLN 39 170 170 GLN GLN G . n G 1 40 TRP 40 171 171 TRP TRP G . n G 1 41 PHE 41 172 172 PHE PHE G . n G 1 42 GLY 42 173 173 GLY GLY G . n G 1 43 SER 43 174 174 SER SER G . n G 1 44 LEU 44 175 175 LEU LEU G . n G 1 45 GLY 45 176 176 GLY GLY G . n G 1 46 ALA 46 177 177 ALA ALA G . n G 1 47 SER 47 178 178 SER SER G . n G 1 48 ILE 48 179 179 ILE ILE G . n G 1 49 TYR 49 180 180 TYR TYR G . n G 1 50 SER 50 181 181 SER SER G . n G 1 51 LEU 51 182 182 LEU LEU G . n G 1 52 PHE 52 183 183 PHE PHE G . n G 1 53 GLN 53 184 184 GLN GLN G . n G 1 54 ILE 54 185 185 ILE ILE G . n G 1 55 MET 55 186 186 MET MET G . n G 1 56 THR 56 187 187 THR THR G . n G 1 57 LEU 57 188 188 LEU LEU G . n G 1 58 GLU 58 189 189 GLU GLU G . n G 1 59 SER 59 190 190 SER SER G . n G 1 60 TRP 60 191 191 TRP TRP G . n G 1 61 SER 61 192 192 SER ALA G . n G 1 62 MET 62 193 193 MET MET G . n G 1 63 GLY 63 194 194 GLY GLY G . n G 1 64 ILE 64 195 195 ILE ILE G . n G 1 65 ALA 65 196 196 ALA ALA G . n G 1 66 ARG 66 197 197 ARG ARG G . n G 1 67 PRO 67 198 198 PRO PRO G . n G 1 68 VAL 68 199 199 VAL VAL G . n G 1 69 MET 69 200 200 MET MET G . n G 1 70 GLU 70 201 201 GLU GLU G . n G 1 71 VAL 71 202 202 VAL VAL G . n G 1 72 TYR 72 203 203 TYR TYR G . n G 1 73 PRO 73 204 204 PRO PRO G . n G 1 74 LEU 74 205 205 LEU LEU G . n G 1 75 ALA 75 206 206 ALA ALA G . n G 1 76 TRP 76 207 207 TRP TRP G . n G 1 77 ILE 77 208 208 ILE ILE G . n G 1 78 PHE 78 209 209 PHE PHE G . n G 1 79 PHE 79 210 210 PHE PHE G . n G 1 80 VAL 80 211 211 VAL VAL G . n G 1 81 PRO 81 212 212 PRO PRO G . n G 1 82 PHE 82 213 213 PHE PHE G . n G 1 83 ILE 83 214 214 ILE ILE G . n G 1 84 LEU 84 215 215 LEU LEU G . n G 1 85 ILE 85 216 216 ILE ILE G . n G 1 86 SER 86 217 217 SER SER G . n G 1 87 SER 87 218 218 SER SER G . n G 1 88 PHE 88 219 219 PHE PHE G . n G 1 89 MET 89 220 220 MET MET G . n G 1 90 VAL 90 221 221 VAL VAL G . n G 1 91 LEU 91 222 222 LEU LEU G . n G 1 92 ASN 92 223 223 ASN ASN G . n G 1 93 LEU 93 224 224 LEU LEU G . n G 1 94 PHE 94 225 225 PHE PHE G . n G 1 95 ILE 95 226 226 ILE ILE G . n G 1 96 ALA 96 227 227 ALA ALA G . n G 1 97 ILE 97 228 228 ILE ILE G . n G 1 98 ILE 98 229 229 ILE ILE G . n G 1 99 VAL 99 230 230 VAL VAL G . n G 1 100 SER 100 231 231 SER SER G . n G 1 101 ALA 101 232 232 ALA ALA G . n G 1 102 THR 102 233 233 THR THR G . n G 1 103 GLN 103 234 234 GLN GLN G . n G 1 104 GLU 104 235 235 GLU GLU G . n G 1 105 VAL 105 236 236 VAL VAL G . n G 1 106 HIS 106 237 237 HIS HIS G . n G 1 107 GLU 107 238 238 GLU GLU G . n G 1 108 SER 108 239 239 SER SER G . n G 1 109 GLU 109 240 240 GLU GLU G . n G 1 110 GLN 110 241 241 GLN GLN G . n G 1 111 ARG 111 242 242 ARG ARG G . n G 1 112 ALA 112 243 243 ALA ALA G . n G 1 113 GLU 113 244 244 GLU GLU G . n G 1 114 ARG 114 245 245 ARG ARG G . n G 1 115 GLU 115 246 246 GLU GLU G . n G 1 116 ALA 116 247 247 ALA ALA G . n G 1 117 ASN 117 248 248 ASN ASN G . n G 1 118 ASN 118 249 249 ASN ASN G . n G 1 119 LEU 119 250 250 LEU LEU G . n G 1 120 ILE 120 251 251 ILE ILE G . n G 1 121 ALA 121 252 252 ALA ALA G . n G 1 122 HIS 122 253 253 HIS HIS G . n G 1 123 ASP 123 254 254 ASP ASP G . n G 1 124 GLU 124 255 255 GLU GLU G . n G 1 125 ARG 125 256 256 ARG ARG G . n G 1 126 GLN 126 257 257 GLN GLN G . n G 1 127 GLU 127 258 258 GLU GLU G . n G 1 128 MET 128 259 259 MET MET G . n G 1 129 LEU 129 260 260 LEU LEU G . n G 1 130 ASP 130 261 261 ASP ASP G . n G 1 131 LEU 131 262 262 LEU LEU G . n G 1 132 MET 132 263 263 MET MET G . n G 1 133 ARG 133 264 264 ARG ARG G . n G 1 134 ALA 134 265 265 ALA ALA G . n G 1 135 MET 135 266 266 MET MET G . n G 1 136 HIS 136 267 267 HIS HIS G . n G 1 137 ALA 137 268 268 ALA ALA G . n G 1 138 LYS 138 269 269 LYS LYS G . n G 1 139 ILE 139 270 270 ILE ILE G . n G 1 140 VAL 140 271 271 VAL VAL G . n G 1 141 ALA 141 272 272 ALA ALA G . n G 1 142 LEU 142 273 273 LEU LEU G . n G 1 143 GLU 143 274 274 GLU GLU G . n G 1 144 GLN 144 275 275 GLN GLN G . n G 1 145 GLN 145 276 276 GLN GLN G . n G 1 146 GLY 146 277 277 GLY GLY G . n G 1 147 LYS 147 278 278 LYS ALA G . n G 1 148 ALA 148 279 ? ? ? G . n G 1 149 GLY 149 280 ? ? ? G . n G 1 150 GLN 150 281 ? ? ? G . n H 1 1 VAL 1 132 ? ? ? H . n H 1 2 GLU 2 133 133 GLU GLU H . n H 1 3 SER 3 134 134 SER SER H . n H 1 4 LEU 4 135 135 LEU LEU H . n H 1 5 MET 5 136 136 MET MET H . n H 1 6 GLN 6 137 137 GLN GLN H . n H 1 7 ALA 7 138 138 ALA ALA H . n H 1 8 LEU 8 139 139 LEU LEU H . n H 1 9 PRO 9 140 140 PRO PRO H . n H 1 10 GLY 10 141 141 GLY GLY H . n H 1 11 ILE 11 142 142 ILE ILE H . n H 1 12 GLY 12 143 143 GLY GLY H . n H 1 13 TRP 13 144 144 TRP TRP H . n H 1 14 THR 14 145 145 THR THR H . n H 1 15 ALA 15 146 146 ALA ALA H . n H 1 16 ALA 16 147 147 ALA ALA H . n H 1 17 LEU 17 148 148 LEU LEU H . n H 1 18 LEU 18 149 149 LEU LEU H . n H 1 19 LEU 19 150 150 LEU LEU H . n H 1 20 MET 20 151 151 MET MET H . n H 1 21 MET 21 152 152 MET MET H . n H 1 22 PHE 22 153 153 PHE PHE H . n H 1 23 TYR 23 154 154 TYR TYR H . n H 1 24 ILE 24 155 155 ILE ILE H . n H 1 25 PHE 25 156 156 PHE PHE H . n H 1 26 ALA 26 157 157 ALA ALA H . n H 1 27 VAL 27 158 158 VAL VAL H . n H 1 28 MET 28 159 159 MET MET H . n H 1 29 GLY 29 160 160 GLY GLY H . n H 1 30 THR 30 161 161 THR THR H . n H 1 31 GLU 31 162 162 GLU GLU H . n H 1 32 LEU 32 163 163 LEU LEU H . n H 1 33 PHE 33 164 164 PHE PHE H . n H 1 34 GLY 34 165 165 GLY GLY H . n H 1 35 GLU 35 166 166 GLU GLU H . n H 1 36 ALA 36 167 167 ALA ALA H . n H 1 37 PHE 37 168 168 PHE PHE H . n H 1 38 PRO 38 169 169 PRO PRO H . n H 1 39 GLN 39 170 170 GLN GLN H . n H 1 40 TRP 40 171 171 TRP TRP H . n H 1 41 PHE 41 172 172 PHE PHE H . n H 1 42 GLY 42 173 173 GLY GLY H . n H 1 43 SER 43 174 174 SER SER H . n H 1 44 LEU 44 175 175 LEU LEU H . n H 1 45 GLY 45 176 176 GLY GLY H . n H 1 46 ALA 46 177 177 ALA ALA H . n H 1 47 SER 47 178 178 SER SER H . n H 1 48 ILE 48 179 179 ILE ILE H . n H 1 49 TYR 49 180 180 TYR TYR H . n H 1 50 SER 50 181 181 SER SER H . n H 1 51 LEU 51 182 182 LEU LEU H . n H 1 52 PHE 52 183 183 PHE PHE H . n H 1 53 GLN 53 184 184 GLN GLN H . n H 1 54 ILE 54 185 185 ILE ILE H . n H 1 55 MET 55 186 186 MET MET H . n H 1 56 THR 56 187 187 THR THR H . n H 1 57 LEU 57 188 188 LEU LEU H . n H 1 58 GLU 58 189 189 GLU GLU H . n H 1 59 SER 59 190 190 SER SER H . n H 1 60 TRP 60 191 191 TRP TRP H . n H 1 61 SER 61 192 192 SER ALA H . n H 1 62 MET 62 193 193 MET MET H . n H 1 63 GLY 63 194 194 GLY GLY H . n H 1 64 ILE 64 195 195 ILE ILE H . n H 1 65 ALA 65 196 196 ALA ALA H . n H 1 66 ARG 66 197 197 ARG ARG H . n H 1 67 PRO 67 198 198 PRO PRO H . n H 1 68 VAL 68 199 199 VAL VAL H . n H 1 69 MET 69 200 200 MET MET H . n H 1 70 GLU 70 201 201 GLU GLU H . n H 1 71 VAL 71 202 202 VAL VAL H . n H 1 72 TYR 72 203 203 TYR TYR H . n H 1 73 PRO 73 204 204 PRO PRO H . n H 1 74 LEU 74 205 205 LEU LEU H . n H 1 75 ALA 75 206 206 ALA ALA H . n H 1 76 TRP 76 207 207 TRP TRP H . n H 1 77 ILE 77 208 208 ILE ILE H . n H 1 78 PHE 78 209 209 PHE PHE H . n H 1 79 PHE 79 210 210 PHE PHE H . n H 1 80 VAL 80 211 211 VAL VAL H . n H 1 81 PRO 81 212 212 PRO PRO H . n H 1 82 PHE 82 213 213 PHE PHE H . n H 1 83 ILE 83 214 214 ILE ILE H . n H 1 84 LEU 84 215 215 LEU LEU H . n H 1 85 ILE 85 216 216 ILE ILE H . n H 1 86 SER 86 217 217 SER SER H . n H 1 87 SER 87 218 218 SER SER H . n H 1 88 PHE 88 219 219 PHE PHE H . n H 1 89 MET 89 220 220 MET MET H . n H 1 90 VAL 90 221 221 VAL VAL H . n H 1 91 LEU 91 222 222 LEU LEU H . n H 1 92 ASN 92 223 223 ASN ASN H . n H 1 93 LEU 93 224 224 LEU LEU H . n H 1 94 PHE 94 225 225 PHE PHE H . n H 1 95 ILE 95 226 226 ILE ILE H . n H 1 96 ALA 96 227 227 ALA ALA H . n H 1 97 ILE 97 228 228 ILE ILE H . n H 1 98 ILE 98 229 229 ILE ILE H . n H 1 99 VAL 99 230 230 VAL VAL H . n H 1 100 SER 100 231 231 SER SER H . n H 1 101 ALA 101 232 232 ALA ALA H . n H 1 102 THR 102 233 233 THR THR H . n H 1 103 GLN 103 234 234 GLN GLN H . n H 1 104 GLU 104 235 235 GLU GLU H . n H 1 105 VAL 105 236 236 VAL VAL H . n H 1 106 HIS 106 237 237 HIS HIS H . n H 1 107 GLU 107 238 238 GLU GLU H . n H 1 108 SER 108 239 239 SER SER H . n H 1 109 GLU 109 240 240 GLU GLU H . n H 1 110 GLN 110 241 241 GLN GLN H . n H 1 111 ARG 111 242 242 ARG ARG H . n H 1 112 ALA 112 243 243 ALA ALA H . n H 1 113 GLU 113 244 244 GLU GLU H . n H 1 114 ARG 114 245 245 ARG ARG H . n H 1 115 GLU 115 246 246 GLU GLU H . n H 1 116 ALA 116 247 247 ALA ALA H . n H 1 117 ASN 117 248 248 ASN ASN H . n H 1 118 ASN 118 249 249 ASN ASN H . n H 1 119 LEU 119 250 250 LEU LEU H . n H 1 120 ILE 120 251 251 ILE ILE H . n H 1 121 ALA 121 252 252 ALA ALA H . n H 1 122 HIS 122 253 253 HIS HIS H . n H 1 123 ASP 123 254 254 ASP ASP H . n H 1 124 GLU 124 255 255 GLU GLU H . n H 1 125 ARG 125 256 256 ARG ARG H . n H 1 126 GLN 126 257 257 GLN GLN H . n H 1 127 GLU 127 258 258 GLU GLU H . n H 1 128 MET 128 259 259 MET MET H . n H 1 129 LEU 129 260 260 LEU LEU H . n H 1 130 ASP 130 261 261 ASP ASP H . n H 1 131 LEU 131 262 262 LEU LEU H . n H 1 132 MET 132 263 263 MET MET H . n H 1 133 ARG 133 264 264 ARG ARG H . n H 1 134 ALA 134 265 265 ALA ALA H . n H 1 135 MET 135 266 266 MET MET H . n H 1 136 HIS 136 267 267 HIS HIS H . n H 1 137 ALA 137 268 268 ALA ALA H . n H 1 138 LYS 138 269 269 LYS LYS H . n H 1 139 ILE 139 270 270 ILE ILE H . n H 1 140 VAL 140 271 271 VAL VAL H . n H 1 141 ALA 141 272 272 ALA ALA H . n H 1 142 LEU 142 273 273 LEU LEU H . n H 1 143 GLU 143 274 274 GLU GLU H . n H 1 144 GLN 144 275 275 GLN GLN H . n H 1 145 GLN 145 276 276 GLN GLN H . n H 1 146 GLY 146 277 277 GLY GLY H . n H 1 147 LYS 147 278 278 LYS ALA H . n H 1 148 ALA 148 279 ? ? ? H . n H 1 149 GLY 149 280 ? ? ? H . n H 1 150 GLN 150 281 ? ? ? H . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code I 2 ACT 1 501 501 ACT ACT A . J 3 NA 1 502 1 NA NA A . K 3 NA 1 503 2 NA NA A . L 2 ACT 1 301 301 ACT ACT C . M 2 ACT 1 401 401 ACT ACT D . N 4 MG 1 301 130 MG MG E . O 2 ACT 1 302 301 ACT ACT E . P 3 NA 1 301 3 NA NA F . Q 3 NA 1 301 4 NA NA G . R 2 ACT 1 302 501 ACT ACT G . S 2 ACT 1 401 401 ACT ACT H . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 134 ? OG ? A SER 3 OG 2 1 Y 1 A SER 192 ? OG ? A SER 61 OG 3 1 Y 1 A LYS 278 ? CG ? A LYS 147 CG 4 1 Y 1 A LYS 278 ? CD ? A LYS 147 CD 5 1 Y 1 A LYS 278 ? CE ? A LYS 147 CE 6 1 Y 1 A LYS 278 ? NZ ? A LYS 147 NZ 7 1 Y 1 B GLU 133 ? CG ? B GLU 2 CG 8 1 Y 1 B GLU 133 ? CD ? B GLU 2 CD 9 1 Y 1 B GLU 133 ? OE1 ? B GLU 2 OE1 10 1 Y 1 B GLU 133 ? OE2 ? B GLU 2 OE2 11 1 Y 1 B SER 134 ? OG ? B SER 3 OG 12 1 Y 1 B SER 192 ? OG ? B SER 61 OG 13 1 Y 1 B LYS 278 ? CG ? B LYS 147 CG 14 1 Y 1 B LYS 278 ? CD ? B LYS 147 CD 15 1 Y 1 B LYS 278 ? CE ? B LYS 147 CE 16 1 Y 1 B LYS 278 ? NZ ? B LYS 147 NZ 17 1 Y 1 C GLU 133 ? CG ? C GLU 2 CG 18 1 Y 1 C GLU 133 ? CD ? C GLU 2 CD 19 1 Y 1 C GLU 133 ? OE1 ? C GLU 2 OE1 20 1 Y 1 C GLU 133 ? OE2 ? C GLU 2 OE2 21 1 Y 1 C SER 134 ? OG ? C SER 3 OG 22 1 Y 1 C SER 192 ? OG ? C SER 61 OG 23 1 Y 1 C LYS 278 ? CG ? C LYS 147 CG 24 1 Y 1 C LYS 278 ? CD ? C LYS 147 CD 25 1 Y 1 C LYS 278 ? CE ? C LYS 147 CE 26 1 Y 1 C LYS 278 ? NZ ? C LYS 147 NZ 27 1 Y 1 D VAL 132 ? CG1 ? D VAL 1 CG1 28 1 Y 1 D VAL 132 ? CG2 ? D VAL 1 CG2 29 1 Y 1 D GLU 133 ? CG ? D GLU 2 CG 30 1 Y 1 D GLU 133 ? CD ? D GLU 2 CD 31 1 Y 1 D GLU 133 ? OE1 ? D GLU 2 OE1 32 1 Y 1 D GLU 133 ? OE2 ? D GLU 2 OE2 33 1 Y 1 D SER 134 ? OG ? D SER 3 OG 34 1 Y 1 D SER 192 ? OG ? D SER 61 OG 35 1 Y 1 D LYS 278 ? CG ? D LYS 147 CG 36 1 Y 1 D LYS 278 ? CD ? D LYS 147 CD 37 1 Y 1 D LYS 278 ? CE ? D LYS 147 CE 38 1 Y 1 D LYS 278 ? NZ ? D LYS 147 NZ 39 1 Y 1 E VAL 132 ? CG1 ? E VAL 1 CG1 40 1 Y 1 E VAL 132 ? CG2 ? E VAL 1 CG2 41 1 Y 1 E GLU 133 ? CG ? E GLU 2 CG 42 1 Y 1 E GLU 133 ? CD ? E GLU 2 CD 43 1 Y 1 E GLU 133 ? OE1 ? E GLU 2 OE1 44 1 Y 1 E GLU 133 ? OE2 ? E GLU 2 OE2 45 1 Y 1 E SER 134 ? OG ? E SER 3 OG 46 1 Y 1 E SER 192 ? OG ? E SER 61 OG 47 1 Y 1 E LYS 278 ? CG ? E LYS 147 CG 48 1 Y 1 E LYS 278 ? CD ? E LYS 147 CD 49 1 Y 1 E LYS 278 ? CE ? E LYS 147 CE 50 1 Y 1 E LYS 278 ? NZ ? E LYS 147 NZ 51 1 Y 1 F GLU 133 ? CG ? F GLU 2 CG 52 1 Y 1 F GLU 133 ? CD ? F GLU 2 CD 53 1 Y 1 F GLU 133 ? OE1 ? F GLU 2 OE1 54 1 Y 1 F GLU 133 ? OE2 ? F GLU 2 OE2 55 1 Y 1 F SER 134 ? OG ? F SER 3 OG 56 1 Y 1 F SER 192 ? OG ? F SER 61 OG 57 1 Y 1 F LYS 278 ? CG ? F LYS 147 CG 58 1 Y 1 F LYS 278 ? CD ? F LYS 147 CD 59 1 Y 1 F LYS 278 ? CE ? F LYS 147 CE 60 1 Y 1 F LYS 278 ? NZ ? F LYS 147 NZ 61 1 Y 1 G GLU 133 ? CG ? G GLU 2 CG 62 1 Y 1 G GLU 133 ? CD ? G GLU 2 CD 63 1 Y 1 G GLU 133 ? OE1 ? G GLU 2 OE1 64 1 Y 1 G GLU 133 ? OE2 ? G GLU 2 OE2 65 1 Y 1 G SER 134 ? OG ? G SER 3 OG 66 1 Y 1 G SER 192 ? OG ? G SER 61 OG 67 1 Y 1 G LYS 278 ? CG ? G LYS 147 CG 68 1 Y 1 G LYS 278 ? CD ? G LYS 147 CD 69 1 Y 1 G LYS 278 ? CE ? G LYS 147 CE 70 1 Y 1 G LYS 278 ? NZ ? G LYS 147 NZ 71 1 Y 1 H GLU 133 ? CG ? H GLU 2 CG 72 1 Y 1 H GLU 133 ? CD ? H GLU 2 CD 73 1 Y 1 H GLU 133 ? OE1 ? H GLU 2 OE1 74 1 Y 1 H GLU 133 ? OE2 ? H GLU 2 OE2 75 1 Y 1 H SER 134 ? OG ? H SER 3 OG 76 1 Y 1 H SER 192 ? OG ? H SER 61 OG 77 1 Y 1 H LYS 278 ? CG ? H LYS 147 CG 78 1 Y 1 H LYS 278 ? CD ? H LYS 147 CD 79 1 Y 1 H LYS 278 ? CE ? H LYS 147 CE 80 1 Y 1 H LYS 278 ? NZ ? H LYS 147 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7PGI _cell.details ? _cell.formula_units_Z ? _cell.length_a 178.180 _cell.length_a_esd ? _cell.length_b 191.800 _cell.length_b_esd ? _cell.length_c 192.320 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 64 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7PGI _symmetry.cell_setting ? _symmetry.Int_Tables_number 24 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PGI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 6.06 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 79.70 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Sodium acetate, 0.1 M HEPES pH 7.5, 20% PEG 3000, 8% Bicelles' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR CCD 130 mm' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-08-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7PGI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.6380 _reflns.d_resolution_low 19.98 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 36662 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.41 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.2 _reflns.pdbx_Rmerge_I_obs 0.157 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.64 _reflns_shell.d_res_low 3.769 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3616 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.172 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 363.980 _refine.B_iso_mean 130.7106 _refine.B_iso_min 30.000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7PGI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.6380 _refine.ls_d_res_low 14.9930 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 36357 _refine.ls_number_reflns_R_free 1755 _refine.ls_number_reflns_R_work 34602 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.0400 _refine.ls_percent_reflns_R_free 4.8300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2879 _refine.ls_R_factor_R_free 0.3035 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2872 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7PGG _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.8900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.6900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.6380 _refine_hist.d_res_low 14.9930 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 9275 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 1170 _refine_hist.pdbx_B_iso_mean_ligand 104.68 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 9246 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? 0.666 ? ? 1 POSITIONAL ? A 1047 ? ? 1 'X-RAY DIFFRACTION' 2 ? ? 0.666 ? ? 2 POSITIONAL ? B 1047 ? ? 1 'X-RAY DIFFRACTION' 3 ? ? 0.681 ? ? 3 POSITIONAL ? C 1047 ? ? 1 'X-RAY DIFFRACTION' 4 ? ? 0.627 ? ? 4 POSITIONAL ? D 1047 ? ? 1 'X-RAY DIFFRACTION' 5 ? ? 0.654 ? ? 5 POSITIONAL ? E 1047 ? ? 1 'X-RAY DIFFRACTION' 6 ? ? 0.771 ? ? 6 POSITIONAL ? F 1047 ? ? 1 'X-RAY DIFFRACTION' 7 ? ? 0.541 ? ? 7 POSITIONAL ? G 1047 ? ? 1 'X-RAY DIFFRACTION' 8 ? ? 0.802 ? ? 8 POSITIONAL ? H 1047 ? ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.6380 3.7349 2685 . 170 2515 98.0000 . . . 0.4041 0.0000 0.3704 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 3.7349 3.8430 2804 . 131 2673 99.0000 . . . 0.3388 0.0000 0.3709 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 3.8430 3.9649 2794 . 157 2637 99.0000 . . . 0.3725 0.0000 0.3539 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 3.9649 4.1038 2752 . 135 2617 99.0000 . . . 0.3354 0.0000 0.3537 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 4.1038 4.2645 2794 . 137 2657 99.0000 . . . 0.3845 0.0000 0.3235 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 4.2645 4.4537 2770 . 153 2617 99.0000 . . . 0.2889 0.0000 0.3035 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 4.4537 4.6817 2794 . 157 2637 99.0000 . . . 0.3014 0.0000 0.2659 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 4.6817 4.9650 2774 . 118 2656 99.0000 . . . 0.2880 0.0000 0.2678 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 4.9650 5.3323 2815 . 121 2694 99.0000 . . . 0.2832 0.0000 0.2814 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 5.3323 5.8399 2808 . 132 2676 100.0000 . . . 0.2960 0.0000 0.2820 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 5.8399 6.6205 2838 . 132 2706 99.0000 . . . 0.3240 0.0000 0.2878 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 6.6205 8.1147 2849 . 98 2751 99.0000 . . . 0.2906 0.0000 0.2778 . . . . . . . 13 . . . 'X-RAY DIFFRACTION' 8.1147 14.9930 2880 . 114 2766 98.0000 . . . 0.2481 0.0000 0.2516 . . . . . . . 13 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; 1 2 ;(chain B and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; 1 3 ;(chain C and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; 1 4 ;(chain D and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; 1 5 ;(chain E and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; 1 6 ;(chain F and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; 1 7 ;(chain G and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; 1 8 ;(chain H and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.end_auth_comp_id 1 1 1 ? A 134 A 135 ;(chain A and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 1 2 ? A 138 A 165 ;(chain A and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 1 3 ? A 167 A 190 ;(chain A and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 1 4 ? A 192 A 192 ;(chain A and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 1 5 ? A 133 A 278 ;(chain A and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 1 6 ? A 202 A 265 ;(chain A and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 1 7 ? A 267 A 268 ;(chain A and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 1 8 ? A 267 A 268 ;(chain A and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 1 9 ? A 274 A 275 ;(chain A and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 1 10 ? A 277 A 278 ;(chain A and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 2 1 ? B 134 B 135 ;(chain B and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 2 2 ? B 138 B 165 ;(chain B and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 2 3 ? B 167 B 190 ;(chain B and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 2 4 ? B 192 B 192 ;(chain B and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 2 5 ? B 133 B 278 ;(chain B and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 2 6 ? B 202 B 265 ;(chain B and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 2 7 ? B 267 B 268 ;(chain B and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 2 8 ? B 267 B 268 ;(chain B and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 2 9 ? B 274 B 275 ;(chain B and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 2 10 ? B 277 B 278 ;(chain B and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 3 1 ? C 134 C 135 ;(chain C and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 3 2 ? C 138 C 165 ;(chain C and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 3 3 ? C 133 C 278 ;(chain C and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 3 4 ? C 194 C 194 ;(chain C and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 3 5 ? C 192 C 192 ;(chain C and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 3 6 ? C 194 C 200 ;(chain C and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 3 7 ? C 208 C 200 ;(chain C and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 3 8 ? C 267 C 268 ;(chain C and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 3 9 ? C 274 C 275 ;(chain C and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 3 10 ? C 277 C 278 ;(chain C and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 4 1 ? D 134 D 135 ;(chain D and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 4 2 ? D 138 D 165 ;(chain D and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 4 3 ? D 132 D 278 ;(chain D and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 4 4 ? D 194 D 194 ;(chain D and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 4 5 ? D 192 D 192 ;(chain D and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 4 6 ? D 198 D 200 ;(chain D and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 4 7 ? D 202 D 2652 ;(chain D and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 4 8 ? D 267 D 268 ;(chain D and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 4 9 ? D 270 D 272 ;(chain D and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 4 10 ? D 274 D 275 ;(chain D and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 4 11 ? D 277 D 278 ;(chain D and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 5 1 ? E 134 E 135 ;(chain E and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 5 2 ? E 138 E 165 ;(chain E and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 5 3 ? E 132 E 278 ;(chain E and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 5 4 ? E 194 E 194 ;(chain E and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 5 5 ? E 192 E 192 ;(chain E and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 5 6 ? E 194 E 200 ;(chain E and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 5 7 ? E 208 E 200 ;(chain E and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 5 8 ? E 267 E 268 ;(chain E and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 5 9 ? E 274 E 275 ;(chain E and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 5 10 ? E 277 E 278 ;(chain E and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 6 1 ? F 134 F 135 ;(chain F and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 6 2 ? F 138 F 165 ;(chain F and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 6 3 ? F 167 F 190 ;(chain F and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 6 4 ? F 192 F 192 ;(chain F and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 6 5 ? F 133 F 278 ;(chain F and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 6 6 ? F 202 F 265 ;(chain F and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 6 7 ? F 267 F 268 ;(chain F and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 6 8 ? F 267 F 268 ;(chain F and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 6 9 ? F 274 F 275 ;(chain F and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 6 10 ? F 277 F 278 ;(chain F and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 7 1 ? G 134 G 135 ;(chain G and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 7 2 ? G 138 G 165 ;(chain G and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 7 3 ? G 167 G 190 ;(chain G and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 7 4 ? G 198 G 200 ;(chain G and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 7 5 ? G 202 G 265 ;(chain G and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 7 6 ? G 267 G 268 ;(chain G and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 7 7 ? G 274 G 27 ;(chain G and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 7 8 ? G 274 G 275 ;(chain G and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 7 9 ? G 277 G 278 ;(chain G and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 8 1 ? H 134 H 135 ;(chain H and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 8 2 ? H 138 H 165 ;(chain H and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 8 3 ? H 167 H 190 ;(chain H and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 8 4 ? H 198 H 200 ;(chain H and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 8 5 ? H 202 H 265 ;(chain H and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 8 6 ? H 267 H 268 ;(chain H and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 8 7 ? H 274 H 27 ;(chain H and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 8 8 ? H 274 H 275 ;(chain H and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? 1 8 9 ? H 277 H 278 ;(chain H and (resid 134 through 135 or resid 138 through 165 or resid 167 through 190 or resid 192 or resid 194 through 196 or resid 198 through 200 or resid 202 through 265 or resid 267 through 268 or resid 270 through 272 or resid 274 through 275 or resid 277 through 278)) ; ? ? ? ? ? ? ? ? ? ? # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7PGI _struct.title 'NaVAb1p (bicelles)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PGI _struct_keywords.text 'ion channel membrane protein transport protein antibody complex, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? F N N 1 ? G N N 1 ? H N N 1 ? I N N 2 ? J N N 3 ? K N N 3 ? L N N 2 ? M N N 2 ? N N N 4 ? O N N 2 ? P N N 3 ? Q N N 3 ? R N N 2 ? S N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q0VNY2_ALCBS _struct_ref.pdbx_db_accession Q0VNY2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VESLMQALPGIGWTAALLLMMFYIFAVMGTELFGEAFPQWFGSLGASIYSLFQIMTLESWSMGIARPVMEVYPLAWIFFV PFILISSFMVLNLFIAIIVSATQEVHESEQRAEREANNLIAHDERQEMLDLMRAMHAKIVALEAAQQGKAGQ ; _struct_ref.pdbx_align_begin 132 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7PGI A 1 ? 150 ? Q0VNY2 132 ? 283 ? 132 281 2 1 7PGI B 1 ? 150 ? Q0VNY2 132 ? 283 ? 132 281 3 1 7PGI C 1 ? 150 ? Q0VNY2 132 ? 283 ? 132 281 4 1 7PGI D 1 ? 150 ? Q0VNY2 132 ? 283 ? 132 281 5 1 7PGI E 1 ? 150 ? Q0VNY2 132 ? 283 ? 132 281 6 1 7PGI F 1 ? 150 ? Q0VNY2 132 ? 283 ? 132 281 7 1 7PGI G 1 ? 150 ? Q0VNY2 132 ? 283 ? 132 281 8 1 7PGI H 1 ? 150 ? Q0VNY2 132 ? 283 ? 132 281 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7PGI ? A ? ? UNP Q0VNY2 ALA 275 deletion ? 1 1 7PGI ? A ? ? UNP Q0VNY2 ALA 276 deletion ? 2 2 7PGI ? B ? ? UNP Q0VNY2 ALA 275 deletion ? 3 2 7PGI ? B ? ? UNP Q0VNY2 ALA 276 deletion ? 4 3 7PGI ? C ? ? UNP Q0VNY2 ALA 275 deletion ? 5 3 7PGI ? C ? ? UNP Q0VNY2 ALA 276 deletion ? 6 4 7PGI ? D ? ? UNP Q0VNY2 ALA 275 deletion ? 7 4 7PGI ? D ? ? UNP Q0VNY2 ALA 276 deletion ? 8 5 7PGI ? E ? ? UNP Q0VNY2 ALA 275 deletion ? 9 5 7PGI ? E ? ? UNP Q0VNY2 ALA 276 deletion ? 10 6 7PGI ? F ? ? UNP Q0VNY2 ALA 275 deletion ? 11 6 7PGI ? F ? ? UNP Q0VNY2 ALA 276 deletion ? 12 7 7PGI ? G ? ? UNP Q0VNY2 ALA 275 deletion ? 13 7 7PGI ? G ? ? UNP Q0VNY2 ALA 276 deletion ? 14 8 7PGI ? H ? ? UNP Q0VNY2 ALA 275 deletion ? 15 8 7PGI ? H ? ? UNP Q0VNY2 ALA 276 deletion ? 16 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA tetrameric 4 2 author_and_software_defined_assembly PISA tetrameric 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 14140 ? 1 MORE -160 ? 1 'SSA (A^2)' 30210 ? 2 'ABSA (A^2)' 14260 ? 2 MORE -170 ? 2 'SSA (A^2)' 29950 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,I,J,K,L,M 2 1 E,F,G,H,N,O,P,Q,R,S # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 4 ? GLN A 6 ? LEU A 135 GLN A 137 5 ? 3 HELX_P HELX_P2 AA2 ALA A 7 ? GLY A 34 ? ALA A 138 GLY A 165 1 ? 28 HELX_P HELX_P3 AA3 PHE A 37 ? GLY A 42 ? PHE A 168 GLY A 173 1 ? 6 HELX_P HELX_P4 AA4 SER A 43 ? THR A 56 ? SER A 174 THR A 187 1 ? 14 HELX_P HELX_P5 AA5 ILE A 64 ? GLU A 70 ? ILE A 195 GLU A 201 1 ? 7 HELX_P HELX_P6 AA6 ALA A 75 ? GLN A 145 ? ALA A 206 GLN A 276 1 ? 71 HELX_P HELX_P7 AA7 LEU B 4 ? GLN B 6 ? LEU B 135 GLN B 137 5 ? 3 HELX_P HELX_P8 AA8 ALA B 7 ? GLY B 34 ? ALA B 138 GLY B 165 1 ? 28 HELX_P HELX_P9 AA9 PHE B 37 ? GLY B 42 ? PHE B 168 GLY B 173 1 ? 6 HELX_P HELX_P10 AB1 SER B 43 ? THR B 56 ? SER B 174 THR B 187 1 ? 14 HELX_P HELX_P11 AB2 ILE B 64 ? TYR B 72 ? ILE B 195 TYR B 203 1 ? 9 HELX_P HELX_P12 AB3 ALA B 75 ? LYS B 147 ? ALA B 206 LYS B 278 1 ? 73 HELX_P HELX_P13 AB4 LEU C 4 ? GLN C 6 ? LEU C 135 GLN C 137 5 ? 3 HELX_P HELX_P14 AB5 ALA C 7 ? GLY C 34 ? ALA C 138 GLY C 165 1 ? 28 HELX_P HELX_P15 AB6 PHE C 37 ? GLY C 42 ? PHE C 168 GLY C 173 1 ? 6 HELX_P HELX_P16 AB7 SER C 43 ? THR C 56 ? SER C 174 THR C 187 1 ? 14 HELX_P HELX_P17 AB8 ILE C 64 ? TYR C 72 ? ILE C 195 TYR C 203 1 ? 9 HELX_P HELX_P18 AB9 ALA C 75 ? LYS C 147 ? ALA C 206 LYS C 278 1 ? 73 HELX_P HELX_P19 AC1 LEU D 4 ? GLN D 6 ? LEU D 135 GLN D 137 5 ? 3 HELX_P HELX_P20 AC2 ALA D 7 ? GLY D 34 ? ALA D 138 GLY D 165 1 ? 28 HELX_P HELX_P21 AC3 PHE D 37 ? GLY D 42 ? PHE D 168 GLY D 173 1 ? 6 HELX_P HELX_P22 AC4 SER D 43 ? THR D 56 ? SER D 174 THR D 187 1 ? 14 HELX_P HELX_P23 AC5 ILE D 64 ? TYR D 72 ? ILE D 195 TYR D 203 1 ? 9 HELX_P HELX_P24 AC6 ALA D 75 ? LYS D 147 ? ALA D 206 LYS D 278 1 ? 73 HELX_P HELX_P25 AC7 LEU E 4 ? GLN E 6 ? LEU E 135 GLN E 137 5 ? 3 HELX_P HELX_P26 AC8 ALA E 7 ? GLY E 34 ? ALA E 138 GLY E 165 1 ? 28 HELX_P HELX_P27 AC9 PHE E 37 ? GLY E 42 ? PHE E 168 GLY E 173 1 ? 6 HELX_P HELX_P28 AD1 SER E 43 ? THR E 56 ? SER E 174 THR E 187 1 ? 14 HELX_P HELX_P29 AD2 ILE E 64 ? TYR E 72 ? ILE E 195 TYR E 203 1 ? 9 HELX_P HELX_P30 AD3 ALA E 75 ? GLN E 145 ? ALA E 206 GLN E 276 1 ? 71 HELX_P HELX_P31 AD4 ALA F 7 ? GLY F 34 ? ALA F 138 GLY F 165 1 ? 28 HELX_P HELX_P32 AD5 PHE F 37 ? GLY F 42 ? PHE F 168 GLY F 173 1 ? 6 HELX_P HELX_P33 AD6 SER F 43 ? THR F 56 ? SER F 174 THR F 187 1 ? 14 HELX_P HELX_P34 AD7 ILE F 64 ? TYR F 72 ? ILE F 195 TYR F 203 1 ? 9 HELX_P HELX_P35 AD8 ALA F 75 ? GLN F 145 ? ALA F 206 GLN F 276 1 ? 71 HELX_P HELX_P36 AD9 LEU G 4 ? GLN G 6 ? LEU G 135 GLN G 137 5 ? 3 HELX_P HELX_P37 AE1 ALA G 7 ? GLY G 34 ? ALA G 138 GLY G 165 1 ? 28 HELX_P HELX_P38 AE2 PHE G 37 ? GLY G 42 ? PHE G 168 GLY G 173 1 ? 6 HELX_P HELX_P39 AE3 SER G 43 ? THR G 56 ? SER G 174 THR G 187 1 ? 14 HELX_P HELX_P40 AE4 ILE G 64 ? TYR G 72 ? ILE G 195 TYR G 203 1 ? 9 HELX_P HELX_P41 AE5 ALA G 75 ? GLN G 145 ? ALA G 206 GLN G 276 1 ? 71 HELX_P HELX_P42 AE6 ALA H 7 ? GLY H 34 ? ALA H 138 GLY H 165 1 ? 28 HELX_P HELX_P43 AE7 PHE H 37 ? GLY H 42 ? PHE H 168 GLY H 173 1 ? 6 HELX_P HELX_P44 AE8 SER H 43 ? THR H 56 ? SER H 174 THR H 187 1 ? 14 HELX_P HELX_P45 AE9 ILE H 64 ? TYR H 72 ? ILE H 195 TYR H 203 1 ? 9 HELX_P HELX_P46 AF1 ALA H 75 ? GLN H 145 ? ALA H 206 GLN H 276 1 ? 71 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A TYR 23 OH ? ? ? 1_555 K NA . NA ? ? A TYR 154 A NA 503 1_555 ? ? ? ? ? ? ? 3.049 ? ? metalc2 metalc ? ? I ACT . O ? ? ? 1_555 J NA . NA ? ? A ACT 501 A NA 502 1_555 ? ? ? ? ? ? ? 3.132 ? ? metalc3 metalc ? ? J NA . NA ? ? ? 1_555 L ACT . O ? ? A NA 502 C ACT 301 1_555 ? ? ? ? ? ? ? 3.017 ? ? metalc4 metalc ? ? J NA . NA ? ? ? 1_555 L ACT . OXT ? ? A NA 502 C ACT 301 1_555 ? ? ? ? ? ? ? 3.190 ? ? metalc5 metalc ? ? J NA . NA ? ? ? 1_555 M ACT . OXT ? ? A NA 502 D ACT 401 1_555 ? ? ? ? ? ? ? 2.765 ? ? metalc6 metalc ? ? K NA . NA ? ? ? 1_555 B TYR 23 OH ? ? A NA 503 B TYR 154 1_555 ? ? ? ? ? ? ? 2.772 ? ? metalc7 metalc ? ? K NA . NA ? ? ? 1_555 C TYR 23 OH ? ? A NA 503 C TYR 154 1_555 ? ? ? ? ? ? ? 2.745 ? ? metalc8 metalc ? ? K NA . NA ? ? ? 1_555 D TYR 23 OH ? ? A NA 503 D TYR 154 1_555 ? ? ? ? ? ? ? 2.842 ? ? metalc9 metalc ? ? K NA . NA ? ? ? 1_555 M ACT . O ? ? A NA 503 D ACT 401 1_555 ? ? ? ? ? ? ? 3.035 ? ? metalc10 metalc ? ? E TYR 23 OH ? ? ? 1_555 Q NA . NA ? ? E TYR 154 G NA 301 1_555 ? ? ? ? ? ? ? 3.024 ? ? metalc11 metalc ? ? O ACT . OXT ? ? ? 1_555 P NA . NA ? ? E ACT 302 F NA 301 1_555 ? ? ? ? ? ? ? 2.635 ? ? metalc12 metalc ? ? F TYR 23 OH ? ? ? 1_555 Q NA . NA ? ? F TYR 154 G NA 301 1_555 ? ? ? ? ? ? ? 2.884 ? ? metalc13 metalc ? ? G TYR 23 OH ? ? ? 1_555 Q NA . NA ? ? G TYR 154 G NA 301 1_555 ? ? ? ? ? ? ? 2.560 ? ? metalc14 metalc ? ? Q NA . NA ? ? ? 1_555 H TYR 23 OH ? ? G NA 301 H TYR 154 1_555 ? ? ? ? ? ? ? 3.105 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OH ? A TYR 23 ? A TYR 154 ? 1_555 NA ? K NA . ? A NA 503 ? 1_555 OH ? B TYR 23 ? B TYR 154 ? 1_555 91.4 ? 2 OH ? A TYR 23 ? A TYR 154 ? 1_555 NA ? K NA . ? A NA 503 ? 1_555 OH ? C TYR 23 ? C TYR 154 ? 1_555 162.7 ? 3 OH ? B TYR 23 ? B TYR 154 ? 1_555 NA ? K NA . ? A NA 503 ? 1_555 OH ? C TYR 23 ? C TYR 154 ? 1_555 83.7 ? 4 OH ? A TYR 23 ? A TYR 154 ? 1_555 NA ? K NA . ? A NA 503 ? 1_555 OH ? D TYR 23 ? D TYR 154 ? 1_555 82.7 ? 5 OH ? B TYR 23 ? B TYR 154 ? 1_555 NA ? K NA . ? A NA 503 ? 1_555 OH ? D TYR 23 ? D TYR 154 ? 1_555 160.0 ? 6 OH ? C TYR 23 ? C TYR 154 ? 1_555 NA ? K NA . ? A NA 503 ? 1_555 OH ? D TYR 23 ? D TYR 154 ? 1_555 96.2 ? 7 OH ? A TYR 23 ? A TYR 154 ? 1_555 NA ? K NA . ? A NA 503 ? 1_555 O ? M ACT . ? D ACT 401 ? 1_555 86.0 ? 8 OH ? B TYR 23 ? B TYR 154 ? 1_555 NA ? K NA . ? A NA 503 ? 1_555 O ? M ACT . ? D ACT 401 ? 1_555 123.0 ? 9 OH ? C TYR 23 ? C TYR 154 ? 1_555 NA ? K NA . ? A NA 503 ? 1_555 O ? M ACT . ? D ACT 401 ? 1_555 110.5 ? 10 OH ? D TYR 23 ? D TYR 154 ? 1_555 NA ? K NA . ? A NA 503 ? 1_555 O ? M ACT . ? D ACT 401 ? 1_555 75.9 ? 11 O ? I ACT . ? A ACT 501 ? 1_555 NA ? J NA . ? A NA 502 ? 1_555 O ? L ACT . ? C ACT 301 ? 1_555 97.6 ? 12 O ? I ACT . ? A ACT 501 ? 1_555 NA ? J NA . ? A NA 502 ? 1_555 OXT ? L ACT . ? C ACT 301 ? 1_555 63.4 ? 13 O ? L ACT . ? C ACT 301 ? 1_555 NA ? J NA . ? A NA 502 ? 1_555 OXT ? L ACT . ? C ACT 301 ? 1_555 43.0 ? 14 O ? I ACT . ? A ACT 501 ? 1_555 NA ? J NA . ? A NA 502 ? 1_555 OXT ? M ACT . ? D ACT 401 ? 1_555 118.6 ? 15 O ? L ACT . ? C ACT 301 ? 1_555 NA ? J NA . ? A NA 502 ? 1_555 OXT ? M ACT . ? D ACT 401 ? 1_555 105.5 ? 16 OXT ? L ACT . ? C ACT 301 ? 1_555 NA ? J NA . ? A NA 502 ? 1_555 OXT ? M ACT . ? D ACT 401 ? 1_555 143.9 ? 17 OH ? E TYR 23 ? E TYR 154 ? 1_555 NA ? Q NA . ? G NA 301 ? 1_555 OH ? F TYR 23 ? F TYR 154 ? 1_555 84.2 ? 18 OH ? E TYR 23 ? E TYR 154 ? 1_555 NA ? Q NA . ? G NA 301 ? 1_555 OH ? G TYR 23 ? G TYR 154 ? 1_555 160.9 ? 19 OH ? F TYR 23 ? F TYR 154 ? 1_555 NA ? Q NA . ? G NA 301 ? 1_555 OH ? G TYR 23 ? G TYR 154 ? 1_555 92.8 ? 20 OH ? E TYR 23 ? E TYR 154 ? 1_555 NA ? Q NA . ? G NA 301 ? 1_555 OH ? H TYR 23 ? H TYR 154 ? 1_555 88.7 ? 21 OH ? F TYR 23 ? F TYR 154 ? 1_555 NA ? Q NA . ? G NA 301 ? 1_555 OH ? H TYR 23 ? H TYR 154 ? 1_555 155.1 ? 22 OH ? G TYR 23 ? G TYR 154 ? 1_555 NA ? Q NA . ? G NA 301 ? 1_555 OH ? H TYR 23 ? H TYR 154 ? 1_555 86.2 ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG1 A ILE 179 ? ? CB A ILE 179 ? ? CG2 A ILE 179 ? ? 98.07 111.40 -13.33 2.20 N 2 1 NE A ARG 256 ? ? CZ A ARG 256 ? ? NH1 A ARG 256 ? ? 116.91 120.30 -3.39 0.50 N 3 1 NE A ARG 256 ? ? CZ A ARG 256 ? ? NH2 A ARG 256 ? ? 124.28 120.30 3.98 0.50 N 4 1 CA A LEU 262 ? ? CB A LEU 262 ? ? CG A LEU 262 ? ? 132.73 115.30 17.43 2.30 N 5 1 CB A MET 266 ? ? CG A MET 266 ? ? SD A MET 266 ? ? 90.10 112.40 -22.30 3.00 N 6 1 CG1 C ILE 179 ? ? CB C ILE 179 ? ? CG2 C ILE 179 ? ? 97.96 111.40 -13.44 2.20 N 7 1 CA C LEU 262 ? ? CB C LEU 262 ? ? CG C LEU 262 ? ? 132.64 115.30 17.34 2.30 N 8 1 CA D LEU 262 ? ? CB D LEU 262 ? ? CG D LEU 262 ? ? 129.33 115.30 14.03 2.30 N 9 1 CG1 E ILE 179 ? ? CB E ILE 179 ? ? CG2 E ILE 179 ? ? 97.88 111.40 -13.52 2.20 N 10 1 CA E LEU 262 ? ? CB E LEU 262 ? ? CG E LEU 262 ? ? 132.63 115.30 17.33 2.30 N 11 1 CA F LEU 262 ? ? CB F LEU 262 ? ? CG F LEU 262 ? ? 129.50 115.30 14.20 2.30 N 12 1 CG1 G ILE 179 ? ? CB G ILE 179 ? ? CG2 G ILE 179 ? ? 98.09 111.40 -13.31 2.20 N 13 1 CA G LEU 262 ? ? CB G LEU 262 ? ? CG G LEU 262 ? ? 132.80 115.30 17.50 2.30 N 14 1 CA H LEU 262 ? ? CB H LEU 262 ? ? CG H LEU 262 ? ? 129.32 115.30 14.02 2.30 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 188 ? ? 59.30 19.98 2 1 MET A 193 ? ? -99.95 58.57 3 1 LEU B 188 ? ? 59.89 19.18 4 1 LEU C 188 ? ? 59.34 19.92 5 1 MET C 193 ? ? -100.17 54.40 6 1 GLU D 133 ? ? -69.53 72.36 7 1 GLU E 133 ? ? -66.57 63.15 8 1 MET E 193 ? ? -99.70 35.75 9 1 LEU F 188 ? ? 59.26 19.75 10 1 MET G 193 ? ? -99.04 33.16 11 1 LEU H 188 ? ? 59.27 19.85 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLU _pdbx_validate_peptide_omega.auth_asym_id_1 D _pdbx_validate_peptide_omega.auth_seq_id_1 133 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 SER _pdbx_validate_peptide_omega.auth_asym_id_2 D _pdbx_validate_peptide_omega.auth_seq_id_2 134 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 146.62 # _pdbx_entry_details.entry_id 7PGI _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 132 ? A VAL 1 2 1 Y 1 A ALA 279 ? A ALA 148 3 1 Y 1 A GLY 280 ? A GLY 149 4 1 Y 1 A GLN 281 ? A GLN 150 5 1 Y 1 B VAL 132 ? B VAL 1 6 1 Y 1 B ALA 279 ? B ALA 148 7 1 Y 1 B GLY 280 ? B GLY 149 8 1 Y 1 B GLN 281 ? B GLN 150 9 1 Y 1 C VAL 132 ? C VAL 1 10 1 Y 1 C ALA 279 ? C ALA 148 11 1 Y 1 C GLY 280 ? C GLY 149 12 1 Y 1 C GLN 281 ? C GLN 150 13 1 Y 1 D ALA 279 ? D ALA 148 14 1 Y 1 D GLY 280 ? D GLY 149 15 1 Y 1 D GLN 281 ? D GLN 150 16 1 Y 1 E ALA 279 ? E ALA 148 17 1 Y 1 E GLY 280 ? E GLY 149 18 1 Y 1 E GLN 281 ? E GLN 150 19 1 Y 1 F VAL 132 ? F VAL 1 20 1 Y 1 F ALA 279 ? F ALA 148 21 1 Y 1 F GLY 280 ? F GLY 149 22 1 Y 1 F GLN 281 ? F GLN 150 23 1 Y 1 G VAL 132 ? G VAL 1 24 1 Y 1 G ALA 279 ? G ALA 148 25 1 Y 1 G GLY 280 ? G GLY 149 26 1 Y 1 G GLN 281 ? G GLN 150 27 1 Y 1 H VAL 132 ? H VAL 1 28 1 Y 1 H ALA 279 ? H ALA 148 29 1 Y 1 H GLY 280 ? H GLY 149 30 1 Y 1 H GLN 281 ? H GLN 150 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACT C C N N 1 ACT O O N N 2 ACT OXT O N N 3 ACT CH3 C N N 4 ACT H1 H N N 5 ACT H2 H N N 6 ACT H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 GLN N N N N 81 GLN CA C N S 82 GLN C C N N 83 GLN O O N N 84 GLN CB C N N 85 GLN CG C N N 86 GLN CD C N N 87 GLN OE1 O N N 88 GLN NE2 N N N 89 GLN OXT O N N 90 GLN H H N N 91 GLN H2 H N N 92 GLN HA H N N 93 GLN HB2 H N N 94 GLN HB3 H N N 95 GLN HG2 H N N 96 GLN HG3 H N N 97 GLN HE21 H N N 98 GLN HE22 H N N 99 GLN HXT H N N 100 GLU N N N N 101 GLU CA C N S 102 GLU C C N N 103 GLU O O N N 104 GLU CB C N N 105 GLU CG C N N 106 GLU CD C N N 107 GLU OE1 O N N 108 GLU OE2 O N N 109 GLU OXT O N N 110 GLU H H N N 111 GLU H2 H N N 112 GLU HA H N N 113 GLU HB2 H N N 114 GLU HB3 H N N 115 GLU HG2 H N N 116 GLU HG3 H N N 117 GLU HE2 H N N 118 GLU HXT H N N 119 GLY N N N N 120 GLY CA C N N 121 GLY C C N N 122 GLY O O N N 123 GLY OXT O N N 124 GLY H H N N 125 GLY H2 H N N 126 GLY HA2 H N N 127 GLY HA3 H N N 128 GLY HXT H N N 129 HIS N N N N 130 HIS CA C N S 131 HIS C C N N 132 HIS O O N N 133 HIS CB C N N 134 HIS CG C Y N 135 HIS ND1 N Y N 136 HIS CD2 C Y N 137 HIS CE1 C Y N 138 HIS NE2 N Y N 139 HIS OXT O N N 140 HIS H H N N 141 HIS H2 H N N 142 HIS HA H N N 143 HIS HB2 H N N 144 HIS HB3 H N N 145 HIS HD1 H N N 146 HIS HD2 H N N 147 HIS HE1 H N N 148 HIS HE2 H N N 149 HIS HXT H N N 150 ILE N N N N 151 ILE CA C N S 152 ILE C C N N 153 ILE O O N N 154 ILE CB C N S 155 ILE CG1 C N N 156 ILE CG2 C N N 157 ILE CD1 C N N 158 ILE OXT O N N 159 ILE H H N N 160 ILE H2 H N N 161 ILE HA H N N 162 ILE HB H N N 163 ILE HG12 H N N 164 ILE HG13 H N N 165 ILE HG21 H N N 166 ILE HG22 H N N 167 ILE HG23 H N N 168 ILE HD11 H N N 169 ILE HD12 H N N 170 ILE HD13 H N N 171 ILE HXT H N N 172 LEU N N N N 173 LEU CA C N S 174 LEU C C N N 175 LEU O O N N 176 LEU CB C N N 177 LEU CG C N N 178 LEU CD1 C N N 179 LEU CD2 C N N 180 LEU OXT O N N 181 LEU H H N N 182 LEU H2 H N N 183 LEU HA H N N 184 LEU HB2 H N N 185 LEU HB3 H N N 186 LEU HG H N N 187 LEU HD11 H N N 188 LEU HD12 H N N 189 LEU HD13 H N N 190 LEU HD21 H N N 191 LEU HD22 H N N 192 LEU HD23 H N N 193 LEU HXT H N N 194 LYS N N N N 195 LYS CA C N S 196 LYS C C N N 197 LYS O O N N 198 LYS CB C N N 199 LYS CG C N N 200 LYS CD C N N 201 LYS CE C N N 202 LYS NZ N N N 203 LYS OXT O N N 204 LYS H H N N 205 LYS H2 H N N 206 LYS HA H N N 207 LYS HB2 H N N 208 LYS HB3 H N N 209 LYS HG2 H N N 210 LYS HG3 H N N 211 LYS HD2 H N N 212 LYS HD3 H N N 213 LYS HE2 H N N 214 LYS HE3 H N N 215 LYS HZ1 H N N 216 LYS HZ2 H N N 217 LYS HZ3 H N N 218 LYS HXT H N N 219 MET N N N N 220 MET CA C N S 221 MET C C N N 222 MET O O N N 223 MET CB C N N 224 MET CG C N N 225 MET SD S N N 226 MET CE C N N 227 MET OXT O N N 228 MET H H N N 229 MET H2 H N N 230 MET HA H N N 231 MET HB2 H N N 232 MET HB3 H N N 233 MET HG2 H N N 234 MET HG3 H N N 235 MET HE1 H N N 236 MET HE2 H N N 237 MET HE3 H N N 238 MET HXT H N N 239 MG MG MG N N 240 NA NA NA N N 241 PHE N N N N 242 PHE CA C N S 243 PHE C C N N 244 PHE O O N N 245 PHE CB C N N 246 PHE CG C Y N 247 PHE CD1 C Y N 248 PHE CD2 C Y N 249 PHE CE1 C Y N 250 PHE CE2 C Y N 251 PHE CZ C Y N 252 PHE OXT O N N 253 PHE H H N N 254 PHE H2 H N N 255 PHE HA H N N 256 PHE HB2 H N N 257 PHE HB3 H N N 258 PHE HD1 H N N 259 PHE HD2 H N N 260 PHE HE1 H N N 261 PHE HE2 H N N 262 PHE HZ H N N 263 PHE HXT H N N 264 PRO N N N N 265 PRO CA C N S 266 PRO C C N N 267 PRO O O N N 268 PRO CB C N N 269 PRO CG C N N 270 PRO CD C N N 271 PRO OXT O N N 272 PRO H H N N 273 PRO HA H N N 274 PRO HB2 H N N 275 PRO HB3 H N N 276 PRO HG2 H N N 277 PRO HG3 H N N 278 PRO HD2 H N N 279 PRO HD3 H N N 280 PRO HXT H N N 281 SER N N N N 282 SER CA C N S 283 SER C C N N 284 SER O O N N 285 SER CB C N N 286 SER OG O N N 287 SER OXT O N N 288 SER H H N N 289 SER H2 H N N 290 SER HA H N N 291 SER HB2 H N N 292 SER HB3 H N N 293 SER HG H N N 294 SER HXT H N N 295 THR N N N N 296 THR CA C N S 297 THR C C N N 298 THR O O N N 299 THR CB C N R 300 THR OG1 O N N 301 THR CG2 C N N 302 THR OXT O N N 303 THR H H N N 304 THR H2 H N N 305 THR HA H N N 306 THR HB H N N 307 THR HG1 H N N 308 THR HG21 H N N 309 THR HG22 H N N 310 THR HG23 H N N 311 THR HXT H N N 312 TRP N N N N 313 TRP CA C N S 314 TRP C C N N 315 TRP O O N N 316 TRP CB C N N 317 TRP CG C Y N 318 TRP CD1 C Y N 319 TRP CD2 C Y N 320 TRP NE1 N Y N 321 TRP CE2 C Y N 322 TRP CE3 C Y N 323 TRP CZ2 C Y N 324 TRP CZ3 C Y N 325 TRP CH2 C Y N 326 TRP OXT O N N 327 TRP H H N N 328 TRP H2 H N N 329 TRP HA H N N 330 TRP HB2 H N N 331 TRP HB3 H N N 332 TRP HD1 H N N 333 TRP HE1 H N N 334 TRP HE3 H N N 335 TRP HZ2 H N N 336 TRP HZ3 H N N 337 TRP HH2 H N N 338 TRP HXT H N N 339 TYR N N N N 340 TYR CA C N S 341 TYR C C N N 342 TYR O O N N 343 TYR CB C N N 344 TYR CG C Y N 345 TYR CD1 C Y N 346 TYR CD2 C Y N 347 TYR CE1 C Y N 348 TYR CE2 C Y N 349 TYR CZ C Y N 350 TYR OH O N N 351 TYR OXT O N N 352 TYR H H N N 353 TYR H2 H N N 354 TYR HA H N N 355 TYR HB2 H N N 356 TYR HB3 H N N 357 TYR HD1 H N N 358 TYR HD2 H N N 359 TYR HE1 H N N 360 TYR HE2 H N N 361 TYR HH H N N 362 TYR HXT H N N 363 VAL N N N N 364 VAL CA C N S 365 VAL C C N N 366 VAL O O N N 367 VAL CB C N N 368 VAL CG1 C N N 369 VAL CG2 C N N 370 VAL OXT O N N 371 VAL H H N N 372 VAL H2 H N N 373 VAL HA H N N 374 VAL HB H N N 375 VAL HG11 H N N 376 VAL HG12 H N N 377 VAL HG13 H N N 378 VAL HG21 H N N 379 VAL HG22 H N N 380 VAL HG23 H N N 381 VAL HXT H N N 382 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACT C O doub N N 1 ACT C OXT sing N N 2 ACT C CH3 sing N N 3 ACT CH3 H1 sing N N 4 ACT CH3 H2 sing N N 5 ACT CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 GLN N CA sing N N 76 GLN N H sing N N 77 GLN N H2 sing N N 78 GLN CA C sing N N 79 GLN CA CB sing N N 80 GLN CA HA sing N N 81 GLN C O doub N N 82 GLN C OXT sing N N 83 GLN CB CG sing N N 84 GLN CB HB2 sing N N 85 GLN CB HB3 sing N N 86 GLN CG CD sing N N 87 GLN CG HG2 sing N N 88 GLN CG HG3 sing N N 89 GLN CD OE1 doub N N 90 GLN CD NE2 sing N N 91 GLN NE2 HE21 sing N N 92 GLN NE2 HE22 sing N N 93 GLN OXT HXT sing N N 94 GLU N CA sing N N 95 GLU N H sing N N 96 GLU N H2 sing N N 97 GLU CA C sing N N 98 GLU CA CB sing N N 99 GLU CA HA sing N N 100 GLU C O doub N N 101 GLU C OXT sing N N 102 GLU CB CG sing N N 103 GLU CB HB2 sing N N 104 GLU CB HB3 sing N N 105 GLU CG CD sing N N 106 GLU CG HG2 sing N N 107 GLU CG HG3 sing N N 108 GLU CD OE1 doub N N 109 GLU CD OE2 sing N N 110 GLU OE2 HE2 sing N N 111 GLU OXT HXT sing N N 112 GLY N CA sing N N 113 GLY N H sing N N 114 GLY N H2 sing N N 115 GLY CA C sing N N 116 GLY CA HA2 sing N N 117 GLY CA HA3 sing N N 118 GLY C O doub N N 119 GLY C OXT sing N N 120 GLY OXT HXT sing N N 121 HIS N CA sing N N 122 HIS N H sing N N 123 HIS N H2 sing N N 124 HIS CA C sing N N 125 HIS CA CB sing N N 126 HIS CA HA sing N N 127 HIS C O doub N N 128 HIS C OXT sing N N 129 HIS CB CG sing N N 130 HIS CB HB2 sing N N 131 HIS CB HB3 sing N N 132 HIS CG ND1 sing Y N 133 HIS CG CD2 doub Y N 134 HIS ND1 CE1 doub Y N 135 HIS ND1 HD1 sing N N 136 HIS CD2 NE2 sing Y N 137 HIS CD2 HD2 sing N N 138 HIS CE1 NE2 sing Y N 139 HIS CE1 HE1 sing N N 140 HIS NE2 HE2 sing N N 141 HIS OXT HXT sing N N 142 ILE N CA sing N N 143 ILE N H sing N N 144 ILE N H2 sing N N 145 ILE CA C sing N N 146 ILE CA CB sing N N 147 ILE CA HA sing N N 148 ILE C O doub N N 149 ILE C OXT sing N N 150 ILE CB CG1 sing N N 151 ILE CB CG2 sing N N 152 ILE CB HB sing N N 153 ILE CG1 CD1 sing N N 154 ILE CG1 HG12 sing N N 155 ILE CG1 HG13 sing N N 156 ILE CG2 HG21 sing N N 157 ILE CG2 HG22 sing N N 158 ILE CG2 HG23 sing N N 159 ILE CD1 HD11 sing N N 160 ILE CD1 HD12 sing N N 161 ILE CD1 HD13 sing N N 162 ILE OXT HXT sing N N 163 LEU N CA sing N N 164 LEU N H sing N N 165 LEU N H2 sing N N 166 LEU CA C sing N N 167 LEU CA CB sing N N 168 LEU CA HA sing N N 169 LEU C O doub N N 170 LEU C OXT sing N N 171 LEU CB CG sing N N 172 LEU CB HB2 sing N N 173 LEU CB HB3 sing N N 174 LEU CG CD1 sing N N 175 LEU CG CD2 sing N N 176 LEU CG HG sing N N 177 LEU CD1 HD11 sing N N 178 LEU CD1 HD12 sing N N 179 LEU CD1 HD13 sing N N 180 LEU CD2 HD21 sing N N 181 LEU CD2 HD22 sing N N 182 LEU CD2 HD23 sing N N 183 LEU OXT HXT sing N N 184 LYS N CA sing N N 185 LYS N H sing N N 186 LYS N H2 sing N N 187 LYS CA C sing N N 188 LYS CA CB sing N N 189 LYS CA HA sing N N 190 LYS C O doub N N 191 LYS C OXT sing N N 192 LYS CB CG sing N N 193 LYS CB HB2 sing N N 194 LYS CB HB3 sing N N 195 LYS CG CD sing N N 196 LYS CG HG2 sing N N 197 LYS CG HG3 sing N N 198 LYS CD CE sing N N 199 LYS CD HD2 sing N N 200 LYS CD HD3 sing N N 201 LYS CE NZ sing N N 202 LYS CE HE2 sing N N 203 LYS CE HE3 sing N N 204 LYS NZ HZ1 sing N N 205 LYS NZ HZ2 sing N N 206 LYS NZ HZ3 sing N N 207 LYS OXT HXT sing N N 208 MET N CA sing N N 209 MET N H sing N N 210 MET N H2 sing N N 211 MET CA C sing N N 212 MET CA CB sing N N 213 MET CA HA sing N N 214 MET C O doub N N 215 MET C OXT sing N N 216 MET CB CG sing N N 217 MET CB HB2 sing N N 218 MET CB HB3 sing N N 219 MET CG SD sing N N 220 MET CG HG2 sing N N 221 MET CG HG3 sing N N 222 MET SD CE sing N N 223 MET CE HE1 sing N N 224 MET CE HE2 sing N N 225 MET CE HE3 sing N N 226 MET OXT HXT sing N N 227 PHE N CA sing N N 228 PHE N H sing N N 229 PHE N H2 sing N N 230 PHE CA C sing N N 231 PHE CA CB sing N N 232 PHE CA HA sing N N 233 PHE C O doub N N 234 PHE C OXT sing N N 235 PHE CB CG sing N N 236 PHE CB HB2 sing N N 237 PHE CB HB3 sing N N 238 PHE CG CD1 doub Y N 239 PHE CG CD2 sing Y N 240 PHE CD1 CE1 sing Y N 241 PHE CD1 HD1 sing N N 242 PHE CD2 CE2 doub Y N 243 PHE CD2 HD2 sing N N 244 PHE CE1 CZ doub Y N 245 PHE CE1 HE1 sing N N 246 PHE CE2 CZ sing Y N 247 PHE CE2 HE2 sing N N 248 PHE CZ HZ sing N N 249 PHE OXT HXT sing N N 250 PRO N CA sing N N 251 PRO N CD sing N N 252 PRO N H sing N N 253 PRO CA C sing N N 254 PRO CA CB sing N N 255 PRO CA HA sing N N 256 PRO C O doub N N 257 PRO C OXT sing N N 258 PRO CB CG sing N N 259 PRO CB HB2 sing N N 260 PRO CB HB3 sing N N 261 PRO CG CD sing N N 262 PRO CG HG2 sing N N 263 PRO CG HG3 sing N N 264 PRO CD HD2 sing N N 265 PRO CD HD3 sing N N 266 PRO OXT HXT sing N N 267 SER N CA sing N N 268 SER N H sing N N 269 SER N H2 sing N N 270 SER CA C sing N N 271 SER CA CB sing N N 272 SER CA HA sing N N 273 SER C O doub N N 274 SER C OXT sing N N 275 SER CB OG sing N N 276 SER CB HB2 sing N N 277 SER CB HB3 sing N N 278 SER OG HG sing N N 279 SER OXT HXT sing N N 280 THR N CA sing N N 281 THR N H sing N N 282 THR N H2 sing N N 283 THR CA C sing N N 284 THR CA CB sing N N 285 THR CA HA sing N N 286 THR C O doub N N 287 THR C OXT sing N N 288 THR CB OG1 sing N N 289 THR CB CG2 sing N N 290 THR CB HB sing N N 291 THR OG1 HG1 sing N N 292 THR CG2 HG21 sing N N 293 THR CG2 HG22 sing N N 294 THR CG2 HG23 sing N N 295 THR OXT HXT sing N N 296 TRP N CA sing N N 297 TRP N H sing N N 298 TRP N H2 sing N N 299 TRP CA C sing N N 300 TRP CA CB sing N N 301 TRP CA HA sing N N 302 TRP C O doub N N 303 TRP C OXT sing N N 304 TRP CB CG sing N N 305 TRP CB HB2 sing N N 306 TRP CB HB3 sing N N 307 TRP CG CD1 doub Y N 308 TRP CG CD2 sing Y N 309 TRP CD1 NE1 sing Y N 310 TRP CD1 HD1 sing N N 311 TRP CD2 CE2 doub Y N 312 TRP CD2 CE3 sing Y N 313 TRP NE1 CE2 sing Y N 314 TRP NE1 HE1 sing N N 315 TRP CE2 CZ2 sing Y N 316 TRP CE3 CZ3 doub Y N 317 TRP CE3 HE3 sing N N 318 TRP CZ2 CH2 doub Y N 319 TRP CZ2 HZ2 sing N N 320 TRP CZ3 CH2 sing Y N 321 TRP CZ3 HZ3 sing N N 322 TRP CH2 HH2 sing N N 323 TRP OXT HXT sing N N 324 TYR N CA sing N N 325 TYR N H sing N N 326 TYR N H2 sing N N 327 TYR CA C sing N N 328 TYR CA CB sing N N 329 TYR CA HA sing N N 330 TYR C O doub N N 331 TYR C OXT sing N N 332 TYR CB CG sing N N 333 TYR CB HB2 sing N N 334 TYR CB HB3 sing N N 335 TYR CG CD1 doub Y N 336 TYR CG CD2 sing Y N 337 TYR CD1 CE1 sing Y N 338 TYR CD1 HD1 sing N N 339 TYR CD2 CE2 doub Y N 340 TYR CD2 HD2 sing N N 341 TYR CE1 CZ doub Y N 342 TYR CE1 HE1 sing N N 343 TYR CE2 CZ sing Y N 344 TYR CE2 HE2 sing N N 345 TYR CZ OH sing N N 346 TYR OH HH sing N N 347 TYR OXT HXT sing N N 348 VAL N CA sing N N 349 VAL N H sing N N 350 VAL N H2 sing N N 351 VAL CA C sing N N 352 VAL CA CB sing N N 353 VAL CA HA sing N N 354 VAL C O doub N N 355 VAL C OXT sing N N 356 VAL CB CG1 sing N N 357 VAL CB CG2 sing N N 358 VAL CB HB sing N N 359 VAL CG1 HG11 sing N N 360 VAL CG1 HG12 sing N N 361 VAL CG1 HG13 sing N N 362 VAL CG2 HG21 sing N N 363 VAL CG2 HG22 sing N N 364 VAL CG2 HG23 sing N N 365 VAL OXT HXT sing N N 366 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Heart, Lung, and Blood Institute (NIH/NHLBI)' 'United States' ? 1 'National Institutes of Health/National Institute on Deafness and Other Communication Disorders (NIH/NIDCD)' 'United States' ? 2 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' ? 3 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7PGG _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7PGI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.005612 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005214 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005200 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MG N NA O S # loop_