data_7PQW # _entry.id 7PQW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PQW pdb_00007pqw 10.2210/pdb7pqw/pdb WWPDB D_1292118214 ? ? BMRB 34667 ? 10.13018/BMR34667 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-09-28 2 'Structure model' 1 1 2023-04-12 3 'Structure model' 1 2 2024-06-05 4 'Structure model' 1 3 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Source and taxonomy' 5 3 'Structure model' 'Structure summary' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' entity_name_com 7 3 'Structure model' pdbx_entity_src_syn 8 4 'Structure model' pdbx_entry_details 9 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_database_2.pdbx_DOI' 11 3 'Structure model' '_pdbx_entity_src_syn.ncbi_taxonomy_id' 12 3 'Structure model' '_pdbx_entity_src_syn.organism_common_name' 13 3 'Structure model' '_pdbx_entity_src_syn.organism_scientific' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7PQW _pdbx_database_status.recvd_initial_deposition_date 2021-09-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR solution structure of BCR4' _pdbx_database_related.db_id 34667 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Loth, K.' 1 0000-0001-7058-8661 'Paquet, F.' 2 0000-0001-8838-3445 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Int J Mol Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1422-0067 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 23 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Aphid BCR4 Structure and Activity Uncover a New Defensin Peptide Superfamily.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/ijms232012480 _citation.pdbx_database_id_PubMed 36293341 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Loth, K.' 1 ? primary 'Parisot, N.' 2 0000-0001-5217-8415 primary 'Paquet, F.' 3 0000-0001-8838-3445 primary 'Terrasson, H.' 4 ? primary 'Sivignon, C.' 5 ? primary 'Rahioui, I.' 6 ? primary 'Ribeiro Lopes, M.' 7 0000-0002-6467-1343 primary 'Gaget, K.' 8 ? primary 'Duport, G.' 9 ? primary 'Delmas, A.F.' 10 ? primary 'Aucagne, V.' 11 0000-0002-2647-0188 primary 'Heddi, A.' 12 0000-0001-6708-9298 primary 'Calevro, F.' 13 0000-0001-7856-9617 primary 'da Silva, P.' 14 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description BCR4 _entity.formula_weight 5905.645 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Bacteriocyte-specific Cysteine-Rich peptide 4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DFDPTEFKGPFPTIEICSKYCAVVCNYTSRPCYCVEAAKERDQWFPYCYD _entity_poly.pdbx_seq_one_letter_code_can DFDPTEFKGPFPTIEICSKYCAVVCNYTSRPCYCVEAAKERDQWFPYCYD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 PHE n 1 3 ASP n 1 4 PRO n 1 5 THR n 1 6 GLU n 1 7 PHE n 1 8 LYS n 1 9 GLY n 1 10 PRO n 1 11 PHE n 1 12 PRO n 1 13 THR n 1 14 ILE n 1 15 GLU n 1 16 ILE n 1 17 CYS n 1 18 SER n 1 19 LYS n 1 20 TYR n 1 21 CYS n 1 22 ALA n 1 23 VAL n 1 24 VAL n 1 25 CYS n 1 26 ASN n 1 27 TYR n 1 28 THR n 1 29 SER n 1 30 ARG n 1 31 PRO n 1 32 CYS n 1 33 TYR n 1 34 CYS n 1 35 VAL n 1 36 GLU n 1 37 ALA n 1 38 ALA n 1 39 LYS n 1 40 GLU n 1 41 ARG n 1 42 ASP n 1 43 GLN n 1 44 TRP n 1 45 PHE n 1 46 PRO n 1 47 TYR n 1 48 CYS n 1 49 TYR n 1 50 ASP n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 50 _pdbx_entity_src_syn.organism_scientific 'Acyrthosiphon pisum' _pdbx_entity_src_syn.organism_common_name 'pea aphid' _pdbx_entity_src_syn.ncbi_taxonomy_id 7029 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 ASP 50 50 50 ASP ASP A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PQW _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7PQW _struct.title 'NMR solution structure of BCR4' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PQW _struct_keywords.text 'Endosymbiosis Pesticide Antimicrobial Disulfide rich peptide BCR1 family, ANTIMICROBIAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7PQW _struct_ref.pdbx_db_accession 7PQW _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7PQW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 50 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7PQW _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 50 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 50 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR relaxation study' _pdbx_struct_assembly_auth_evidence.details DOSY # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 13 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id CYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 25 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 13 _struct_conf.end_auth_comp_id CYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 25 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 17 A CYS 34 1_555 ? ? ? ? ? ? ? 2.194 ? ? disulf2 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 21 A CYS 32 1_555 ? ? ? ? ? ? ? 2.133 ? ? disulf3 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 25 A CYS 48 1_555 ? ? ? ? ? ? ? 2.194 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 17 ? CYS A 34 ? CYS A 17 ? 1_555 CYS A 34 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 21 ? CYS A 32 ? CYS A 21 ? 1_555 CYS A 32 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 25 ? CYS A 48 ? CYS A 25 ? 1_555 CYS A 48 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 34 ? ALA A 37 ? CYS A 34 ALA A 37 AA1 2 GLN A 43 ? PRO A 46 ? GLN A 43 PRO A 46 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ALA _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 37 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 37 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 43 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 43 # _pdbx_entry_details.entry_id 7PQW _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 18 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 15 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HG _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 18 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 6 ? ? -97.85 -82.79 2 1 PHE A 7 ? ? -115.25 -87.86 3 1 LYS A 8 ? ? -141.85 -16.99 4 1 THR A 13 ? ? -79.95 36.73 5 1 ILE A 14 ? ? -32.89 -28.38 6 1 VAL A 24 ? ? -64.49 -72.56 7 1 CYS A 25 ? ? -98.49 -78.93 8 1 ASN A 26 ? ? -98.00 -60.39 9 1 TYR A 27 ? ? -78.01 40.30 10 1 THR A 28 ? ? -37.64 -30.52 11 1 ARG A 41 ? ? 78.31 -48.05 12 1 PRO A 46 ? ? -39.41 144.12 13 1 TYR A 49 ? ? -174.41 -172.83 14 2 GLU A 6 ? ? -97.79 -81.91 15 2 PHE A 7 ? ? -112.05 -88.57 16 2 LYS A 8 ? ? -144.92 -26.41 17 2 PRO A 10 ? ? -49.56 167.63 18 2 THR A 13 ? ? -74.98 36.80 19 2 ILE A 14 ? ? -31.94 -30.71 20 2 VAL A 24 ? ? -60.78 -73.16 21 2 CYS A 25 ? ? -98.38 -77.99 22 2 ASN A 26 ? ? -95.43 -60.09 23 2 TYR A 27 ? ? -86.06 41.79 24 2 THR A 28 ? ? -31.75 -34.78 25 2 ARG A 41 ? ? 75.56 -31.05 26 2 TYR A 49 ? ? 178.88 -174.04 27 3 GLU A 6 ? ? -96.16 -83.15 28 3 PHE A 7 ? ? -114.92 -88.09 29 3 LYS A 8 ? ? -143.95 -8.03 30 3 THR A 13 ? ? -72.20 37.22 31 3 ILE A 14 ? ? -32.08 -30.03 32 3 VAL A 24 ? ? -67.40 -73.66 33 3 CYS A 25 ? ? -98.09 -79.12 34 3 TYR A 27 ? ? -79.13 39.95 35 3 THR A 28 ? ? -38.27 -33.85 36 3 ARG A 41 ? ? 80.38 -35.17 37 3 PRO A 46 ? ? -39.12 144.27 38 3 TYR A 49 ? ? -175.28 -170.13 39 4 GLU A 6 ? ? -97.71 -83.30 40 4 PHE A 7 ? ? -115.60 -87.09 41 4 LYS A 8 ? ? -142.60 -30.08 42 4 THR A 13 ? ? -69.63 37.31 43 4 ILE A 14 ? ? -32.78 -27.86 44 4 VAL A 24 ? ? -62.20 -73.53 45 4 CYS A 25 ? ? -98.18 -79.48 46 4 TYR A 27 ? ? -80.52 39.83 47 4 THR A 28 ? ? -39.61 -28.86 48 4 ARG A 41 ? ? 75.10 -50.06 49 4 PRO A 46 ? ? -39.52 141.19 50 4 TYR A 49 ? ? 176.65 -168.79 51 5 GLU A 6 ? ? -97.24 -83.31 52 5 PHE A 7 ? ? -115.63 -86.23 53 5 LYS A 8 ? ? -141.17 -21.31 54 5 THR A 13 ? ? -74.67 37.09 55 5 ILE A 14 ? ? -32.83 -28.51 56 5 VAL A 24 ? ? -60.44 -70.26 57 5 CYS A 25 ? ? -97.47 -81.29 58 5 TYR A 27 ? ? -76.06 39.81 59 5 THR A 28 ? ? -34.84 -36.32 60 5 ARG A 41 ? ? 77.46 -41.94 61 5 PRO A 46 ? ? -39.25 142.46 62 5 TYR A 49 ? ? -175.40 -165.95 63 6 PHE A 2 ? ? -174.25 141.99 64 6 GLU A 6 ? ? -99.61 -82.12 65 6 PHE A 7 ? ? -112.92 -87.40 66 6 LYS A 8 ? ? -142.71 -31.53 67 6 THR A 13 ? ? -69.26 36.62 68 6 ILE A 14 ? ? -32.69 -28.52 69 6 VAL A 24 ? ? -60.04 -73.04 70 6 CYS A 25 ? ? -98.80 -79.52 71 6 TYR A 27 ? ? -78.58 39.59 72 6 ARG A 41 ? ? 78.05 -34.09 73 6 PRO A 46 ? ? -39.55 143.03 74 6 TYR A 49 ? ? -168.29 -161.56 75 7 GLU A 6 ? ? -97.41 -83.30 76 7 PHE A 7 ? ? -115.15 -87.94 77 7 LYS A 8 ? ? -141.48 -21.08 78 7 THR A 13 ? ? -71.55 36.59 79 7 ILE A 14 ? ? -32.44 -29.78 80 7 VAL A 24 ? ? -67.97 -73.35 81 7 CYS A 25 ? ? -99.02 -77.25 82 7 ASN A 26 ? ? -95.38 -62.14 83 7 TYR A 27 ? ? -83.89 41.38 84 7 THR A 28 ? ? -29.25 -42.13 85 7 ARG A 41 ? ? 76.35 -37.68 86 7 PRO A 46 ? ? -38.78 145.06 87 7 TYR A 49 ? ? -172.83 -162.78 88 8 GLU A 6 ? ? -97.63 -82.22 89 8 PHE A 7 ? ? -115.09 -87.77 90 8 LYS A 8 ? ? -142.11 -30.56 91 8 THR A 13 ? ? -80.12 36.75 92 8 ILE A 14 ? ? -32.09 -29.47 93 8 VAL A 24 ? ? -65.26 -73.98 94 8 CYS A 25 ? ? -98.20 -79.37 95 8 TYR A 27 ? ? -79.13 40.14 96 8 ARG A 41 ? ? 82.71 -34.17 97 8 PRO A 46 ? ? -39.08 141.17 98 8 TYR A 49 ? ? -178.21 -174.73 99 9 GLU A 6 ? ? -97.77 -83.79 100 9 PHE A 7 ? ? -115.36 -86.22 101 9 LYS A 8 ? ? -140.82 -19.18 102 9 THR A 13 ? ? -68.47 37.51 103 9 ILE A 14 ? ? -32.45 -28.55 104 9 VAL A 24 ? ? -64.94 -71.87 105 9 CYS A 25 ? ? -98.69 -78.67 106 9 ASN A 26 ? ? -99.00 -60.89 107 9 TYR A 27 ? ? -81.83 39.18 108 9 THR A 28 ? ? -34.55 -35.81 109 9 ARG A 41 ? ? 80.57 -45.30 110 9 PRO A 46 ? ? -39.74 142.94 111 10 GLU A 6 ? ? -99.18 -84.11 112 10 PHE A 7 ? ? -115.53 -85.65 113 10 LYS A 8 ? ? -140.57 -21.43 114 10 THR A 13 ? ? -68.79 37.17 115 10 ILE A 14 ? ? -31.92 -31.10 116 10 VAL A 24 ? ? -63.98 -73.20 117 10 CYS A 25 ? ? -98.39 -78.24 118 10 TYR A 27 ? ? -79.93 40.14 119 10 THR A 28 ? ? -36.01 -33.04 120 10 ARG A 41 ? ? 77.50 -38.31 121 11 GLU A 6 ? ? -94.40 -81.38 122 11 PHE A 7 ? ? -113.21 -89.40 123 11 LYS A 8 ? ? -145.11 -26.47 124 11 THR A 13 ? ? -68.22 37.02 125 11 ILE A 14 ? ? -32.53 -28.76 126 11 VAL A 24 ? ? -63.94 -71.94 127 11 CYS A 25 ? ? -99.78 -79.03 128 11 ASN A 26 ? ? -98.55 -62.73 129 11 TYR A 27 ? ? -79.11 40.13 130 11 THR A 28 ? ? -34.66 -35.83 131 11 ARG A 41 ? ? 76.51 -41.82 132 11 PRO A 46 ? ? -38.47 141.45 133 11 TYR A 49 ? ? 178.64 174.13 134 12 GLU A 6 ? ? -96.22 -83.35 135 12 PHE A 7 ? ? -114.68 -87.40 136 12 LYS A 8 ? ? -142.23 -15.21 137 12 THR A 13 ? ? -70.46 36.74 138 12 ILE A 14 ? ? -32.56 -30.08 139 12 VAL A 24 ? ? -67.62 -73.71 140 12 CYS A 25 ? ? -99.20 -78.23 141 12 TYR A 27 ? ? -85.17 39.88 142 12 THR A 28 ? ? -39.77 -27.53 143 12 ARG A 41 ? ? 79.64 -43.75 144 12 PRO A 46 ? ? -42.40 152.77 145 12 TYR A 47 ? ? -64.45 1.10 146 12 TYR A 49 ? ? -153.08 -154.37 147 13 GLU A 6 ? ? -96.63 -83.65 148 13 PHE A 7 ? ? -115.93 -85.72 149 13 THR A 13 ? ? -69.95 37.60 150 13 ILE A 14 ? ? -31.52 -30.38 151 13 VAL A 24 ? ? -59.88 -72.15 152 13 CYS A 25 ? ? -98.27 -80.33 153 13 ASN A 26 ? ? -97.56 -60.12 154 13 TYR A 27 ? ? -79.23 40.05 155 13 THR A 28 ? ? -38.66 -27.86 156 13 ARG A 41 ? ? 81.32 -41.59 157 13 PRO A 46 ? ? -39.97 143.70 158 13 TYR A 49 ? ? -179.09 -164.60 159 14 GLU A 6 ? ? -98.97 -82.12 160 14 PHE A 7 ? ? -113.88 -88.53 161 14 LYS A 8 ? ? -142.85 -11.27 162 14 THR A 13 ? ? -73.70 37.15 163 14 ILE A 14 ? ? -32.04 -30.43 164 14 VAL A 24 ? ? -65.48 -71.76 165 14 CYS A 25 ? ? -98.29 -80.00 166 14 TYR A 27 ? ? -79.82 40.25 167 14 ARG A 41 ? ? 78.55 -48.19 168 14 PRO A 46 ? ? -39.61 142.71 169 15 GLU A 6 ? ? -98.30 -83.33 170 15 PHE A 7 ? ? -114.77 -87.20 171 15 LYS A 8 ? ? -143.11 -13.15 172 15 THR A 13 ? ? -67.57 37.50 173 15 ILE A 14 ? ? -32.14 -29.38 174 15 VAL A 24 ? ? -67.90 -70.64 175 15 CYS A 25 ? ? -98.01 -81.77 176 15 TYR A 27 ? ? -73.78 39.01 177 15 THR A 28 ? ? -38.23 -33.24 178 15 ARG A 41 ? ? 77.69 -42.00 179 16 GLU A 6 ? ? -95.13 -80.37 180 16 PHE A 7 ? ? -111.29 -89.45 181 16 LYS A 8 ? ? -143.70 -32.43 182 16 PRO A 10 ? ? -45.17 159.42 183 16 THR A 13 ? ? -77.00 37.04 184 16 ILE A 14 ? ? -31.61 -31.22 185 16 VAL A 24 ? ? -57.14 -73.33 186 16 CYS A 25 ? ? -98.60 -79.83 187 16 TYR A 27 ? ? -79.99 40.61 188 16 ARG A 41 ? ? 75.87 -33.41 189 16 CYS A 48 ? ? -113.12 79.43 190 16 TYR A 49 ? ? 177.91 146.55 191 17 GLU A 6 ? ? -98.01 -83.64 192 17 PHE A 7 ? ? -115.27 -87.09 193 17 LYS A 8 ? ? -142.10 -14.53 194 17 THR A 13 ? ? -72.70 37.46 195 17 ILE A 14 ? ? -31.92 -30.52 196 17 VAL A 24 ? ? -62.04 -72.67 197 17 CYS A 25 ? ? -97.45 -79.38 198 17 TYR A 27 ? ? -79.65 40.71 199 17 THR A 28 ? ? -39.14 -28.98 200 17 ARG A 41 ? ? 77.44 -34.42 201 17 PRO A 46 ? ? -39.11 141.16 202 17 TYR A 49 ? ? -172.59 -162.29 203 18 GLU A 6 ? ? -98.44 -80.37 204 18 PHE A 7 ? ? -112.49 -88.38 205 18 LYS A 8 ? ? -143.13 -30.03 206 18 THR A 13 ? ? -69.01 37.11 207 18 ILE A 14 ? ? -32.61 -26.46 208 18 VAL A 24 ? ? -63.28 -74.17 209 18 CYS A 25 ? ? -98.27 -80.97 210 18 TYR A 27 ? ? -77.12 39.05 211 18 ARG A 41 ? ? 79.85 -46.16 212 19 GLU A 6 ? ? -101.21 -82.33 213 19 PHE A 7 ? ? -114.68 -85.88 214 19 LYS A 8 ? ? -142.13 -29.21 215 19 THR A 13 ? ? -70.41 37.46 216 19 ILE A 14 ? ? -31.93 -30.77 217 19 VAL A 24 ? ? -63.81 -70.19 218 19 CYS A 25 ? ? -96.80 -82.75 219 19 TYR A 27 ? ? -74.95 39.59 220 19 ARG A 41 ? ? 74.11 -33.13 221 19 PRO A 46 ? ? -39.91 140.58 222 19 TYR A 49 ? ? -177.75 -158.71 223 20 GLU A 6 ? ? -98.06 -82.75 224 20 PHE A 7 ? ? -114.18 -86.83 225 20 LYS A 8 ? ? -143.25 -20.27 226 20 THR A 13 ? ? -73.10 36.73 227 20 ILE A 14 ? ? -32.63 -29.52 228 20 VAL A 24 ? ? -68.52 -72.92 229 20 CYS A 25 ? ? -98.62 -78.49 230 20 TYR A 27 ? ? -81.55 41.05 231 20 THR A 28 ? ? -35.13 -31.81 232 20 ARG A 41 ? ? 76.12 -35.58 233 20 PRO A 46 ? ? -39.67 140.10 234 20 TYR A 49 ? ? -179.73 -173.91 # _pdbx_nmr_ensemble.entry_id 7PQW _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7PQW _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.6 mM unlabelled BCR4, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label unlabelled _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component BCR4 _pdbx_nmr_exptl_sample.concentration 0.6 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling unlabelled # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D TOCSY' 1 isotropic 2 1 1 '2D NOESY' 1 isotropic 3 1 1 'so-fast HMQC' 1 isotropic 4 1 1 13C-HSQC 1 isotropic # _pdbx_nmr_refine.entry_id 7PQW _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 2 'peak picking' 'CcpNmr Analysis' ? CCPN 3 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LYS N N N N 159 LYS CA C N S 160 LYS C C N N 161 LYS O O N N 162 LYS CB C N N 163 LYS CG C N N 164 LYS CD C N N 165 LYS CE C N N 166 LYS NZ N N N 167 LYS OXT O N N 168 LYS H H N N 169 LYS H2 H N N 170 LYS HA H N N 171 LYS HB2 H N N 172 LYS HB3 H N N 173 LYS HG2 H N N 174 LYS HG3 H N N 175 LYS HD2 H N N 176 LYS HD3 H N N 177 LYS HE2 H N N 178 LYS HE3 H N N 179 LYS HZ1 H N N 180 LYS HZ2 H N N 181 LYS HZ3 H N N 182 LYS HXT H N N 183 PHE N N N N 184 PHE CA C N S 185 PHE C C N N 186 PHE O O N N 187 PHE CB C N N 188 PHE CG C Y N 189 PHE CD1 C Y N 190 PHE CD2 C Y N 191 PHE CE1 C Y N 192 PHE CE2 C Y N 193 PHE CZ C Y N 194 PHE OXT O N N 195 PHE H H N N 196 PHE H2 H N N 197 PHE HA H N N 198 PHE HB2 H N N 199 PHE HB3 H N N 200 PHE HD1 H N N 201 PHE HD2 H N N 202 PHE HE1 H N N 203 PHE HE2 H N N 204 PHE HZ H N N 205 PHE HXT H N N 206 PRO N N N N 207 PRO CA C N S 208 PRO C C N N 209 PRO O O N N 210 PRO CB C N N 211 PRO CG C N N 212 PRO CD C N N 213 PRO OXT O N N 214 PRO H H N N 215 PRO HA H N N 216 PRO HB2 H N N 217 PRO HB3 H N N 218 PRO HG2 H N N 219 PRO HG3 H N N 220 PRO HD2 H N N 221 PRO HD3 H N N 222 PRO HXT H N N 223 SER N N N N 224 SER CA C N S 225 SER C C N N 226 SER O O N N 227 SER CB C N N 228 SER OG O N N 229 SER OXT O N N 230 SER H H N N 231 SER H2 H N N 232 SER HA H N N 233 SER HB2 H N N 234 SER HB3 H N N 235 SER HG H N N 236 SER HXT H N N 237 THR N N N N 238 THR CA C N S 239 THR C C N N 240 THR O O N N 241 THR CB C N R 242 THR OG1 O N N 243 THR CG2 C N N 244 THR OXT O N N 245 THR H H N N 246 THR H2 H N N 247 THR HA H N N 248 THR HB H N N 249 THR HG1 H N N 250 THR HG21 H N N 251 THR HG22 H N N 252 THR HG23 H N N 253 THR HXT H N N 254 TRP N N N N 255 TRP CA C N S 256 TRP C C N N 257 TRP O O N N 258 TRP CB C N N 259 TRP CG C Y N 260 TRP CD1 C Y N 261 TRP CD2 C Y N 262 TRP NE1 N Y N 263 TRP CE2 C Y N 264 TRP CE3 C Y N 265 TRP CZ2 C Y N 266 TRP CZ3 C Y N 267 TRP CH2 C Y N 268 TRP OXT O N N 269 TRP H H N N 270 TRP H2 H N N 271 TRP HA H N N 272 TRP HB2 H N N 273 TRP HB3 H N N 274 TRP HD1 H N N 275 TRP HE1 H N N 276 TRP HE3 H N N 277 TRP HZ2 H N N 278 TRP HZ3 H N N 279 TRP HH2 H N N 280 TRP HXT H N N 281 TYR N N N N 282 TYR CA C N S 283 TYR C C N N 284 TYR O O N N 285 TYR CB C N N 286 TYR CG C Y N 287 TYR CD1 C Y N 288 TYR CD2 C Y N 289 TYR CE1 C Y N 290 TYR CE2 C Y N 291 TYR CZ C Y N 292 TYR OH O N N 293 TYR OXT O N N 294 TYR H H N N 295 TYR H2 H N N 296 TYR HA H N N 297 TYR HB2 H N N 298 TYR HB3 H N N 299 TYR HD1 H N N 300 TYR HD2 H N N 301 TYR HE1 H N N 302 TYR HE2 H N N 303 TYR HH H N N 304 TYR HXT H N N 305 VAL N N N N 306 VAL CA C N S 307 VAL C C N N 308 VAL O O N N 309 VAL CB C N N 310 VAL CG1 C N N 311 VAL CG2 C N N 312 VAL OXT O N N 313 VAL H H N N 314 VAL H2 H N N 315 VAL HA H N N 316 VAL HB H N N 317 VAL HG11 H N N 318 VAL HG12 H N N 319 VAL HG13 H N N 320 VAL HG21 H N N 321 VAL HG22 H N N 322 VAL HG23 H N N 323 VAL HXT H N N 324 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LYS N CA sing N N 150 LYS N H sing N N 151 LYS N H2 sing N N 152 LYS CA C sing N N 153 LYS CA CB sing N N 154 LYS CA HA sing N N 155 LYS C O doub N N 156 LYS C OXT sing N N 157 LYS CB CG sing N N 158 LYS CB HB2 sing N N 159 LYS CB HB3 sing N N 160 LYS CG CD sing N N 161 LYS CG HG2 sing N N 162 LYS CG HG3 sing N N 163 LYS CD CE sing N N 164 LYS CD HD2 sing N N 165 LYS CD HD3 sing N N 166 LYS CE NZ sing N N 167 LYS CE HE2 sing N N 168 LYS CE HE3 sing N N 169 LYS NZ HZ1 sing N N 170 LYS NZ HZ2 sing N N 171 LYS NZ HZ3 sing N N 172 LYS OXT HXT sing N N 173 PHE N CA sing N N 174 PHE N H sing N N 175 PHE N H2 sing N N 176 PHE CA C sing N N 177 PHE CA CB sing N N 178 PHE CA HA sing N N 179 PHE C O doub N N 180 PHE C OXT sing N N 181 PHE CB CG sing N N 182 PHE CB HB2 sing N N 183 PHE CB HB3 sing N N 184 PHE CG CD1 doub Y N 185 PHE CG CD2 sing Y N 186 PHE CD1 CE1 sing Y N 187 PHE CD1 HD1 sing N N 188 PHE CD2 CE2 doub Y N 189 PHE CD2 HD2 sing N N 190 PHE CE1 CZ doub Y N 191 PHE CE1 HE1 sing N N 192 PHE CE2 CZ sing Y N 193 PHE CE2 HE2 sing N N 194 PHE CZ HZ sing N N 195 PHE OXT HXT sing N N 196 PRO N CA sing N N 197 PRO N CD sing N N 198 PRO N H sing N N 199 PRO CA C sing N N 200 PRO CA CB sing N N 201 PRO CA HA sing N N 202 PRO C O doub N N 203 PRO C OXT sing N N 204 PRO CB CG sing N N 205 PRO CB HB2 sing N N 206 PRO CB HB3 sing N N 207 PRO CG CD sing N N 208 PRO CG HG2 sing N N 209 PRO CG HG3 sing N N 210 PRO CD HD2 sing N N 211 PRO CD HD3 sing N N 212 PRO OXT HXT sing N N 213 SER N CA sing N N 214 SER N H sing N N 215 SER N H2 sing N N 216 SER CA C sing N N 217 SER CA CB sing N N 218 SER CA HA sing N N 219 SER C O doub N N 220 SER C OXT sing N N 221 SER CB OG sing N N 222 SER CB HB2 sing N N 223 SER CB HB3 sing N N 224 SER OG HG sing N N 225 SER OXT HXT sing N N 226 THR N CA sing N N 227 THR N H sing N N 228 THR N H2 sing N N 229 THR CA C sing N N 230 THR CA CB sing N N 231 THR CA HA sing N N 232 THR C O doub N N 233 THR C OXT sing N N 234 THR CB OG1 sing N N 235 THR CB CG2 sing N N 236 THR CB HB sing N N 237 THR OG1 HG1 sing N N 238 THR CG2 HG21 sing N N 239 THR CG2 HG22 sing N N 240 THR CG2 HG23 sing N N 241 THR OXT HXT sing N N 242 TRP N CA sing N N 243 TRP N H sing N N 244 TRP N H2 sing N N 245 TRP CA C sing N N 246 TRP CA CB sing N N 247 TRP CA HA sing N N 248 TRP C O doub N N 249 TRP C OXT sing N N 250 TRP CB CG sing N N 251 TRP CB HB2 sing N N 252 TRP CB HB3 sing N N 253 TRP CG CD1 doub Y N 254 TRP CG CD2 sing Y N 255 TRP CD1 NE1 sing Y N 256 TRP CD1 HD1 sing N N 257 TRP CD2 CE2 doub Y N 258 TRP CD2 CE3 sing Y N 259 TRP NE1 CE2 sing Y N 260 TRP NE1 HE1 sing N N 261 TRP CE2 CZ2 sing Y N 262 TRP CE3 CZ3 doub Y N 263 TRP CE3 HE3 sing N N 264 TRP CZ2 CH2 doub Y N 265 TRP CZ2 HZ2 sing N N 266 TRP CZ3 CH2 sing Y N 267 TRP CZ3 HZ3 sing N N 268 TRP CH2 HH2 sing N N 269 TRP OXT HXT sing N N 270 TYR N CA sing N N 271 TYR N H sing N N 272 TYR N H2 sing N N 273 TYR CA C sing N N 274 TYR CA CB sing N N 275 TYR CA HA sing N N 276 TYR C O doub N N 277 TYR C OXT sing N N 278 TYR CB CG sing N N 279 TYR CB HB2 sing N N 280 TYR CB HB3 sing N N 281 TYR CG CD1 doub Y N 282 TYR CG CD2 sing Y N 283 TYR CD1 CE1 sing Y N 284 TYR CD1 HD1 sing N N 285 TYR CD2 CE2 doub Y N 286 TYR CD2 HD2 sing N N 287 TYR CE1 CZ doub Y N 288 TYR CE1 HE1 sing N N 289 TYR CE2 CZ sing Y N 290 TYR CE2 HE2 sing N N 291 TYR CZ OH sing N N 292 TYR OH HH sing N N 293 TYR OXT HXT sing N N 294 VAL N CA sing N N 295 VAL N H sing N N 296 VAL N H2 sing N N 297 VAL CA C sing N N 298 VAL CA CB sing N N 299 VAL CA HA sing N N 300 VAL C O doub N N 301 VAL C OXT sing N N 302 VAL CB CG1 sing N N 303 VAL CB CG2 sing N N 304 VAL CB HB sing N N 305 VAL CG1 HG11 sing N N 306 VAL CG1 HG12 sing N N 307 VAL CG1 HG13 sing N N 308 VAL CG2 HG21 sing N N 309 VAL CG2 HG22 sing N N 310 VAL CG2 HG23 sing N N 311 VAL OXT HXT sing N N 312 # _pdbx_audit_support.funding_organization 'Agence Nationale de la Recherche (ANR)' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ANR-119-CE11-0004-01 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III HD' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7PQW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #