data_7PQI # _entry.id 7PQI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.385 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PQI pdb_00007pqi 10.2210/pdb7pqi/pdb WWPDB D_1292118139 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-09-28 2 'Structure model' 1 1 2023-04-05 3 'Structure model' 1 2 2024-02-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7PQI _pdbx_database_status.recvd_initial_deposition_date 2021-09-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cotman, A.E.' 1 0000-0003-2528-396X 'Zega, A.' 2 0000-0003-4065-0019 'Zidar, N.' 3 0000-0003-1905-0158 'Ilas, J.' 4 0000-0002-0124-0474 'Tomasic, T.' 5 0000-0001-5534-209X 'Masic, L.P.' 6 0000-0003-0624-8472 'Mundy, J.E.A.' 7 ? 'Stevenson, C.E.M.' 8 0000-0001-6695-8201 'Burton, N.' 9 0000-0002-1735-4927 'Lawson, D.M.' 10 0000-0002-7637-4303 'Maxwell, A.' 11 0000-0002-5756-6430 'Kikelj, D.' 12 0000-0002-2067-7604 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 66 _citation.language ? _citation.page_first 1380 _citation.page_last 1425 _citation.title ;Discovery and Hit-to-Lead Optimization of Benzothiazole Scaffold-Based DNA Gyrase Inhibitors with Potent Activity against Acinetobacter baumannii and Pseudomonas aeruginosa. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.2c01597 _citation.pdbx_database_id_PubMed 36634346 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cotman, A.E.' 1 0000-0003-2528-396X primary 'Durcik, M.' 2 0000-0002-9218-1771 primary 'Benedetto Tiz, D.' 3 ? primary 'Fulgheri, F.' 4 0000-0002-7858-1605 primary 'Secci, D.' 5 ? primary 'Sterle, M.' 6 0000-0003-3898-5194 primary 'Mozina, S.' 7 0000-0002-7416-6981 primary 'Skok, Z.' 8 ? primary 'Zidar, N.' 9 0000-0003-1905-0158 primary 'Zega, A.' 10 0000-0003-4065-0019 primary 'Ilas, J.' 11 0000-0002-0124-0474 primary 'Peterlin Masic, L.' 12 ? primary 'Tomasic, T.' 13 0000-0001-5534-209X primary 'Hughes, D.' 14 ? primary 'Huseby, D.L.' 15 0000-0001-9974-578X primary 'Cao, S.' 16 ? primary 'Garoff, L.' 17 ? primary 'Berruga Fernandez, T.' 18 0000-0001-6459-1397 primary 'Giachou, P.' 19 ? primary 'Crone, L.' 20 ? primary 'Simoff, I.' 21 0000-0001-6522-7191 primary 'Svensson, R.' 22 ? primary 'Birnir, B.' 23 ? primary 'Korol, S.V.' 24 0000-0001-8279-2790 primary 'Jin, Z.' 25 ? primary 'Vicente, F.' 26 ? primary 'Ramos, M.C.' 27 0000-0002-3674-615X primary 'de la Cruz, M.' 28 ? primary 'Glinghammar, B.' 29 ? primary 'Lenhammar, L.' 30 ? primary 'Henderson, S.R.' 31 0000-0003-2078-639X primary 'Mundy, J.E.A.' 32 ? primary 'Maxwell, A.' 33 0000-0002-5756-6430 primary 'Stevenson, C.E.M.' 34 ? primary 'Lawson, D.M.' 35 ? primary 'Janssen, G.V.' 36 ? primary 'Sterk, G.J.' 37 ? primary 'Kikelj, D.' 38 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA gyrase subunit B' 22770.273 1 5.6.2.2 ? ? 'corresponds to residues 28-233 of full-length wild-type protein' 2 non-polymer syn NOVOBIOCIN 612.624 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 5 ? ? ? ? 4 water nat water 18.015 70 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;RGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCDEIIVTIHEDESVSVSDNGRGIPTDIHPEEGVSAAEV ILTILHAGGKFDDNSYKVSGGLHGVGVSVVNALSSKLHLTIYRAGQIHEQEYHHGDPQYPLRVIGETDNTGTTVRFWPSA ETFSQTIFNVEILARRLRELSFLNAGVRIVLRDERINLEHVYDYEG ; _entity_poly.pdbx_seq_one_letter_code_can ;RGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCDEIIVTIHEDESVSVSDNGRGIPTDIHPEEGVSAAEV ILTILHAGGKFDDNSYKVSGGLHGVGVSVVNALSSKLHLTIYRAGQIHEQEYHHGDPQYPLRVIGETDNTGTTVRFWPSA ETFSQTIFNVEILARRLRELSFLNAGVRIVLRDERINLEHVYDYEG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 NOVOBIOCIN NOV 3 1,2-ETHANEDIOL EDO 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 GLY n 1 3 LEU n 1 4 ASP n 1 5 ALA n 1 6 VAL n 1 7 ARG n 1 8 LYS n 1 9 ARG n 1 10 PRO n 1 11 GLY n 1 12 MET n 1 13 TYR n 1 14 ILE n 1 15 GLY n 1 16 ASP n 1 17 THR n 1 18 ASP n 1 19 ASP n 1 20 GLY n 1 21 THR n 1 22 GLY n 1 23 LEU n 1 24 HIS n 1 25 HIS n 1 26 MET n 1 27 VAL n 1 28 PHE n 1 29 GLU n 1 30 VAL n 1 31 VAL n 1 32 ASP n 1 33 ASN n 1 34 ALA n 1 35 ILE n 1 36 ASP n 1 37 GLU n 1 38 ALA n 1 39 LEU n 1 40 ALA n 1 41 GLY n 1 42 HIS n 1 43 CYS n 1 44 ASP n 1 45 GLU n 1 46 ILE n 1 47 ILE n 1 48 VAL n 1 49 THR n 1 50 ILE n 1 51 HIS n 1 52 GLU n 1 53 ASP n 1 54 GLU n 1 55 SER n 1 56 VAL n 1 57 SER n 1 58 VAL n 1 59 SER n 1 60 ASP n 1 61 ASN n 1 62 GLY n 1 63 ARG n 1 64 GLY n 1 65 ILE n 1 66 PRO n 1 67 THR n 1 68 ASP n 1 69 ILE n 1 70 HIS n 1 71 PRO n 1 72 GLU n 1 73 GLU n 1 74 GLY n 1 75 VAL n 1 76 SER n 1 77 ALA n 1 78 ALA n 1 79 GLU n 1 80 VAL n 1 81 ILE n 1 82 LEU n 1 83 THR n 1 84 ILE n 1 85 LEU n 1 86 HIS n 1 87 ALA n 1 88 GLY n 1 89 GLY n 1 90 LYS n 1 91 PHE n 1 92 ASP n 1 93 ASP n 1 94 ASN n 1 95 SER n 1 96 TYR n 1 97 LYS n 1 98 VAL n 1 99 SER n 1 100 GLY n 1 101 GLY n 1 102 LEU n 1 103 HIS n 1 104 GLY n 1 105 VAL n 1 106 GLY n 1 107 VAL n 1 108 SER n 1 109 VAL n 1 110 VAL n 1 111 ASN n 1 112 ALA n 1 113 LEU n 1 114 SER n 1 115 SER n 1 116 LYS n 1 117 LEU n 1 118 HIS n 1 119 LEU n 1 120 THR n 1 121 ILE n 1 122 TYR n 1 123 ARG n 1 124 ALA n 1 125 GLY n 1 126 GLN n 1 127 ILE n 1 128 HIS n 1 129 GLU n 1 130 GLN n 1 131 GLU n 1 132 TYR n 1 133 HIS n 1 134 HIS n 1 135 GLY n 1 136 ASP n 1 137 PRO n 1 138 GLN n 1 139 TYR n 1 140 PRO n 1 141 LEU n 1 142 ARG n 1 143 VAL n 1 144 ILE n 1 145 GLY n 1 146 GLU n 1 147 THR n 1 148 ASP n 1 149 ASN n 1 150 THR n 1 151 GLY n 1 152 THR n 1 153 THR n 1 154 VAL n 1 155 ARG n 1 156 PHE n 1 157 TRP n 1 158 PRO n 1 159 SER n 1 160 ALA n 1 161 GLU n 1 162 THR n 1 163 PHE n 1 164 SER n 1 165 GLN n 1 166 THR n 1 167 ILE n 1 168 PHE n 1 169 ASN n 1 170 VAL n 1 171 GLU n 1 172 ILE n 1 173 LEU n 1 174 ALA n 1 175 ARG n 1 176 ARG n 1 177 LEU n 1 178 ARG n 1 179 GLU n 1 180 LEU n 1 181 SER n 1 182 PHE n 1 183 LEU n 1 184 ASN n 1 185 ALA n 1 186 GLY n 1 187 VAL n 1 188 ARG n 1 189 ILE n 1 190 VAL n 1 191 LEU n 1 192 ARG n 1 193 ASP n 1 194 GLU n 1 195 ARG n 1 196 ILE n 1 197 ASN n 1 198 LEU n 1 199 GLU n 1 200 HIS n 1 201 VAL n 1 202 TYR n 1 203 ASP n 1 204 TYR n 1 205 GLU n 1 206 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 206 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'gyrB, J518_2757' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Acinetobacter baumannii 1419130' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1310619 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NOV non-polymer . NOVOBIOCIN '4-Hydroxy-3-[4-hydroxy-3-(3-methylbut-2-enyl)benzamido]-8-methylcoumarin-7-yl 3-O-carbamoyl-5,5-di-C-methyl-alpha-l-lyxofuranoside' 'C31 H36 N2 O11' 612.624 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 28 28 ARG ARG A . n A 1 2 GLY 2 29 29 GLY GLY A . n A 1 3 LEU 3 30 30 LEU LEU A . n A 1 4 ASP 4 31 31 ASP ASP A . n A 1 5 ALA 5 32 32 ALA ALA A . n A 1 6 VAL 6 33 33 VAL VAL A . n A 1 7 ARG 7 34 34 ARG ARG A . n A 1 8 LYS 8 35 35 LYS LYS A . n A 1 9 ARG 9 36 36 ARG ARG A . n A 1 10 PRO 10 37 37 PRO PRO A . n A 1 11 GLY 11 38 38 GLY GLY A . n A 1 12 MET 12 39 39 MET MET A . n A 1 13 TYR 13 40 40 TYR TYR A . n A 1 14 ILE 14 41 41 ILE ILE A . n A 1 15 GLY 15 42 42 GLY GLY A . n A 1 16 ASP 16 43 43 ASP ASP A . n A 1 17 THR 17 44 44 THR THR A . n A 1 18 ASP 18 45 45 ASP ASP A . n A 1 19 ASP 19 46 46 ASP ASP A . n A 1 20 GLY 20 47 47 GLY GLY A . n A 1 21 THR 21 48 48 THR THR A . n A 1 22 GLY 22 49 49 GLY GLY A . n A 1 23 LEU 23 50 50 LEU LEU A . n A 1 24 HIS 24 51 51 HIS HIS A . n A 1 25 HIS 25 52 52 HIS HIS A . n A 1 26 MET 26 53 53 MET MET A . n A 1 27 VAL 27 54 54 VAL VAL A . n A 1 28 PHE 28 55 55 PHE PHE A . n A 1 29 GLU 29 56 56 GLU GLU A . n A 1 30 VAL 30 57 57 VAL VAL A . n A 1 31 VAL 31 58 58 VAL VAL A . n A 1 32 ASP 32 59 59 ASP ASP A . n A 1 33 ASN 33 60 60 ASN ASN A . n A 1 34 ALA 34 61 61 ALA ALA A . n A 1 35 ILE 35 62 62 ILE ILE A . n A 1 36 ASP 36 63 63 ASP ASP A . n A 1 37 GLU 37 64 64 GLU GLU A . n A 1 38 ALA 38 65 65 ALA ALA A . n A 1 39 LEU 39 66 66 LEU LEU A . n A 1 40 ALA 40 67 67 ALA ALA A . n A 1 41 GLY 41 68 68 GLY GLY A . n A 1 42 HIS 42 69 69 HIS HIS A . n A 1 43 CYS 43 70 70 CYS CYS A . n A 1 44 ASP 44 71 71 ASP ASP A . n A 1 45 GLU 45 72 72 GLU GLU A . n A 1 46 ILE 46 73 73 ILE ILE A . n A 1 47 ILE 47 74 74 ILE ILE A . n A 1 48 VAL 48 75 75 VAL VAL A . n A 1 49 THR 49 76 76 THR THR A . n A 1 50 ILE 50 77 77 ILE ILE A . n A 1 51 HIS 51 78 78 HIS HIS A . n A 1 52 GLU 52 79 79 GLU GLU A . n A 1 53 ASP 53 80 80 ASP ASP A . n A 1 54 GLU 54 81 81 GLU GLU A . n A 1 55 SER 55 82 82 SER SER A . n A 1 56 VAL 56 83 83 VAL VAL A . n A 1 57 SER 57 84 84 SER SER A . n A 1 58 VAL 58 85 85 VAL VAL A . n A 1 59 SER 59 86 86 SER SER A . n A 1 60 ASP 60 87 87 ASP ASP A . n A 1 61 ASN 61 88 88 ASN ASN A . n A 1 62 GLY 62 89 89 GLY GLY A . n A 1 63 ARG 63 90 90 ARG ARG A . n A 1 64 GLY 64 91 91 GLY GLY A . n A 1 65 ILE 65 92 92 ILE ILE A . n A 1 66 PRO 66 93 93 PRO PRO A . n A 1 67 THR 67 94 94 THR THR A . n A 1 68 ASP 68 95 95 ASP ASP A . n A 1 69 ILE 69 96 96 ILE ILE A . n A 1 70 HIS 70 97 97 HIS HIS A . n A 1 71 PRO 71 98 98 PRO PRO A . n A 1 72 GLU 72 99 99 GLU GLU A . n A 1 73 GLU 73 100 100 GLU GLU A . n A 1 74 GLY 74 101 101 GLY GLY A . n A 1 75 VAL 75 102 102 VAL VAL A . n A 1 76 SER 76 103 103 SER SER A . n A 1 77 ALA 77 104 104 ALA ALA A . n A 1 78 ALA 78 105 105 ALA ALA A . n A 1 79 GLU 79 106 106 GLU GLU A . n A 1 80 VAL 80 107 107 VAL VAL A . n A 1 81 ILE 81 108 108 ILE ILE A . n A 1 82 LEU 82 109 109 LEU LEU A . n A 1 83 THR 83 110 110 THR THR A . n A 1 84 ILE 84 111 111 ILE ILE A . n A 1 85 LEU 85 112 112 LEU LEU A . n A 1 86 HIS 86 113 113 HIS HIS A . n A 1 87 ALA 87 114 114 ALA ALA A . n A 1 88 GLY 88 115 115 GLY GLY A . n A 1 89 GLY 89 116 116 GLY GLY A . n A 1 90 LYS 90 117 117 LYS LYS A . n A 1 91 PHE 91 118 ? ? ? A . n A 1 92 ASP 92 119 ? ? ? A . n A 1 93 ASP 93 120 ? ? ? A . n A 1 94 ASN 94 121 ? ? ? A . n A 1 95 SER 95 122 ? ? ? A . n A 1 96 TYR 96 123 ? ? ? A . n A 1 97 LYS 97 124 ? ? ? A . n A 1 98 VAL 98 125 ? ? ? A . n A 1 99 SER 99 126 126 SER SER A . n A 1 100 GLY 100 127 127 GLY GLY A . n A 1 101 GLY 101 128 128 GLY GLY A . n A 1 102 LEU 102 129 129 LEU LEU A . n A 1 103 HIS 103 130 130 HIS HIS A . n A 1 104 GLY 104 131 131 GLY GLY A . n A 1 105 VAL 105 132 132 VAL VAL A . n A 1 106 GLY 106 133 133 GLY GLY A . n A 1 107 VAL 107 134 134 VAL VAL A . n A 1 108 SER 108 135 135 SER SER A . n A 1 109 VAL 109 136 136 VAL VAL A . n A 1 110 VAL 110 137 137 VAL VAL A . n A 1 111 ASN 111 138 138 ASN ASN A . n A 1 112 ALA 112 139 139 ALA ALA A . n A 1 113 LEU 113 140 140 LEU LEU A . n A 1 114 SER 114 141 141 SER SER A . n A 1 115 SER 115 142 142 SER SER A . n A 1 116 LYS 116 143 143 LYS LYS A . n A 1 117 LEU 117 144 144 LEU LEU A . n A 1 118 HIS 118 145 145 HIS HIS A . n A 1 119 LEU 119 146 146 LEU LEU A . n A 1 120 THR 120 147 147 THR THR A . n A 1 121 ILE 121 148 148 ILE ILE A . n A 1 122 TYR 122 149 149 TYR TYR A . n A 1 123 ARG 123 150 150 ARG ARG A . n A 1 124 ALA 124 151 151 ALA ALA A . n A 1 125 GLY 125 152 152 GLY GLY A . n A 1 126 GLN 126 153 153 GLN GLN A . n A 1 127 ILE 127 154 154 ILE ILE A . n A 1 128 HIS 128 155 155 HIS HIS A . n A 1 129 GLU 129 156 156 GLU GLU A . n A 1 130 GLN 130 157 157 GLN GLN A . n A 1 131 GLU 131 158 158 GLU GLU A . n A 1 132 TYR 132 159 159 TYR TYR A . n A 1 133 HIS 133 160 160 HIS HIS A . n A 1 134 HIS 134 161 161 HIS HIS A . n A 1 135 GLY 135 162 162 GLY GLY A . n A 1 136 ASP 136 163 163 ASP ASP A . n A 1 137 PRO 137 164 164 PRO PRO A . n A 1 138 GLN 138 165 165 GLN GLN A . n A 1 139 TYR 139 166 166 TYR TYR A . n A 1 140 PRO 140 167 167 PRO PRO A . n A 1 141 LEU 141 168 168 LEU LEU A . n A 1 142 ARG 142 169 169 ARG ARG A . n A 1 143 VAL 143 170 170 VAL VAL A . n A 1 144 ILE 144 171 171 ILE ILE A . n A 1 145 GLY 145 172 172 GLY GLY A . n A 1 146 GLU 146 173 173 GLU GLU A . n A 1 147 THR 147 174 174 THR THR A . n A 1 148 ASP 148 175 175 ASP ASP A . n A 1 149 ASN 149 176 176 ASN ASN A . n A 1 150 THR 150 177 177 THR THR A . n A 1 151 GLY 151 178 178 GLY GLY A . n A 1 152 THR 152 179 179 THR THR A . n A 1 153 THR 153 180 180 THR THR A . n A 1 154 VAL 154 181 181 VAL VAL A . n A 1 155 ARG 155 182 182 ARG ARG A . n A 1 156 PHE 156 183 183 PHE PHE A . n A 1 157 TRP 157 184 184 TRP TRP A . n A 1 158 PRO 158 185 185 PRO PRO A . n A 1 159 SER 159 186 186 SER SER A . n A 1 160 ALA 160 187 187 ALA ALA A . n A 1 161 GLU 161 188 188 GLU GLU A . n A 1 162 THR 162 189 189 THR THR A . n A 1 163 PHE 163 190 190 PHE PHE A . n A 1 164 SER 164 191 191 SER SER A . n A 1 165 GLN 165 192 192 GLN GLN A . n A 1 166 THR 166 193 193 THR THR A . n A 1 167 ILE 167 194 194 ILE ILE A . n A 1 168 PHE 168 195 195 PHE PHE A . n A 1 169 ASN 169 196 196 ASN ASN A . n A 1 170 VAL 170 197 197 VAL VAL A . n A 1 171 GLU 171 198 198 GLU GLU A . n A 1 172 ILE 172 199 199 ILE ILE A . n A 1 173 LEU 173 200 200 LEU LEU A . n A 1 174 ALA 174 201 201 ALA ALA A . n A 1 175 ARG 175 202 202 ARG ARG A . n A 1 176 ARG 176 203 203 ARG ARG A . n A 1 177 LEU 177 204 204 LEU LEU A . n A 1 178 ARG 178 205 205 ARG ARG A . n A 1 179 GLU 179 206 206 GLU GLU A . n A 1 180 LEU 180 207 207 LEU LEU A . n A 1 181 SER 181 208 208 SER SER A . n A 1 182 PHE 182 209 209 PHE PHE A . n A 1 183 LEU 183 210 210 LEU LEU A . n A 1 184 ASN 184 211 211 ASN ASN A . n A 1 185 ALA 185 212 212 ALA ALA A . n A 1 186 GLY 186 213 213 GLY GLY A . n A 1 187 VAL 187 214 214 VAL VAL A . n A 1 188 ARG 188 215 215 ARG ARG A . n A 1 189 ILE 189 216 216 ILE ILE A . n A 1 190 VAL 190 217 217 VAL VAL A . n A 1 191 LEU 191 218 218 LEU LEU A . n A 1 192 ARG 192 219 219 ARG ARG A . n A 1 193 ASP 193 220 220 ASP ASP A . n A 1 194 GLU 194 221 221 GLU GLU A . n A 1 195 ARG 195 222 222 ARG ARG A . n A 1 196 ILE 196 223 223 ILE ILE A . n A 1 197 ASN 197 224 224 ASN ASN A . n A 1 198 LEU 198 225 225 LEU LEU A . n A 1 199 GLU 199 226 226 GLU GLU A . n A 1 200 HIS 200 227 227 HIS HIS A . n A 1 201 VAL 201 228 228 VAL VAL A . n A 1 202 TYR 202 229 229 TYR TYR A . n A 1 203 ASP 203 230 230 ASP ASP A . n A 1 204 TYR 204 231 231 TYR TYR A . n A 1 205 GLU 205 232 232 GLU GLU A . n A 1 206 GLY 206 233 233 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NOV 1 301 301 NOV NOV A . C 3 EDO 1 302 302 EDO EDO A . D 3 EDO 1 303 303 EDO EDO A . E 3 EDO 1 304 304 EDO EDO A . F 3 EDO 1 305 305 EDO EDO A . G 3 EDO 1 306 306 EDO EDO A . H 4 HOH 1 401 70 HOH HOH A . H 4 HOH 2 402 37 HOH HOH A . H 4 HOH 3 403 63 HOH HOH A . H 4 HOH 4 404 17 HOH HOH A . H 4 HOH 5 405 58 HOH HOH A . H 4 HOH 6 406 9 HOH HOH A . H 4 HOH 7 407 29 HOH HOH A . H 4 HOH 8 408 68 HOH HOH A . H 4 HOH 9 409 30 HOH HOH A . H 4 HOH 10 410 10 HOH HOH A . H 4 HOH 11 411 28 HOH HOH A . H 4 HOH 12 412 65 HOH HOH A . H 4 HOH 13 413 48 HOH HOH A . H 4 HOH 14 414 11 HOH HOH A . H 4 HOH 15 415 62 HOH HOH A . H 4 HOH 16 416 32 HOH HOH A . H 4 HOH 17 417 20 HOH HOH A . H 4 HOH 18 418 56 HOH HOH A . H 4 HOH 19 419 16 HOH HOH A . H 4 HOH 20 420 26 HOH HOH A . H 4 HOH 21 421 12 HOH HOH A . H 4 HOH 22 422 13 HOH HOH A . H 4 HOH 23 423 4 HOH HOH A . H 4 HOH 24 424 47 HOH HOH A . H 4 HOH 25 425 23 HOH HOH A . H 4 HOH 26 426 33 HOH HOH A . H 4 HOH 27 427 18 HOH HOH A . H 4 HOH 28 428 57 HOH HOH A . H 4 HOH 29 429 15 HOH HOH A . H 4 HOH 30 430 19 HOH HOH A . H 4 HOH 31 431 69 HOH HOH A . H 4 HOH 32 432 66 HOH HOH A . H 4 HOH 33 433 35 HOH HOH A . H 4 HOH 34 434 38 HOH HOH A . H 4 HOH 35 435 43 HOH HOH A . H 4 HOH 36 436 27 HOH HOH A . H 4 HOH 37 437 5 HOH HOH A . H 4 HOH 38 438 25 HOH HOH A . H 4 HOH 39 439 53 HOH HOH A . H 4 HOH 40 440 61 HOH HOH A . H 4 HOH 41 441 21 HOH HOH A . H 4 HOH 42 442 46 HOH HOH A . H 4 HOH 43 443 39 HOH HOH A . H 4 HOH 44 444 8 HOH HOH A . H 4 HOH 45 445 2 HOH HOH A . H 4 HOH 46 446 51 HOH HOH A . H 4 HOH 47 447 41 HOH HOH A . H 4 HOH 48 448 34 HOH HOH A . H 4 HOH 49 449 22 HOH HOH A . H 4 HOH 50 450 3 HOH HOH A . H 4 HOH 51 451 54 HOH HOH A . H 4 HOH 52 452 6 HOH HOH A . H 4 HOH 53 453 64 HOH HOH A . H 4 HOH 54 454 24 HOH HOH A . H 4 HOH 55 455 67 HOH HOH A . H 4 HOH 56 456 14 HOH HOH A . H 4 HOH 57 457 31 HOH HOH A . H 4 HOH 58 458 40 HOH HOH A . H 4 HOH 59 459 50 HOH HOH A . H 4 HOH 60 460 1 HOH HOH A . H 4 HOH 61 461 60 HOH HOH A . H 4 HOH 62 462 7 HOH HOH A . H 4 HOH 63 463 44 HOH HOH A . H 4 HOH 64 464 59 HOH HOH A . H 4 HOH 65 465 45 HOH HOH A . H 4 HOH 66 466 55 HOH HOH A . H 4 HOH 67 467 49 HOH HOH A . H 4 HOH 68 468 42 HOH HOH A . H 4 HOH 69 469 36 HOH HOH A . H 4 HOH 70 470 52 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 28 ? CG ? A ARG 1 CG 2 1 Y 1 A ARG 28 ? CD ? A ARG 1 CD 3 1 Y 1 A ARG 28 ? NE ? A ARG 1 NE 4 1 Y 1 A ARG 28 ? CZ ? A ARG 1 CZ 5 1 Y 1 A ARG 28 ? NH1 ? A ARG 1 NH1 6 1 Y 1 A ARG 28 ? NH2 ? A ARG 1 NH2 7 1 Y 1 A GLU 99 ? CG ? A GLU 72 CG 8 1 Y 1 A GLU 99 ? CD ? A GLU 72 CD 9 1 Y 1 A GLU 99 ? OE1 ? A GLU 72 OE1 10 1 Y 1 A GLU 99 ? OE2 ? A GLU 72 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7PQI _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.869 _cell.length_a_esd ? _cell.length_b 42.869 _cell.length_b_esd ? _cell.length_c 256.192 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7PQI _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PQI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.57 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52 _exptl_crystal.description NULL _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details NULL _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-01-20 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9999 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9999 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7PQI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.900 _reflns.d_resolution_low 256.190 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20179 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 26.300 _reflns.pdbx_Rmerge_I_obs 0.223 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 269 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.228 _reflns.pdbx_Rpim_I_all 0.044 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 530228 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.900 1.940 ? ? 34649 ? ? ? 1269 100.000 ? ? ? ? 2.620 ? ? ? ? ? ? ? ? 27.300 ? ? ? 1.200 2.668 0.504 ? 1 1 0.894 ? ? ? ? ? ? ? ? ? ? 9.110 256.190 ? ? 4504 ? ? ? 270 99.900 ? ? ? ? 0.046 ? ? ? ? ? ? ? ? 16.700 ? ? ? 27.100 0.047 0.011 ? 2 1 0.999 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 1.4900 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 1.4900 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -2.9700 _refine.B_iso_max 76.530 _refine.B_iso_mean 35.4940 _refine.B_iso_min 21.010 _refine.correlation_coeff_Fo_to_Fc 0.9530 _refine.correlation_coeff_Fo_to_Fc_free 0.9540 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : WITH TLS ADDED' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7PQI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9000 _refine.ls_d_res_low 64.1300 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19078 _refine.ls_number_reflns_R_free 989 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 100.0000 _refine.ls_percent_reflns_R_free 4.9000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2176 _refine.ls_R_factor_R_free 0.2370 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2165 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6YD9 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1530 _refine.pdbx_overall_ESU_R_Free 0.1350 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 9.1420 _refine.overall_SU_ML 0.1310 _refine.overall_SU_R_Cruickshank_DPI 0.1529 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.9000 _refine_hist.d_res_low 64.1300 _refine_hist.number_atoms_solvent 71 _refine_hist.number_atoms_total 1661 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 198 _refine_hist.pdbx_B_iso_mean_ligand 36.87 _refine_hist.pdbx_B_iso_mean_solvent 42.82 _refine_hist.pdbx_number_atoms_protein 1526 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 64 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.013 1617 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.015 1502 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.435 1.643 2192 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.320 1.579 3436 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.317 5.000 196 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.502 21.778 90 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.246 15.000 246 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 20.466 15.000 12 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.061 0.200 209 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1847 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 372 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.9000 _refine_ls_shell.d_res_low 1.9490 _refine_ls_shell.number_reflns_all 1465 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 56 _refine_ls_shell.number_reflns_R_work 1409 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3570 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3200 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7PQI _struct.title 'Acinetobacter baumannii DNA gyrase B 23kDa ATPase subdomain complexed with novobiocin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PQI _struct_keywords.text 'DNA gyrase, GyrB, inhibitor, antibacterial, isomerase, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A009KIJ4_ACIBA _struct_ref.pdbx_db_accession A0A009KIJ4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCDEIIVTIHEDESVSVSDNGRGIPTDIHPEEGVSAAEV ILTILHAGGKFDDNSYKVSGGLHGVGVSVVNALSSKLHLTIYRAGQIHEQEYHHGDPQYPLRVIGETDNTGTTVRFWPSA ETFSQTIFNVEILARRLRELSFLNAGVRIVLRDERINLEHVYDYEG ; _struct_ref.pdbx_align_begin 28 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7PQI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 206 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A009KIJ4 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 233 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 28 _struct_ref_seq.pdbx_auth_seq_align_end 233 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1970 ? 1 MORE 21 ? 1 'SSA (A^2)' 9230 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 3 ? ARG A 9 ? LEU A 30 ARG A 36 1 ? 7 HELX_P HELX_P2 AA2 ARG A 9 ? GLY A 15 ? ARG A 36 GLY A 42 1 ? 7 HELX_P HELX_P3 AA3 GLY A 20 ? ALA A 40 ? GLY A 47 ALA A 67 1 ? 21 HELX_P HELX_P4 AA4 SER A 76 ? ILE A 84 ? SER A 103 ILE A 111 1 ? 9 HELX_P HELX_P5 AA5 GLY A 106 ? LEU A 113 ? GLY A 133 LEU A 140 1 ? 8 HELX_P HELX_P6 AA6 ASN A 169 ? ASN A 184 ? ASN A 196 ASN A 211 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? parallel AA2 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 136 ? PRO A 137 ? ASP A 163 PRO A 164 AA1 2 GLN A 126 ? HIS A 133 ? GLN A 153 HIS A 160 AA1 3 ARG A 142 ? GLU A 146 ? ARG A 169 GLU A 173 AA2 1 ASP A 136 ? PRO A 137 ? ASP A 163 PRO A 164 AA2 2 GLN A 126 ? HIS A 133 ? GLN A 153 HIS A 160 AA2 3 SER A 114 ? ARG A 123 ? SER A 141 ARG A 150 AA2 4 GLY A 151 ? PRO A 158 ? GLY A 178 PRO A 185 AA2 5 VAL A 56 ? ASP A 60 ? VAL A 83 ASP A 87 AA2 6 GLU A 45 ? ILE A 50 ? GLU A 72 ILE A 77 AA2 7 VAL A 187 ? ASP A 193 ? VAL A 214 ASP A 220 AA2 8 LEU A 198 ? TYR A 204 ? LEU A 225 TYR A 231 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ASP A 136 ? O ASP A 163 N HIS A 133 ? N HIS A 160 AA1 2 3 N ILE A 127 ? N ILE A 154 O ILE A 144 ? O ILE A 171 AA2 1 2 O ASP A 136 ? O ASP A 163 N HIS A 133 ? N HIS A 160 AA2 2 3 O GLN A 130 ? O GLN A 157 N LEU A 119 ? N LEU A 146 AA2 3 4 N TYR A 122 ? N TYR A 149 O GLY A 151 ? O GLY A 178 AA2 4 5 O THR A 152 ? O THR A 179 N ASP A 60 ? N ASP A 87 AA2 5 6 O SER A 59 ? O SER A 86 N ILE A 47 ? N ILE A 74 AA2 6 7 N VAL A 48 ? N VAL A 75 O VAL A 190 ? O VAL A 217 AA2 7 8 N ILE A 189 ? N ILE A 216 O TYR A 202 ? O TYR A 229 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 99 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -24.44 _pdbx_validate_torsion.psi -57.73 # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 17.219 _pdbx_refine_tls.origin_y 5.175 _pdbx_refine_tls.origin_z 18.915 _pdbx_refine_tls.T[1][1] 0.1451 _pdbx_refine_tls.T[2][2] 0.0647 _pdbx_refine_tls.T[3][3] 0.0065 _pdbx_refine_tls.T[1][2] 0.0357 _pdbx_refine_tls.T[1][3] -0.0190 _pdbx_refine_tls.T[2][3] 0.0043 _pdbx_refine_tls.L[1][1] 1.0174 _pdbx_refine_tls.L[2][2] 1.7926 _pdbx_refine_tls.L[3][3] 3.3451 _pdbx_refine_tls.L[1][2] -0.1921 _pdbx_refine_tls.L[1][3] -0.0379 _pdbx_refine_tls.L[2][3] -0.3546 _pdbx_refine_tls.S[1][1] 0.0259 _pdbx_refine_tls.S[2][2] -0.0349 _pdbx_refine_tls.S[3][3] 0.0091 _pdbx_refine_tls.S[1][2] 0.0203 _pdbx_refine_tls.S[1][3] -0.0503 _pdbx_refine_tls.S[2][3] -0.0310 _pdbx_refine_tls.S[2][1] 0.1074 _pdbx_refine_tls.S[3][1] 0.1357 _pdbx_refine_tls.S[3][2] 0.1243 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 28 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 233 _pdbx_refine_tls_group.selection_details ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? # _pdbx_entry_details.entry_id 7PQI _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PHE 118 ? A PHE 91 2 1 Y 1 A ASP 119 ? A ASP 92 3 1 Y 1 A ASP 120 ? A ASP 93 4 1 Y 1 A ASN 121 ? A ASN 94 5 1 Y 1 A SER 122 ? A SER 95 6 1 Y 1 A TYR 123 ? A TYR 96 7 1 Y 1 A LYS 124 ? A LYS 97 8 1 Y 1 A VAL 125 ? A VAL 98 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 NOV C1 C N N 260 NOV O1 O N N 261 NOV N1 N N N 262 NOV C12 C N N 263 NOV O4 O N N 264 NOV O5 O N N 265 NOV C27 C N R 266 NOV C28 C N S 267 NOV C29 C N R 268 NOV O6 O N N 269 NOV C30 C N R 270 NOV O7 O N N 271 NOV C31 C N N 272 NOV C23 C N N 273 NOV C26 C N N 274 NOV O8 O N N 275 NOV C3 C Y N 276 NOV C4 C Y N 277 NOV C2 C N N 278 NOV C5 C Y N 279 NOV C9 C Y N 280 NOV C10 C Y N 281 NOV C11 C Y N 282 NOV O10 O N N 283 NOV C6 C N N 284 NOV O11 O N N 285 NOV C7 C N N 286 NOV C8 C N N 287 NOV O9 O N N 288 NOV N2 N N N 289 NOV C13 C N N 290 NOV O2 O N N 291 NOV C14 C Y N 292 NOV C15 C Y N 293 NOV C16 C Y N 294 NOV C17 C Y N 295 NOV O3 O N N 296 NOV C18 C Y N 297 NOV C19 C Y N 298 NOV C20 C N N 299 NOV C21 C N N 300 NOV C22 C N N 301 NOV C24 C N N 302 NOV C25 C N N 303 NOV H11A H N N 304 NOV H12 H N N 305 NOV H13 H N N 306 NOV HN11 H N N 307 NOV HN12 H N N 308 NOV H27 H N N 309 NOV H28 H N N 310 NOV H29 H N N 311 NOV HO6 H N N 312 NOV H30 H N N 313 NOV H231 H N N 314 NOV H232 H N N 315 NOV H233 H N N 316 NOV H261 H N N 317 NOV H262 H N N 318 NOV H263 H N N 319 NOV H21A H N N 320 NOV H22 H N N 321 NOV H23 H N N 322 NOV H10 H N N 323 NOV H11 H N N 324 NOV HO9 H N N 325 NOV HN2 H N N 326 NOV H15 H N N 327 NOV HO3 H N N 328 NOV H18 H N N 329 NOV H19 H N N 330 NOV H201 H N N 331 NOV H202 H N N 332 NOV H21 H N N 333 NOV H241 H N N 334 NOV H242 H N N 335 NOV H243 H N N 336 NOV H251 H N N 337 NOV H252 H N N 338 NOV H253 H N N 339 PHE N N N N 340 PHE CA C N S 341 PHE C C N N 342 PHE O O N N 343 PHE CB C N N 344 PHE CG C Y N 345 PHE CD1 C Y N 346 PHE CD2 C Y N 347 PHE CE1 C Y N 348 PHE CE2 C Y N 349 PHE CZ C Y N 350 PHE OXT O N N 351 PHE H H N N 352 PHE H2 H N N 353 PHE HA H N N 354 PHE HB2 H N N 355 PHE HB3 H N N 356 PHE HD1 H N N 357 PHE HD2 H N N 358 PHE HE1 H N N 359 PHE HE2 H N N 360 PHE HZ H N N 361 PHE HXT H N N 362 PRO N N N N 363 PRO CA C N S 364 PRO C C N N 365 PRO O O N N 366 PRO CB C N N 367 PRO CG C N N 368 PRO CD C N N 369 PRO OXT O N N 370 PRO H H N N 371 PRO HA H N N 372 PRO HB2 H N N 373 PRO HB3 H N N 374 PRO HG2 H N N 375 PRO HG3 H N N 376 PRO HD2 H N N 377 PRO HD3 H N N 378 PRO HXT H N N 379 SER N N N N 380 SER CA C N S 381 SER C C N N 382 SER O O N N 383 SER CB C N N 384 SER OG O N N 385 SER OXT O N N 386 SER H H N N 387 SER H2 H N N 388 SER HA H N N 389 SER HB2 H N N 390 SER HB3 H N N 391 SER HG H N N 392 SER HXT H N N 393 THR N N N N 394 THR CA C N S 395 THR C C N N 396 THR O O N N 397 THR CB C N R 398 THR OG1 O N N 399 THR CG2 C N N 400 THR OXT O N N 401 THR H H N N 402 THR H2 H N N 403 THR HA H N N 404 THR HB H N N 405 THR HG1 H N N 406 THR HG21 H N N 407 THR HG22 H N N 408 THR HG23 H N N 409 THR HXT H N N 410 TRP N N N N 411 TRP CA C N S 412 TRP C C N N 413 TRP O O N N 414 TRP CB C N N 415 TRP CG C Y N 416 TRP CD1 C Y N 417 TRP CD2 C Y N 418 TRP NE1 N Y N 419 TRP CE2 C Y N 420 TRP CE3 C Y N 421 TRP CZ2 C Y N 422 TRP CZ3 C Y N 423 TRP CH2 C Y N 424 TRP OXT O N N 425 TRP H H N N 426 TRP H2 H N N 427 TRP HA H N N 428 TRP HB2 H N N 429 TRP HB3 H N N 430 TRP HD1 H N N 431 TRP HE1 H N N 432 TRP HE3 H N N 433 TRP HZ2 H N N 434 TRP HZ3 H N N 435 TRP HH2 H N N 436 TRP HXT H N N 437 TYR N N N N 438 TYR CA C N S 439 TYR C C N N 440 TYR O O N N 441 TYR CB C N N 442 TYR CG C Y N 443 TYR CD1 C Y N 444 TYR CD2 C Y N 445 TYR CE1 C Y N 446 TYR CE2 C Y N 447 TYR CZ C Y N 448 TYR OH O N N 449 TYR OXT O N N 450 TYR H H N N 451 TYR H2 H N N 452 TYR HA H N N 453 TYR HB2 H N N 454 TYR HB3 H N N 455 TYR HD1 H N N 456 TYR HD2 H N N 457 TYR HE1 H N N 458 TYR HE2 H N N 459 TYR HH H N N 460 TYR HXT H N N 461 VAL N N N N 462 VAL CA C N S 463 VAL C C N N 464 VAL O O N N 465 VAL CB C N N 466 VAL CG1 C N N 467 VAL CG2 C N N 468 VAL OXT O N N 469 VAL H H N N 470 VAL H2 H N N 471 VAL HA H N N 472 VAL HB H N N 473 VAL HG11 H N N 474 VAL HG12 H N N 475 VAL HG13 H N N 476 VAL HG21 H N N 477 VAL HG22 H N N 478 VAL HG23 H N N 479 VAL HXT H N N 480 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 NOV C1 O1 sing N N 246 NOV C1 H11A sing N N 247 NOV C1 H12 sing N N 248 NOV C1 H13 sing N N 249 NOV O1 C27 sing N N 250 NOV N1 C12 sing N N 251 NOV N1 HN11 sing N N 252 NOV N1 HN12 sing N N 253 NOV C12 O4 doub N N 254 NOV C12 O5 sing N N 255 NOV O5 C28 sing N N 256 NOV C27 C28 sing N N 257 NOV C27 C31 sing N N 258 NOV C27 H27 sing N N 259 NOV C28 C29 sing N N 260 NOV C28 H28 sing N N 261 NOV C29 O6 sing N N 262 NOV C29 C30 sing N N 263 NOV C29 H29 sing N N 264 NOV O6 HO6 sing N N 265 NOV C30 O7 sing N N 266 NOV C30 O8 sing N N 267 NOV C30 H30 sing N N 268 NOV O7 C31 sing N N 269 NOV C31 C23 sing N N 270 NOV C31 C26 sing N N 271 NOV C23 H231 sing N N 272 NOV C23 H232 sing N N 273 NOV C23 H233 sing N N 274 NOV C26 H261 sing N N 275 NOV C26 H262 sing N N 276 NOV C26 H263 sing N N 277 NOV O8 C3 sing N N 278 NOV C3 C4 doub Y N 279 NOV C3 C11 sing Y N 280 NOV C4 C2 sing N N 281 NOV C4 C5 sing Y N 282 NOV C2 H21A sing N N 283 NOV C2 H22 sing N N 284 NOV C2 H23 sing N N 285 NOV C5 C9 doub Y N 286 NOV C5 O10 sing N N 287 NOV C9 C10 sing Y N 288 NOV C9 C8 sing N N 289 NOV C10 C11 doub Y N 290 NOV C10 H10 sing N N 291 NOV C11 H11 sing N N 292 NOV O10 C6 sing N N 293 NOV C6 O11 doub N N 294 NOV C6 C7 sing N N 295 NOV C7 C8 doub N N 296 NOV C7 N2 sing N N 297 NOV C8 O9 sing N N 298 NOV O9 HO9 sing N N 299 NOV N2 C13 sing N N 300 NOV N2 HN2 sing N N 301 NOV C13 O2 doub N N 302 NOV C13 C14 sing N N 303 NOV C14 C15 doub Y N 304 NOV C14 C19 sing Y N 305 NOV C15 C16 sing Y N 306 NOV C15 H15 sing N N 307 NOV C16 C17 doub Y N 308 NOV C16 C20 sing N N 309 NOV C17 O3 sing N N 310 NOV C17 C18 sing Y N 311 NOV O3 HO3 sing N N 312 NOV C18 C19 doub Y N 313 NOV C18 H18 sing N N 314 NOV C19 H19 sing N N 315 NOV C20 C21 sing N N 316 NOV C20 H201 sing N N 317 NOV C20 H202 sing N N 318 NOV C21 C22 doub N N 319 NOV C21 H21 sing N N 320 NOV C22 C24 sing N N 321 NOV C22 C25 sing N N 322 NOV C24 H241 sing N N 323 NOV C24 H242 sing N N 324 NOV C24 H243 sing N N 325 NOV C25 H251 sing N N 326 NOV C25 H252 sing N N 327 NOV C25 H253 sing N N 328 PHE N CA sing N N 329 PHE N H sing N N 330 PHE N H2 sing N N 331 PHE CA C sing N N 332 PHE CA CB sing N N 333 PHE CA HA sing N N 334 PHE C O doub N N 335 PHE C OXT sing N N 336 PHE CB CG sing N N 337 PHE CB HB2 sing N N 338 PHE CB HB3 sing N N 339 PHE CG CD1 doub Y N 340 PHE CG CD2 sing Y N 341 PHE CD1 CE1 sing Y N 342 PHE CD1 HD1 sing N N 343 PHE CD2 CE2 doub Y N 344 PHE CD2 HD2 sing N N 345 PHE CE1 CZ doub Y N 346 PHE CE1 HE1 sing N N 347 PHE CE2 CZ sing Y N 348 PHE CE2 HE2 sing N N 349 PHE CZ HZ sing N N 350 PHE OXT HXT sing N N 351 PRO N CA sing N N 352 PRO N CD sing N N 353 PRO N H sing N N 354 PRO CA C sing N N 355 PRO CA CB sing N N 356 PRO CA HA sing N N 357 PRO C O doub N N 358 PRO C OXT sing N N 359 PRO CB CG sing N N 360 PRO CB HB2 sing N N 361 PRO CB HB3 sing N N 362 PRO CG CD sing N N 363 PRO CG HG2 sing N N 364 PRO CG HG3 sing N N 365 PRO CD HD2 sing N N 366 PRO CD HD3 sing N N 367 PRO OXT HXT sing N N 368 SER N CA sing N N 369 SER N H sing N N 370 SER N H2 sing N N 371 SER CA C sing N N 372 SER CA CB sing N N 373 SER CA HA sing N N 374 SER C O doub N N 375 SER C OXT sing N N 376 SER CB OG sing N N 377 SER CB HB2 sing N N 378 SER CB HB3 sing N N 379 SER OG HG sing N N 380 SER OXT HXT sing N N 381 THR N CA sing N N 382 THR N H sing N N 383 THR N H2 sing N N 384 THR CA C sing N N 385 THR CA CB sing N N 386 THR CA HA sing N N 387 THR C O doub N N 388 THR C OXT sing N N 389 THR CB OG1 sing N N 390 THR CB CG2 sing N N 391 THR CB HB sing N N 392 THR OG1 HG1 sing N N 393 THR CG2 HG21 sing N N 394 THR CG2 HG22 sing N N 395 THR CG2 HG23 sing N N 396 THR OXT HXT sing N N 397 TRP N CA sing N N 398 TRP N H sing N N 399 TRP N H2 sing N N 400 TRP CA C sing N N 401 TRP CA CB sing N N 402 TRP CA HA sing N N 403 TRP C O doub N N 404 TRP C OXT sing N N 405 TRP CB CG sing N N 406 TRP CB HB2 sing N N 407 TRP CB HB3 sing N N 408 TRP CG CD1 doub Y N 409 TRP CG CD2 sing Y N 410 TRP CD1 NE1 sing Y N 411 TRP CD1 HD1 sing N N 412 TRP CD2 CE2 doub Y N 413 TRP CD2 CE3 sing Y N 414 TRP NE1 CE2 sing Y N 415 TRP NE1 HE1 sing N N 416 TRP CE2 CZ2 sing Y N 417 TRP CE3 CZ3 doub Y N 418 TRP CE3 HE3 sing N N 419 TRP CZ2 CH2 doub Y N 420 TRP CZ2 HZ2 sing N N 421 TRP CZ3 CH2 sing Y N 422 TRP CZ3 HZ3 sing N N 423 TRP CH2 HH2 sing N N 424 TRP OXT HXT sing N N 425 TYR N CA sing N N 426 TYR N H sing N N 427 TYR N H2 sing N N 428 TYR CA C sing N N 429 TYR CA CB sing N N 430 TYR CA HA sing N N 431 TYR C O doub N N 432 TYR C OXT sing N N 433 TYR CB CG sing N N 434 TYR CB HB2 sing N N 435 TYR CB HB3 sing N N 436 TYR CG CD1 doub Y N 437 TYR CG CD2 sing Y N 438 TYR CD1 CE1 sing Y N 439 TYR CD1 HD1 sing N N 440 TYR CD2 CE2 doub Y N 441 TYR CD2 HD2 sing N N 442 TYR CE1 CZ doub Y N 443 TYR CE1 HE1 sing N N 444 TYR CE2 CZ sing Y N 445 TYR CE2 HE2 sing N N 446 TYR CZ OH sing N N 447 TYR OH HH sing N N 448 TYR OXT HXT sing N N 449 VAL N CA sing N N 450 VAL N H sing N N 451 VAL N H2 sing N N 452 VAL CA C sing N N 453 VAL CA CB sing N N 454 VAL CA HA sing N N 455 VAL C O doub N N 456 VAL C OXT sing N N 457 VAL CB CG1 sing N N 458 VAL CB CG2 sing N N 459 VAL CB HB sing N N 460 VAL CG1 HG11 sing N N 461 VAL CG1 HG12 sing N N 462 VAL CG1 HG13 sing N N 463 VAL CG2 HG21 sing N N 464 VAL CG2 HG22 sing N N 465 VAL CG2 HG23 sing N N 466 VAL OXT HXT sing N N 467 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'European Communitys Seventh Framework Programme' 'United Kingdom' 115583 1 'Biotechnology and Biological Sciences Research Council (BBSRC)' 'United Kingdom' BB/P012523/1 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NOV _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NOV _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6YD9 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7PQI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.023327 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023327 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003903 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_