data_7PL4 # _entry.id 7PL4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PL4 pdb_00007pl4 10.2210/pdb7pl4/pdb WWPDB D_1292117721 ? ? BMRB 34662 ? 10.13018/BMR34662 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-09-07 2 'Structure model' 1 1 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7PL4 _pdbx_database_status.recvd_initial_deposition_date 2021-08-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details ;Structure of Insulin receptor-related receptor's transmembrane domain ; _pdbx_database_related.db_id 34662 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bershatsky, Y.V.' 1 ? 'Nadezhdin, K.D.' 2 ? 'Bocharova, O.V.' 3 ? 'Bocharov, E.V.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Structure of Insulin-like growth factor 1 receptor's transmembrane domain ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bershatsky, Y.V.' 1 ? primary 'Nadezhdin, K.D.' 2 ? primary 'Bocharova, O.V.' 3 ? primary 'Bocharov, E.V.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Insulin receptor-related protein beta chain' _entity.formula_weight 3243.968 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GGLHVLLTATPVGLTLLIVLAALGFFYGKKR _entity_poly.pdbx_seq_one_letter_code_can GGLHVLLTATPVGLTLLIVLAALGFFYGKKR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 LEU n 1 4 HIS n 1 5 VAL n 1 6 LEU n 1 7 LEU n 1 8 THR n 1 9 ALA n 1 10 THR n 1 11 PRO n 1 12 VAL n 1 13 GLY n 1 14 LEU n 1 15 THR n 1 16 LEU n 1 17 LEU n 1 18 ILE n 1 19 VAL n 1 20 LEU n 1 21 ALA n 1 22 ALA n 1 23 LEU n 1 24 GLY n 1 25 PHE n 1 26 PHE n 1 27 TYR n 1 28 GLY n 1 29 LYS n 1 30 LYS n 1 31 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 31 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'INSRR, IRR' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 11 11 GLY GLY A . n A 1 2 GLY 2 12 12 GLY GLY A . n A 1 3 LEU 3 13 13 LEU LEU A . n A 1 4 HIS 4 14 14 HIS HIS A . n A 1 5 VAL 5 15 15 VAL VAL A . n A 1 6 LEU 6 16 16 LEU LEU A . n A 1 7 LEU 7 17 17 LEU LEU A . n A 1 8 THR 8 18 18 THR THR A . n A 1 9 ALA 9 19 19 ALA ALA A . n A 1 10 THR 10 20 20 THR THR A . n A 1 11 PRO 11 21 21 PRO PRO A . n A 1 12 VAL 12 22 22 VAL VAL A . n A 1 13 GLY 13 23 23 GLY GLY A . n A 1 14 LEU 14 24 24 LEU LEU A . n A 1 15 THR 15 25 25 THR THR A . n A 1 16 LEU 16 26 26 LEU LEU A . n A 1 17 LEU 17 27 27 LEU LEU A . n A 1 18 ILE 18 28 28 ILE ILE A . n A 1 19 VAL 19 29 29 VAL VAL A . n A 1 20 LEU 20 30 30 LEU LEU A . n A 1 21 ALA 21 31 31 ALA ALA A . n A 1 22 ALA 22 32 32 ALA ALA A . n A 1 23 LEU 23 33 33 LEU LEU A . n A 1 24 GLY 24 34 34 GLY GLY A . n A 1 25 PHE 25 35 35 PHE PHE A . n A 1 26 PHE 26 36 36 PHE PHE A . n A 1 27 TYR 27 37 37 TYR TYR A . n A 1 28 GLY 28 38 38 GLY GLY A . n A 1 29 LYS 29 39 39 LYS LYS A . n A 1 30 LYS 30 40 40 LYS LYS A . n A 1 31 ARG 31 41 41 ARG ARG A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PL4 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7PL4 _struct.title ;Structure of Insulin receptor-related receptor's transmembrane domain ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PL4 _struct_keywords.text 'PROTEIN, TRANSMEMBRANE DOMAIN, Insulin receptor-related receptor, RECEPTOR, IRR, Transferase' _struct_keywords.pdbx_keywords TRANSFERASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code INSRR_HUMAN _struct_ref.pdbx_db_accession P14616 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GGLHVLLTATPVGLTLLIVLAALGFFYGKKR _struct_ref.pdbx_align_begin 918 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7PL4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P14616 _struct_ref_seq.db_align_beg 918 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 948 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 11 _struct_ref_seq.pdbx_auth_seq_align_end 41 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3240 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 2 ? THR A 10 ? GLY A 12 THR A 20 1 ? 9 HELX_P HELX_P2 AA2 THR A 10 ? LYS A 30 ? THR A 20 LYS A 40 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 THR A 20 ? ? 57.32 71.49 2 3 THR A 20 ? ? -116.32 69.90 3 4 THR A 20 ? ? 63.39 72.28 4 7 THR A 20 ? ? 62.75 69.56 # _pdbx_nmr_ensemble.entry_id 7PL4 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7PL4 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5 mM [U-100% 13C; U-100% 15N] IRRtm, 100 mM [U-99% 2H] DPC, 0.3 mM Sodium azide, 30 mM KH2PO4, 20 mM K2HPO4, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label '13C 15N' _pdbx_nmr_sample_details.type micelle _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 IRRtm 0.5 ? mM '[U-100% 13C; U-100% 15N]' 1 DPC 100 ? mM '[U-99% 2H]' 1 'Sodium azide' 0.3 ? mM 'natural abundance' 1 KH2PO4 30 ? mM 'natural abundance' 1 K2HPO4 20 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label conditions _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 2 isotropic 2 1 1 '2D 1H-15N TROSY' 2 isotropic 3 1 1 '2D 1H-13C CT HSQC' 1 isotropic 4 1 1 '2D 1H-13C HSQC' 1 isotropic 5 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 6 1 1 '3D HNCO' 1 isotropic 7 1 1 '3D HNCA' 1 isotropic 8 1 1 '3D HN(CO)CA' 1 isotropic 9 1 1 '3D CBCA(CO)NH' 1 isotropic 10 1 1 '3D HCCH-TOCSY' 1 isotropic 11 1 1 '3D 1H-15N NOESY' 1 isotropic 12 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic # _pdbx_nmr_refine.entry_id 7PL4 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' 2 'peak picking' CARA ? 'Keller and Wuthrich' 3 'chemical shift assignment' CARA ? 'Keller and Wuthrich' 4 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 5 collection TopSpin ? 'Bruker Biospin' 6 processing TALOS ? 'Cornilescu, Delaglio and Bax' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 GLY N N N N 41 GLY CA C N N 42 GLY C C N N 43 GLY O O N N 44 GLY OXT O N N 45 GLY H H N N 46 GLY H2 H N N 47 GLY HA2 H N N 48 GLY HA3 H N N 49 GLY HXT H N N 50 HIS N N N N 51 HIS CA C N S 52 HIS C C N N 53 HIS O O N N 54 HIS CB C N N 55 HIS CG C Y N 56 HIS ND1 N Y N 57 HIS CD2 C Y N 58 HIS CE1 C Y N 59 HIS NE2 N Y N 60 HIS OXT O N N 61 HIS H H N N 62 HIS H2 H N N 63 HIS HA H N N 64 HIS HB2 H N N 65 HIS HB3 H N N 66 HIS HD1 H N N 67 HIS HD2 H N N 68 HIS HE1 H N N 69 HIS HE2 H N N 70 HIS HXT H N N 71 ILE N N N N 72 ILE CA C N S 73 ILE C C N N 74 ILE O O N N 75 ILE CB C N S 76 ILE CG1 C N N 77 ILE CG2 C N N 78 ILE CD1 C N N 79 ILE OXT O N N 80 ILE H H N N 81 ILE H2 H N N 82 ILE HA H N N 83 ILE HB H N N 84 ILE HG12 H N N 85 ILE HG13 H N N 86 ILE HG21 H N N 87 ILE HG22 H N N 88 ILE HG23 H N N 89 ILE HD11 H N N 90 ILE HD12 H N N 91 ILE HD13 H N N 92 ILE HXT H N N 93 LEU N N N N 94 LEU CA C N S 95 LEU C C N N 96 LEU O O N N 97 LEU CB C N N 98 LEU CG C N N 99 LEU CD1 C N N 100 LEU CD2 C N N 101 LEU OXT O N N 102 LEU H H N N 103 LEU H2 H N N 104 LEU HA H N N 105 LEU HB2 H N N 106 LEU HB3 H N N 107 LEU HG H N N 108 LEU HD11 H N N 109 LEU HD12 H N N 110 LEU HD13 H N N 111 LEU HD21 H N N 112 LEU HD22 H N N 113 LEU HD23 H N N 114 LEU HXT H N N 115 LYS N N N N 116 LYS CA C N S 117 LYS C C N N 118 LYS O O N N 119 LYS CB C N N 120 LYS CG C N N 121 LYS CD C N N 122 LYS CE C N N 123 LYS NZ N N N 124 LYS OXT O N N 125 LYS H H N N 126 LYS H2 H N N 127 LYS HA H N N 128 LYS HB2 H N N 129 LYS HB3 H N N 130 LYS HG2 H N N 131 LYS HG3 H N N 132 LYS HD2 H N N 133 LYS HD3 H N N 134 LYS HE2 H N N 135 LYS HE3 H N N 136 LYS HZ1 H N N 137 LYS HZ2 H N N 138 LYS HZ3 H N N 139 LYS HXT H N N 140 PHE N N N N 141 PHE CA C N S 142 PHE C C N N 143 PHE O O N N 144 PHE CB C N N 145 PHE CG C Y N 146 PHE CD1 C Y N 147 PHE CD2 C Y N 148 PHE CE1 C Y N 149 PHE CE2 C Y N 150 PHE CZ C Y N 151 PHE OXT O N N 152 PHE H H N N 153 PHE H2 H N N 154 PHE HA H N N 155 PHE HB2 H N N 156 PHE HB3 H N N 157 PHE HD1 H N N 158 PHE HD2 H N N 159 PHE HE1 H N N 160 PHE HE2 H N N 161 PHE HZ H N N 162 PHE HXT H N N 163 PRO N N N N 164 PRO CA C N S 165 PRO C C N N 166 PRO O O N N 167 PRO CB C N N 168 PRO CG C N N 169 PRO CD C N N 170 PRO OXT O N N 171 PRO H H N N 172 PRO HA H N N 173 PRO HB2 H N N 174 PRO HB3 H N N 175 PRO HG2 H N N 176 PRO HG3 H N N 177 PRO HD2 H N N 178 PRO HD3 H N N 179 PRO HXT H N N 180 THR N N N N 181 THR CA C N S 182 THR C C N N 183 THR O O N N 184 THR CB C N R 185 THR OG1 O N N 186 THR CG2 C N N 187 THR OXT O N N 188 THR H H N N 189 THR H2 H N N 190 THR HA H N N 191 THR HB H N N 192 THR HG1 H N N 193 THR HG21 H N N 194 THR HG22 H N N 195 THR HG23 H N N 196 THR HXT H N N 197 TYR N N N N 198 TYR CA C N S 199 TYR C C N N 200 TYR O O N N 201 TYR CB C N N 202 TYR CG C Y N 203 TYR CD1 C Y N 204 TYR CD2 C Y N 205 TYR CE1 C Y N 206 TYR CE2 C Y N 207 TYR CZ C Y N 208 TYR OH O N N 209 TYR OXT O N N 210 TYR H H N N 211 TYR H2 H N N 212 TYR HA H N N 213 TYR HB2 H N N 214 TYR HB3 H N N 215 TYR HD1 H N N 216 TYR HD2 H N N 217 TYR HE1 H N N 218 TYR HE2 H N N 219 TYR HH H N N 220 TYR HXT H N N 221 VAL N N N N 222 VAL CA C N S 223 VAL C C N N 224 VAL O O N N 225 VAL CB C N N 226 VAL CG1 C N N 227 VAL CG2 C N N 228 VAL OXT O N N 229 VAL H H N N 230 VAL H2 H N N 231 VAL HA H N N 232 VAL HB H N N 233 VAL HG11 H N N 234 VAL HG12 H N N 235 VAL HG13 H N N 236 VAL HG21 H N N 237 VAL HG22 H N N 238 VAL HG23 H N N 239 VAL HXT H N N 240 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 GLY N CA sing N N 39 GLY N H sing N N 40 GLY N H2 sing N N 41 GLY CA C sing N N 42 GLY CA HA2 sing N N 43 GLY CA HA3 sing N N 44 GLY C O doub N N 45 GLY C OXT sing N N 46 GLY OXT HXT sing N N 47 HIS N CA sing N N 48 HIS N H sing N N 49 HIS N H2 sing N N 50 HIS CA C sing N N 51 HIS CA CB sing N N 52 HIS CA HA sing N N 53 HIS C O doub N N 54 HIS C OXT sing N N 55 HIS CB CG sing N N 56 HIS CB HB2 sing N N 57 HIS CB HB3 sing N N 58 HIS CG ND1 sing Y N 59 HIS CG CD2 doub Y N 60 HIS ND1 CE1 doub Y N 61 HIS ND1 HD1 sing N N 62 HIS CD2 NE2 sing Y N 63 HIS CD2 HD2 sing N N 64 HIS CE1 NE2 sing Y N 65 HIS CE1 HE1 sing N N 66 HIS NE2 HE2 sing N N 67 HIS OXT HXT sing N N 68 ILE N CA sing N N 69 ILE N H sing N N 70 ILE N H2 sing N N 71 ILE CA C sing N N 72 ILE CA CB sing N N 73 ILE CA HA sing N N 74 ILE C O doub N N 75 ILE C OXT sing N N 76 ILE CB CG1 sing N N 77 ILE CB CG2 sing N N 78 ILE CB HB sing N N 79 ILE CG1 CD1 sing N N 80 ILE CG1 HG12 sing N N 81 ILE CG1 HG13 sing N N 82 ILE CG2 HG21 sing N N 83 ILE CG2 HG22 sing N N 84 ILE CG2 HG23 sing N N 85 ILE CD1 HD11 sing N N 86 ILE CD1 HD12 sing N N 87 ILE CD1 HD13 sing N N 88 ILE OXT HXT sing N N 89 LEU N CA sing N N 90 LEU N H sing N N 91 LEU N H2 sing N N 92 LEU CA C sing N N 93 LEU CA CB sing N N 94 LEU CA HA sing N N 95 LEU C O doub N N 96 LEU C OXT sing N N 97 LEU CB CG sing N N 98 LEU CB HB2 sing N N 99 LEU CB HB3 sing N N 100 LEU CG CD1 sing N N 101 LEU CG CD2 sing N N 102 LEU CG HG sing N N 103 LEU CD1 HD11 sing N N 104 LEU CD1 HD12 sing N N 105 LEU CD1 HD13 sing N N 106 LEU CD2 HD21 sing N N 107 LEU CD2 HD22 sing N N 108 LEU CD2 HD23 sing N N 109 LEU OXT HXT sing N N 110 LYS N CA sing N N 111 LYS N H sing N N 112 LYS N H2 sing N N 113 LYS CA C sing N N 114 LYS CA CB sing N N 115 LYS CA HA sing N N 116 LYS C O doub N N 117 LYS C OXT sing N N 118 LYS CB CG sing N N 119 LYS CB HB2 sing N N 120 LYS CB HB3 sing N N 121 LYS CG CD sing N N 122 LYS CG HG2 sing N N 123 LYS CG HG3 sing N N 124 LYS CD CE sing N N 125 LYS CD HD2 sing N N 126 LYS CD HD3 sing N N 127 LYS CE NZ sing N N 128 LYS CE HE2 sing N N 129 LYS CE HE3 sing N N 130 LYS NZ HZ1 sing N N 131 LYS NZ HZ2 sing N N 132 LYS NZ HZ3 sing N N 133 LYS OXT HXT sing N N 134 PHE N CA sing N N 135 PHE N H sing N N 136 PHE N H2 sing N N 137 PHE CA C sing N N 138 PHE CA CB sing N N 139 PHE CA HA sing N N 140 PHE C O doub N N 141 PHE C OXT sing N N 142 PHE CB CG sing N N 143 PHE CB HB2 sing N N 144 PHE CB HB3 sing N N 145 PHE CG CD1 doub Y N 146 PHE CG CD2 sing Y N 147 PHE CD1 CE1 sing Y N 148 PHE CD1 HD1 sing N N 149 PHE CD2 CE2 doub Y N 150 PHE CD2 HD2 sing N N 151 PHE CE1 CZ doub Y N 152 PHE CE1 HE1 sing N N 153 PHE CE2 CZ sing Y N 154 PHE CE2 HE2 sing N N 155 PHE CZ HZ sing N N 156 PHE OXT HXT sing N N 157 PRO N CA sing N N 158 PRO N CD sing N N 159 PRO N H sing N N 160 PRO CA C sing N N 161 PRO CA CB sing N N 162 PRO CA HA sing N N 163 PRO C O doub N N 164 PRO C OXT sing N N 165 PRO CB CG sing N N 166 PRO CB HB2 sing N N 167 PRO CB HB3 sing N N 168 PRO CG CD sing N N 169 PRO CG HG2 sing N N 170 PRO CG HG3 sing N N 171 PRO CD HD2 sing N N 172 PRO CD HD3 sing N N 173 PRO OXT HXT sing N N 174 THR N CA sing N N 175 THR N H sing N N 176 THR N H2 sing N N 177 THR CA C sing N N 178 THR CA CB sing N N 179 THR CA HA sing N N 180 THR C O doub N N 181 THR C OXT sing N N 182 THR CB OG1 sing N N 183 THR CB CG2 sing N N 184 THR CB HB sing N N 185 THR OG1 HG1 sing N N 186 THR CG2 HG21 sing N N 187 THR CG2 HG22 sing N N 188 THR CG2 HG23 sing N N 189 THR OXT HXT sing N N 190 TYR N CA sing N N 191 TYR N H sing N N 192 TYR N H2 sing N N 193 TYR CA C sing N N 194 TYR CA CB sing N N 195 TYR CA HA sing N N 196 TYR C O doub N N 197 TYR C OXT sing N N 198 TYR CB CG sing N N 199 TYR CB HB2 sing N N 200 TYR CB HB3 sing N N 201 TYR CG CD1 doub Y N 202 TYR CG CD2 sing Y N 203 TYR CD1 CE1 sing Y N 204 TYR CD1 HD1 sing N N 205 TYR CD2 CE2 doub Y N 206 TYR CD2 HD2 sing N N 207 TYR CE1 CZ doub Y N 208 TYR CE1 HE1 sing N N 209 TYR CE2 CZ sing Y N 210 TYR CE2 HE2 sing N N 211 TYR CZ OH sing N N 212 TYR OH HH sing N N 213 TYR OXT HXT sing N N 214 VAL N CA sing N N 215 VAL N H sing N N 216 VAL N H2 sing N N 217 VAL CA C sing N N 218 VAL CA CB sing N N 219 VAL CA HA sing N N 220 VAL C O doub N N 221 VAL C OXT sing N N 222 VAL CB CG1 sing N N 223 VAL CB CG2 sing N N 224 VAL CB HB sing N N 225 VAL CG1 HG11 sing N N 226 VAL CG1 HG12 sing N N 227 VAL CG1 HG13 sing N N 228 VAL CG2 HG21 sing N N 229 VAL CG2 HG22 sing N N 230 VAL CG2 HG23 sing N N 231 VAL OXT HXT sing N N 232 # _pdbx_audit_support.funding_organization 'Russian Science Foundation' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 18-14-00375 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 600 ? 2 'AVANCE III' ? Bruker 800 ? # _atom_sites.entry_id 7PL4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_