data_7PVP # _entry.id 7PVP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PVP pdb_00007pvp 10.2210/pdb7pvp/pdb WWPDB D_1292118504 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-01-18 2 'Structure model' 1 1 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7PVP _pdbx_database_status.recvd_initial_deposition_date 2021-10-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 arnout.voet@kuleuven.be Arnout Voet 'R. D.' 'principal investigator/group leader' 0000-0002-3329-2703 3 steven.defeyter@kuleuven.be Steven 'De Feyter' E. 'principal investigator/group leader' 0000-0002-0909-9292 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wouters, S.M.L.' 1 0000-0003-2089-7620 'Noguchi, H.' 2 0000-0001-9052-1237 'Velpula, G.' 3 0000-0002-0642-6892 'Clarke, D.E.' 4 0000-0003-0754-8928 'Voet, A.R.D.' 5 0000-0002-3329-2703 'De Feyter, S.' 6 0000-0002-0909-9292 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'SAKe: Computationally Designed Modular Protein Building Blocks for Macromolecular Assemblies' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wouters, S.M.L.' 1 0000-0003-2089-7620 primary 'Clarke, D.E.' 2 0000-0003-0754-8928 primary 'Noguchi, H.' 3 0000-0001-9052-1237 primary 'Velpula, G.' 4 0000-0002-0642-6892 primary 'Voet, A.R.D.' 5 0000-0002-3329-2703 primary 'De Feyter, S.' 6 0000-0002-0909-9292 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man SAKe6BC 30758.781 1 ? ? ? ? 2 water nat water 18.015 95 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMNGHIYAVGGYDGHTHLNSVEAYDPETDEWRLVAPLTTPRSGMGVAVLNGHIYAVGGYDGHTHLNSVEAYDPETDEW RLVAPLTTPRSGMGVAVLNGHIYAVGGYDGHTHLNSVEAYDPETDEWRLVAPLTTPRSGMGVAVLNGHIYAVGGYDGHTH LNSVEAYDPETDEWRLVAPLTTPRSGMGVAVLNGHIYAVGGYDGHTHLNSVEAYDPETDEWRLVAPLTTPRSGMGVAVLN GHIYAVGGYDGHTHLNSVEAYDPETDEWRLVAPLTTPRSGMGVAVL ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMNGHIYAVGGYDGHTHLNSVEAYDPETDEWRLVAPLTTPRSGMGVAVLNGHIYAVGGYDGHTHLNSVEAYDPETDEW RLVAPLTTPRSGMGVAVLNGHIYAVGGYDGHTHLNSVEAYDPETDEWRLVAPLTTPRSGMGVAVLNGHIYAVGGYDGHTH LNSVEAYDPETDEWRLVAPLTTPRSGMGVAVLNGHIYAVGGYDGHTHLNSVEAYDPETDEWRLVAPLTTPRSGMGVAVLN GHIYAVGGYDGHTHLNSVEAYDPETDEWRLVAPLTTPRSGMGVAVL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ASN n 1 6 GLY n 1 7 HIS n 1 8 ILE n 1 9 TYR n 1 10 ALA n 1 11 VAL n 1 12 GLY n 1 13 GLY n 1 14 TYR n 1 15 ASP n 1 16 GLY n 1 17 HIS n 1 18 THR n 1 19 HIS n 1 20 LEU n 1 21 ASN n 1 22 SER n 1 23 VAL n 1 24 GLU n 1 25 ALA n 1 26 TYR n 1 27 ASP n 1 28 PRO n 1 29 GLU n 1 30 THR n 1 31 ASP n 1 32 GLU n 1 33 TRP n 1 34 ARG n 1 35 LEU n 1 36 VAL n 1 37 ALA n 1 38 PRO n 1 39 LEU n 1 40 THR n 1 41 THR n 1 42 PRO n 1 43 ARG n 1 44 SER n 1 45 GLY n 1 46 MET n 1 47 GLY n 1 48 VAL n 1 49 ALA n 1 50 VAL n 1 51 LEU n 1 52 ASN n 1 53 GLY n 1 54 HIS n 1 55 ILE n 1 56 TYR n 1 57 ALA n 1 58 VAL n 1 59 GLY n 1 60 GLY n 1 61 TYR n 1 62 ASP n 1 63 GLY n 1 64 HIS n 1 65 THR n 1 66 HIS n 1 67 LEU n 1 68 ASN n 1 69 SER n 1 70 VAL n 1 71 GLU n 1 72 ALA n 1 73 TYR n 1 74 ASP n 1 75 PRO n 1 76 GLU n 1 77 THR n 1 78 ASP n 1 79 GLU n 1 80 TRP n 1 81 ARG n 1 82 LEU n 1 83 VAL n 1 84 ALA n 1 85 PRO n 1 86 LEU n 1 87 THR n 1 88 THR n 1 89 PRO n 1 90 ARG n 1 91 SER n 1 92 GLY n 1 93 MET n 1 94 GLY n 1 95 VAL n 1 96 ALA n 1 97 VAL n 1 98 LEU n 1 99 ASN n 1 100 GLY n 1 101 HIS n 1 102 ILE n 1 103 TYR n 1 104 ALA n 1 105 VAL n 1 106 GLY n 1 107 GLY n 1 108 TYR n 1 109 ASP n 1 110 GLY n 1 111 HIS n 1 112 THR n 1 113 HIS n 1 114 LEU n 1 115 ASN n 1 116 SER n 1 117 VAL n 1 118 GLU n 1 119 ALA n 1 120 TYR n 1 121 ASP n 1 122 PRO n 1 123 GLU n 1 124 THR n 1 125 ASP n 1 126 GLU n 1 127 TRP n 1 128 ARG n 1 129 LEU n 1 130 VAL n 1 131 ALA n 1 132 PRO n 1 133 LEU n 1 134 THR n 1 135 THR n 1 136 PRO n 1 137 ARG n 1 138 SER n 1 139 GLY n 1 140 MET n 1 141 GLY n 1 142 VAL n 1 143 ALA n 1 144 VAL n 1 145 LEU n 1 146 ASN n 1 147 GLY n 1 148 HIS n 1 149 ILE n 1 150 TYR n 1 151 ALA n 1 152 VAL n 1 153 GLY n 1 154 GLY n 1 155 TYR n 1 156 ASP n 1 157 GLY n 1 158 HIS n 1 159 THR n 1 160 HIS n 1 161 LEU n 1 162 ASN n 1 163 SER n 1 164 VAL n 1 165 GLU n 1 166 ALA n 1 167 TYR n 1 168 ASP n 1 169 PRO n 1 170 GLU n 1 171 THR n 1 172 ASP n 1 173 GLU n 1 174 TRP n 1 175 ARG n 1 176 LEU n 1 177 VAL n 1 178 ALA n 1 179 PRO n 1 180 LEU n 1 181 THR n 1 182 THR n 1 183 PRO n 1 184 ARG n 1 185 SER n 1 186 GLY n 1 187 MET n 1 188 GLY n 1 189 VAL n 1 190 ALA n 1 191 VAL n 1 192 LEU n 1 193 ASN n 1 194 GLY n 1 195 HIS n 1 196 ILE n 1 197 TYR n 1 198 ALA n 1 199 VAL n 1 200 GLY n 1 201 GLY n 1 202 TYR n 1 203 ASP n 1 204 GLY n 1 205 HIS n 1 206 THR n 1 207 HIS n 1 208 LEU n 1 209 ASN n 1 210 SER n 1 211 VAL n 1 212 GLU n 1 213 ALA n 1 214 TYR n 1 215 ASP n 1 216 PRO n 1 217 GLU n 1 218 THR n 1 219 ASP n 1 220 GLU n 1 221 TRP n 1 222 ARG n 1 223 LEU n 1 224 VAL n 1 225 ALA n 1 226 PRO n 1 227 LEU n 1 228 THR n 1 229 THR n 1 230 PRO n 1 231 ARG n 1 232 SER n 1 233 GLY n 1 234 MET n 1 235 GLY n 1 236 VAL n 1 237 ALA n 1 238 VAL n 1 239 LEU n 1 240 ASN n 1 241 GLY n 1 242 HIS n 1 243 ILE n 1 244 TYR n 1 245 ALA n 1 246 VAL n 1 247 GLY n 1 248 GLY n 1 249 TYR n 1 250 ASP n 1 251 GLY n 1 252 HIS n 1 253 THR n 1 254 HIS n 1 255 LEU n 1 256 ASN n 1 257 SER n 1 258 VAL n 1 259 GLU n 1 260 ALA n 1 261 TYR n 1 262 ASP n 1 263 PRO n 1 264 GLU n 1 265 THR n 1 266 ASP n 1 267 GLU n 1 268 TRP n 1 269 ARG n 1 270 LEU n 1 271 VAL n 1 272 ALA n 1 273 PRO n 1 274 LEU n 1 275 THR n 1 276 THR n 1 277 PRO n 1 278 ARG n 1 279 SER n 1 280 GLY n 1 281 MET n 1 282 GLY n 1 283 VAL n 1 284 ALA n 1 285 VAL n 1 286 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 286 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-28a(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 MET 4 4 ? ? ? A . n A 1 5 ASN 5 5 ? ? ? A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 TRP 33 33 33 TRP TRP A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 HIS 111 111 111 HIS HIS A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 TYR 120 120 120 TYR TYR A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 TRP 127 127 127 TRP TRP A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 MET 140 140 140 MET MET A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 HIS 148 148 148 HIS HIS A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 TYR 155 155 155 TYR TYR A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 HIS 158 158 158 HIS HIS A . n A 1 159 THR 159 159 159 THR THR A . n A 1 160 HIS 160 160 160 HIS HIS A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 GLU 165 165 165 GLU GLU A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 TYR 167 167 167 TYR TYR A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 TRP 174 174 174 TRP TRP A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 PRO 179 179 179 PRO PRO A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 SER 185 185 185 SER SER A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 MET 187 187 187 MET MET A . n A 1 188 GLY 188 188 188 GLY GLY A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 ASN 193 193 193 ASN ASN A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 HIS 195 195 195 HIS HIS A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 TYR 197 197 197 TYR TYR A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 GLY 200 200 200 GLY GLY A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 TYR 202 202 202 TYR TYR A . n A 1 203 ASP 203 203 203 ASP ASP A . n A 1 204 GLY 204 204 204 GLY GLY A . n A 1 205 HIS 205 205 205 HIS HIS A . n A 1 206 THR 206 206 206 THR THR A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 ASN 209 209 209 ASN ASN A . n A 1 210 SER 210 210 210 SER SER A . n A 1 211 VAL 211 211 211 VAL VAL A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 ALA 213 213 213 ALA ALA A . n A 1 214 TYR 214 214 214 TYR TYR A . n A 1 215 ASP 215 215 215 ASP ASP A . n A 1 216 PRO 216 216 216 PRO PRO A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 THR 218 218 218 THR THR A . n A 1 219 ASP 219 219 219 ASP ASP A . n A 1 220 GLU 220 220 220 GLU GLU A . n A 1 221 TRP 221 221 221 TRP TRP A . n A 1 222 ARG 222 222 222 ARG ARG A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 VAL 224 224 224 VAL VAL A . n A 1 225 ALA 225 225 225 ALA ALA A . n A 1 226 PRO 226 226 226 PRO PRO A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 THR 228 228 228 THR THR A . n A 1 229 THR 229 229 229 THR THR A . n A 1 230 PRO 230 230 230 PRO PRO A . n A 1 231 ARG 231 231 231 ARG ARG A . n A 1 232 SER 232 232 232 SER SER A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 MET 234 234 234 MET MET A . n A 1 235 GLY 235 235 235 GLY GLY A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 VAL 238 238 238 VAL VAL A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 ASN 240 240 240 ASN ASN A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 HIS 242 242 242 HIS HIS A . n A 1 243 ILE 243 243 243 ILE ILE A . n A 1 244 TYR 244 244 244 TYR TYR A . n A 1 245 ALA 245 245 245 ALA ALA A . n A 1 246 VAL 246 246 246 VAL VAL A . n A 1 247 GLY 247 247 247 GLY GLY A . n A 1 248 GLY 248 248 248 GLY GLY A . n A 1 249 TYR 249 249 249 TYR TYR A . n A 1 250 ASP 250 250 250 ASP ASP A . n A 1 251 GLY 251 251 251 GLY GLY A . n A 1 252 HIS 252 252 252 HIS HIS A . n A 1 253 THR 253 253 253 THR THR A . n A 1 254 HIS 254 254 254 HIS HIS A . n A 1 255 LEU 255 255 255 LEU LEU A . n A 1 256 ASN 256 256 256 ASN ASN A . n A 1 257 SER 257 257 257 SER SER A . n A 1 258 VAL 258 258 258 VAL VAL A . n A 1 259 GLU 259 259 259 GLU GLU A . n A 1 260 ALA 260 260 260 ALA ALA A . n A 1 261 TYR 261 261 261 TYR TYR A . n A 1 262 ASP 262 262 262 ASP ASP A . n A 1 263 PRO 263 263 263 PRO PRO A . n A 1 264 GLU 264 264 264 GLU GLU A . n A 1 265 THR 265 265 265 THR THR A . n A 1 266 ASP 266 266 266 ASP ASP A . n A 1 267 GLU 267 267 267 GLU GLU A . n A 1 268 TRP 268 268 268 TRP TRP A . n A 1 269 ARG 269 269 269 ARG ARG A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 VAL 271 271 271 VAL VAL A . n A 1 272 ALA 272 272 272 ALA ALA A . n A 1 273 PRO 273 273 273 PRO PRO A . n A 1 274 LEU 274 274 274 LEU LEU A . n A 1 275 THR 275 275 275 THR THR A . n A 1 276 THR 276 276 276 THR THR A . n A 1 277 PRO 277 277 277 PRO PRO A . n A 1 278 ARG 278 278 278 ARG ARG A . n A 1 279 SER 279 279 279 SER SER A . n A 1 280 GLY 280 280 280 GLY GLY A . n A 1 281 MET 281 281 281 MET MET A . n A 1 282 GLY 282 282 282 GLY GLY A . n A 1 283 VAL 283 283 283 VAL VAL A . n A 1 284 ALA 284 284 284 ALA ALA A . n A 1 285 VAL 285 285 285 VAL VAL A . n A 1 286 LEU 286 286 286 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 57 HOH HOH A . B 2 HOH 2 302 21 HOH HOH A . B 2 HOH 3 303 31 HOH HOH A . B 2 HOH 4 304 28 HOH HOH A . B 2 HOH 5 305 29 HOH HOH A . B 2 HOH 6 306 34 HOH HOH A . B 2 HOH 7 307 72 HOH HOH A . B 2 HOH 8 308 44 HOH HOH A . B 2 HOH 9 309 46 HOH HOH A . B 2 HOH 10 310 24 HOH HOH A . B 2 HOH 11 311 73 HOH HOH A . B 2 HOH 12 312 56 HOH HOH A . B 2 HOH 13 313 39 HOH HOH A . B 2 HOH 14 314 16 HOH HOH A . B 2 HOH 15 315 27 HOH HOH A . B 2 HOH 16 316 18 HOH HOH A . B 2 HOH 17 317 32 HOH HOH A . B 2 HOH 18 318 33 HOH HOH A . B 2 HOH 19 319 67 HOH HOH A . B 2 HOH 20 320 30 HOH HOH A . B 2 HOH 21 321 22 HOH HOH A . B 2 HOH 22 322 76 HOH HOH A . B 2 HOH 23 323 61 HOH HOH A . B 2 HOH 24 324 52 HOH HOH A . B 2 HOH 25 325 41 HOH HOH A . B 2 HOH 26 326 59 HOH HOH A . B 2 HOH 27 327 53 HOH HOH A . B 2 HOH 28 328 17 HOH HOH A . B 2 HOH 29 329 7 HOH HOH A . B 2 HOH 30 330 48 HOH HOH A . B 2 HOH 31 331 51 HOH HOH A . B 2 HOH 32 332 11 HOH HOH A . B 2 HOH 33 333 90 HOH HOH A . B 2 HOH 34 334 15 HOH HOH A . B 2 HOH 35 335 8 HOH HOH A . B 2 HOH 36 336 9 HOH HOH A . B 2 HOH 37 337 64 HOH HOH A . B 2 HOH 38 338 78 HOH HOH A . B 2 HOH 39 339 4 HOH HOH A . B 2 HOH 40 340 54 HOH HOH A . B 2 HOH 41 341 79 HOH HOH A . B 2 HOH 42 342 60 HOH HOH A . B 2 HOH 43 343 88 HOH HOH A . B 2 HOH 44 344 58 HOH HOH A . B 2 HOH 45 345 75 HOH HOH A . B 2 HOH 46 346 85 HOH HOH A . B 2 HOH 47 347 38 HOH HOH A . B 2 HOH 48 348 63 HOH HOH A . B 2 HOH 49 349 49 HOH HOH A . B 2 HOH 50 350 83 HOH HOH A . B 2 HOH 51 351 45 HOH HOH A . B 2 HOH 52 352 55 HOH HOH A . B 2 HOH 53 353 86 HOH HOH A . B 2 HOH 54 354 23 HOH HOH A . B 2 HOH 55 355 19 HOH HOH A . B 2 HOH 56 356 89 HOH HOH A . B 2 HOH 57 357 36 HOH HOH A . B 2 HOH 58 358 25 HOH HOH A . B 2 HOH 59 359 50 HOH HOH A . B 2 HOH 60 360 43 HOH HOH A . B 2 HOH 61 361 71 HOH HOH A . B 2 HOH 62 362 35 HOH HOH A . B 2 HOH 63 363 69 HOH HOH A . B 2 HOH 64 364 40 HOH HOH A . B 2 HOH 65 365 65 HOH HOH A . B 2 HOH 66 366 5 HOH HOH A . B 2 HOH 67 367 1 HOH HOH A . B 2 HOH 68 368 26 HOH HOH A . B 2 HOH 69 369 42 HOH HOH A . B 2 HOH 70 370 6 HOH HOH A . B 2 HOH 71 371 80 HOH HOH A . B 2 HOH 72 372 91 HOH HOH A . B 2 HOH 73 373 47 HOH HOH A . B 2 HOH 74 374 37 HOH HOH A . B 2 HOH 75 375 10 HOH HOH A . B 2 HOH 76 376 3 HOH HOH A . B 2 HOH 77 377 14 HOH HOH A . B 2 HOH 78 378 77 HOH HOH A . B 2 HOH 79 379 92 HOH HOH A . B 2 HOH 80 380 82 HOH HOH A . B 2 HOH 81 381 2 HOH HOH A . B 2 HOH 82 382 68 HOH HOH A . B 2 HOH 83 383 66 HOH HOH A . B 2 HOH 84 384 81 HOH HOH A . B 2 HOH 85 385 62 HOH HOH A . B 2 HOH 86 386 95 HOH HOH A . B 2 HOH 87 387 96 HOH HOH A . B 2 HOH 88 388 98 HOH HOH A . B 2 HOH 89 389 97 HOH HOH A . B 2 HOH 90 390 12 HOH HOH A . B 2 HOH 91 391 13 HOH HOH A . B 2 HOH 92 392 94 HOH HOH A . B 2 HOH 93 393 99 HOH HOH A . B 2 HOH 94 394 87 HOH HOH A . B 2 HOH 95 395 100 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 29 ? CG ? A GLU 29 CG 2 1 Y 1 A GLU 29 ? CD ? A GLU 29 CD 3 1 Y 1 A GLU 29 ? OE1 ? A GLU 29 OE1 4 1 Y 1 A GLU 29 ? OE2 ? A GLU 29 OE2 5 1 Y 1 A GLU 32 ? CD ? A GLU 32 CD 6 1 Y 1 A GLU 32 ? OE1 ? A GLU 32 OE1 7 1 Y 1 A GLU 32 ? OE2 ? A GLU 32 OE2 8 1 Y 1 A GLU 76 ? CG ? A GLU 76 CG 9 1 Y 1 A GLU 76 ? CD ? A GLU 76 CD 10 1 Y 1 A GLU 76 ? OE1 ? A GLU 76 OE1 11 1 Y 1 A GLU 76 ? OE2 ? A GLU 76 OE2 12 1 Y 1 A GLU 123 ? CG ? A GLU 123 CG 13 1 Y 1 A GLU 123 ? CD ? A GLU 123 CD 14 1 Y 1 A GLU 123 ? OE1 ? A GLU 123 OE1 15 1 Y 1 A GLU 123 ? OE2 ? A GLU 123 OE2 16 1 Y 1 A GLU 170 ? CG ? A GLU 170 CG 17 1 Y 1 A GLU 170 ? CD ? A GLU 170 CD 18 1 Y 1 A GLU 170 ? OE1 ? A GLU 170 OE1 19 1 Y 1 A GLU 170 ? OE2 ? A GLU 170 OE2 20 1 Y 1 A GLU 173 ? CD ? A GLU 173 CD 21 1 Y 1 A GLU 173 ? OE1 ? A GLU 173 OE1 22 1 Y 1 A GLU 173 ? OE2 ? A GLU 173 OE2 23 1 Y 1 A GLU 217 ? CD ? A GLU 217 CD 24 1 Y 1 A GLU 217 ? OE1 ? A GLU 217 OE1 25 1 Y 1 A GLU 217 ? OE2 ? A GLU 217 OE2 26 1 Y 1 A GLU 264 ? CG ? A GLU 264 CG 27 1 Y 1 A GLU 264 ? CD ? A GLU 264 CD 28 1 Y 1 A GLU 264 ? OE1 ? A GLU 264 OE1 29 1 Y 1 A GLU 264 ? OE2 ? A GLU 264 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2-4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.7 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 5 # _cell.angle_alpha 60.060 _cell.angle_alpha_esd ? _cell.angle_beta 89.990 _cell.angle_beta_esd ? _cell.angle_gamma 89.970 _cell.angle_gamma_esd ? _cell.entry_id 7PVP _cell.details ? _cell.formula_units_Z ? _cell.length_a 34.342 _cell.length_a_esd ? _cell.length_b 46.858 _cell.length_b_esd ? _cell.length_c 46.911 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 1 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7PVP _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PVP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.13 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Ammonium phosphate, 0.1 M tris pH 8.5, 50% (v/v) MPD' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-09-25 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.99990 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.99990 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 19.830 _reflns.entry_id 7PVP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.800 _reflns.d_resolution_low 40.650 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22741 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.400 _reflns.pdbx_Rmerge_I_obs 0.074 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 1 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.088 _reflns.pdbx_Rpim_I_all 0.047 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 78435 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.800 1.840 ? ? 4166 ? ? ? 1294 95.600 ? ? ? ? 0.444 ? ? ? ? ? ? ? ? 3.200 ? ? ? 1.800 0.533 0.292 ? 1 1 0.862 ? ? ? ? ? ? ? ? ? ? 9.000 40.650 ? ? 578 ? ? ? 176 95.700 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 3.300 ? ? ? 16.300 0.044 0.024 ? 2 1 0.996 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 50.260 _refine.B_iso_mean 21.8278 _refine.B_iso_min 12.400 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7PVP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8000 _refine.ls_d_res_low 40.6500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22710 _refine.ls_number_reflns_R_free 1197 _refine.ls_number_reflns_R_work 21513 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.8300 _refine.ls_percent_reflns_R_free 5.2700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1747 _refine.ls_R_factor_R_free 0.2144 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1726 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.970 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'Designed model' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.0600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.8000 _refine_hist.d_res_low 40.6500 _refine_hist.number_atoms_solvent 95 _refine_hist.number_atoms_total 2201 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 281 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 29.56 _refine_hist.pdbx_number_atoms_protein 2106 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8000 1.8700 2466 . 123 2343 95.0000 . . . 0.2685 0.0000 0.2036 . . . . . . . 9 . . . 'X-RAY DIFFRACTION' 1.8700 1.9600 2524 . 153 2371 96.0000 . . . 0.2420 0.0000 0.2012 . . . . . . . 9 . . . 'X-RAY DIFFRACTION' 1.9600 2.0600 2451 . 86 2365 96.0000 . . . 0.1988 0.0000 0.1685 . . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.0600 2.1900 2528 . 244 2284 97.0000 . . . 0.1877 0.0000 0.1611 . . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.1900 2.3600 2526 . 151 2375 96.0000 . . . 0.2262 0.0000 0.1582 . . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.3600 2.6000 2574 . 129 2445 97.0000 . . . 0.2760 0.0000 0.1590 . . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.6000 2.9700 2521 . 84 2437 98.0000 . . . 0.2380 0.0000 0.1621 . . . . . . . 9 . . . 'X-RAY DIFFRACTION' 2.9700 3.7400 2525 . 141 2384 98.0000 . . . 0.2215 0.0000 0.1711 . . . . . . . 9 . . . 'X-RAY DIFFRACTION' 3.7400 40.6500 2595 . 86 2509 98.0000 . . . 0.1741 0.0000 0.1805 . . . . . . . 9 . . . # _struct.entry_id 7PVP _struct.title 'Crystal structure of the SAKe6BC designer protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PVP _struct_keywords.text 'beta propeller, synthetic, designer, layer, self-assembly, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7PVP _struct_ref.pdbx_db_accession 7PVP _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7PVP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 286 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7PVP _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 286 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 286 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 10890 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 4 ? AA4 ? 4 ? AA5 ? 4 ? AA6 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 32 ? VAL A 36 ? GLU A 32 VAL A 36 AA1 2 VAL A 23 ? ASP A 27 ? VAL A 23 ASP A 27 AA1 3 HIS A 7 ? VAL A 11 ? HIS A 7 VAL A 11 AA1 4 GLY A 282 ? LEU A 286 ? GLY A 282 LEU A 286 AA2 1 GLY A 47 ? LEU A 51 ? GLY A 47 LEU A 51 AA2 2 HIS A 54 ? TYR A 61 ? HIS A 54 TYR A 61 AA2 3 HIS A 66 ? ASP A 74 ? HIS A 66 ASP A 74 AA2 4 GLU A 79 ? LEU A 82 ? GLU A 79 LEU A 82 AA3 1 GLY A 94 ? LEU A 98 ? GLY A 94 LEU A 98 AA3 2 HIS A 101 ? TYR A 108 ? HIS A 101 TYR A 108 AA3 3 HIS A 113 ? ASP A 121 ? HIS A 113 ASP A 121 AA3 4 GLU A 126 ? LEU A 129 ? GLU A 126 LEU A 129 AA4 1 GLY A 141 ? LEU A 145 ? GLY A 141 LEU A 145 AA4 2 HIS A 148 ? TYR A 155 ? HIS A 148 TYR A 155 AA4 3 HIS A 160 ? ASP A 168 ? HIS A 160 ASP A 168 AA4 4 GLU A 173 ? LEU A 176 ? GLU A 173 LEU A 176 AA5 1 GLY A 188 ? LEU A 192 ? GLY A 188 LEU A 192 AA5 2 HIS A 195 ? VAL A 199 ? HIS A 195 VAL A 199 AA5 3 VAL A 211 ? ASP A 215 ? VAL A 211 ASP A 215 AA5 4 GLU A 220 ? LEU A 223 ? GLU A 220 LEU A 223 AA6 1 GLY A 235 ? LEU A 239 ? GLY A 235 LEU A 239 AA6 2 HIS A 242 ? TYR A 249 ? HIS A 242 TYR A 249 AA6 3 HIS A 254 ? ASP A 262 ? HIS A 254 ASP A 262 AA6 4 GLU A 267 ? LEU A 270 ? GLU A 267 LEU A 270 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ARG A 34 ? O ARG A 34 N ALA A 25 ? N ALA A 25 AA1 2 3 O GLU A 24 ? O GLU A 24 N ALA A 10 ? N ALA A 10 AA1 3 4 N TYR A 9 ? N TYR A 9 O ALA A 284 ? O ALA A 284 AA2 1 2 N ALA A 49 ? N ALA A 49 O TYR A 56 ? O TYR A 56 AA2 2 3 N GLY A 60 ? N GLY A 60 O LEU A 67 ? O LEU A 67 AA2 3 4 N ALA A 72 ? N ALA A 72 O ARG A 81 ? O ARG A 81 AA3 1 2 N ALA A 96 ? N ALA A 96 O TYR A 103 ? O TYR A 103 AA3 2 3 N GLY A 107 ? N GLY A 107 O LEU A 114 ? O LEU A 114 AA3 3 4 N ALA A 119 ? N ALA A 119 O ARG A 128 ? O ARG A 128 AA4 1 2 N ALA A 143 ? N ALA A 143 O TYR A 150 ? O TYR A 150 AA4 2 3 N GLY A 154 ? N GLY A 154 O LEU A 161 ? O LEU A 161 AA4 3 4 N ALA A 166 ? N ALA A 166 O ARG A 175 ? O ARG A 175 AA5 1 2 N ALA A 190 ? N ALA A 190 O TYR A 197 ? O TYR A 197 AA5 2 3 N ILE A 196 ? N ILE A 196 O TYR A 214 ? O TYR A 214 AA5 3 4 N ALA A 213 ? N ALA A 213 O ARG A 222 ? O ARG A 222 AA6 1 2 N GLY A 235 ? N GLY A 235 O VAL A 246 ? O VAL A 246 AA6 2 3 N GLY A 248 ? N GLY A 248 O LEU A 255 ? O LEU A 255 AA6 3 4 N ALA A 260 ? N ALA A 260 O ARG A 269 ? O ARG A 269 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 36 ? ? -120.73 -167.67 2 1 HIS A 64 ? ? -134.50 -32.83 3 1 VAL A 83 ? ? -122.30 -163.27 4 1 VAL A 130 ? ? -119.17 -164.16 5 1 HIS A 158 ? ? -136.11 -30.10 6 1 VAL A 177 ? ? -120.25 -166.28 7 1 HIS A 205 ? ? -134.61 -30.65 8 1 VAL A 224 ? ? -120.86 -165.44 9 1 HIS A 252 ? ? -136.56 -31.63 10 1 VAL A 271 ? ? -119.96 -163.60 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -0.0017 -33.0105 -18.9425 0.1158 ? -0.0062 ? 0.0070 ? 0.1127 ? -0.0023 ? 0.1544 ? 0.8118 ? -0.2452 ? 0.2664 ? 2.4418 ? -0.3910 ? 2.4979 ? -0.0719 ? -0.0243 ? -0.0574 ? -0.1918 ? 0.0375 ? -0.0143 ? 0.2028 ? -0.0519 ? 0.0228 ? 2 'X-RAY DIFFRACTION' ? refined -1.8115 -20.3096 -19.5539 0.1360 ? 0.0097 ? -0.0174 ? 0.1633 ? 0.0002 ? 0.1983 ? 1.0216 ? 0.9095 ? -0.3406 ? 1.6774 ? 0.7778 ? 2.2266 ? -0.0109 ? -0.0453 ? 0.1737 ? -0.0441 ? -0.0639 ? 0.1546 ? -0.0556 ? -0.0293 ? 0.0645 ? 3 'X-RAY DIFFRACTION' ? refined 1.3357 -18.8501 -23.3688 0.1410 ? -0.0071 ? 0.0139 ? 0.1663 ? -0.0038 ? 0.1356 ? 2.0240 ? -0.0783 ? 0.2314 ? 3.2996 ? -0.1179 ? 1.9918 ? -0.0113 ? 0.0134 ? -0.1529 ? -0.2578 ? 0.0285 ? 0.0756 ? 0.0644 ? 0.0209 ? -0.0127 ? 4 'X-RAY DIFFRACTION' ? refined -1.8062 -11.8989 -11.7326 0.1271 ? 0.0184 ? -0.0154 ? 0.1755 ? 0.0012 ? 0.1789 ? 1.5770 ? 1.0184 ? -0.0737 ? 1.9394 ? -0.7451 ? 3.0128 ? -0.0544 ? -0.0450 ? -0.0544 ? 0.0952 ? 0.0221 ? 0.0123 ? -0.1571 ? -0.2414 ? 0.0311 ? 5 'X-RAY DIFFRACTION' ? refined 1.3400 -7.8632 -12.3698 0.1230 ? 0.0013 ? -0.0119 ? 0.1361 ? 0.0110 ? 0.1168 ? 1.8805 ? -0.1779 ? -0.2135 ? 2.5877 ? 0.4155 ? 2.5242 ? 0.0147 ? 0.1143 ? 0.0156 ? -0.1059 ? -0.1048 ? -0.0022 ? -0.2435 ? 0.0125 ? 0.1172 ? 6 'X-RAY DIFFRACTION' ? refined -1.8127 -14.4573 -0.5136 0.1395 ? 0.0197 ? 0.0015 ? 0.1711 ? 0.0019 ? 0.1828 ? 1.7749 ? 0.2977 ? 0.8513 ? 2.4782 ? -0.2240 ? 1.4047 ? -0.0061 ? -0.1018 ? -0.1409 ? 0.0073 ? 0.0182 ? 0.0802 ? -0.0154 ? -0.0813 ? 0.0058 ? 7 'X-RAY DIFFRACTION' ? refined 1.4603 -12.0745 2.6314 0.1365 ? 0.0000 ? -0.0228 ? 0.1228 ? -0.0053 ? 0.1741 ? 1.4217 ? -0.0588 ? -0.2886 ? 2.3296 ? -0.3968 ? 2.7724 ? -0.0140 ? 0.0873 ? 0.1328 ? 0.0755 ? 0.0041 ? -0.0499 ? -0.2737 ? -0.0139 ? 0.0160 ? 8 'X-RAY DIFFRACTION' ? refined -1.8154 -25.4189 2.8828 0.1461 ? 0.0015 ? 0.0042 ? 0.1668 ? -0.0078 ? 0.2090 ? 1.2394 ? -0.5609 ? 0.1949 ? 1.7070 ? 0.4948 ? 2.1902 ? -0.0423 ? 0.0801 ? -0.1238 ? 0.0275 ? -0.0456 ? 0.1540 ? 0.0283 ? -0.0633 ? 0.0901 ? 9 'X-RAY DIFFRACTION' ? refined 1.4036 -26.6052 6.7147 0.1592 ? 0.0109 ? -0.0205 ? 0.1709 ? 0.0022 ? 0.1701 ? 2.4871 ? -0.2706 ? -0.4762 ? 3.1394 ? 0.0551 ? 2.4165 ? -0.0369 ? -0.0978 ? 0.0679 ? 0.2675 ? 0.0546 ? 0.0910 ? -0.0337 ? 0.0198 ? -0.0246 ? 10 'X-RAY DIFFRACTION' ? refined -1.8708 -33.8471 -4.4216 0.1211 ? 0.0122 ? 0.0117 ? 0.1789 ? -0.0016 ? 0.1753 ? 0.4114 ? 0.0499 ? 0.2289 ? 1.6470 ? 0.1785 ? 3.1072 ? -0.0391 ? 0.0897 ? 0.0121 ? -0.0555 ? -0.0203 ? 0.0641 ? 0.0753 ? -0.2367 ? 0.0723 ? 11 'X-RAY DIFFRACTION' ? refined 1.4939 -37.7324 -4.0845 0.1398 ? 0.0303 ? -0.0067 ? 0.1490 ? 0.0150 ? 0.1751 ? 0.9285 ? 0.1198 ? 0.2690 ? 2.0854 ? 0.4545 ? 3.1561 ? -0.0525 ? -0.0863 ? -0.0111 ? 0.1943 ? -0.0324 ? 0.0274 ? 0.2473 ? -0.0815 ? 0.0617 ? 12 'X-RAY DIFFRACTION' ? refined 0.7204 -32.5682 -15.0619 0.1021 ? -0.0044 ? -0.0033 ? 0.1476 ? 0.0087 ? 0.1994 ? 0.3396 ? 0.2517 ? 0.1566 ? 1.4426 ? 0.2456 ? 2.6395 ? -0.1007 ? 0.0342 ? 0.2211 ? -0.0891 ? 0.0750 ? 0.1295 ? -0.0646 ? -0.0307 ? 0.0598 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 6 ? ? ? A 36 ? ? ;chain 'A' and (resid 6 through 36 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 37 ? ? ? A 58 ? ? ;chain 'A' and (resid 37 through 58 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 59 ? ? ? A 83 ? ? ;chain 'A' and (resid 59 through 83 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 84 ? ? ? A 105 ? ? ;chain 'A' and (resid 84 through 105 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 106 ? ? ? A 130 ? ? ;chain 'A' and (resid 106 through 130 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 131 ? ? ? A 152 ? ? ;chain 'A' and (resid 131 through 152 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? A 153 ? ? ? A 177 ? ? ;chain 'A' and (resid 153 through 177 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? A 178 ? ? ? A 199 ? ? ;chain 'A' and (resid 178 through 199 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? A 200 ? ? ? A 223 ? ? ;chain 'A' and (resid 200 through 223 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? A 224 ? ? ? A 246 ? ? ;chain 'A' and (resid 224 through 246 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? A 247 ? ? ? A 270 ? ? ;chain 'A' and (resid 247 through 270 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? A 271 ? ? ? A 286 ? ? ;chain 'A' and (resid 271 through 286 ) ; # _pdbx_phasing_MR.entry_id 7PVP _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 1.750 _pdbx_phasing_MR.d_res_low_rotation 40.610 _pdbx_phasing_MR.d_res_high_translation 1.750 _pdbx_phasing_MR.d_res_low_translation 40.610 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A MET 4 ? A MET 4 5 1 Y 1 A ASN 5 ? A ASN 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLU N N N N 74 GLU CA C N S 75 GLU C C N N 76 GLU O O N N 77 GLU CB C N N 78 GLU CG C N N 79 GLU CD C N N 80 GLU OE1 O N N 81 GLU OE2 O N N 82 GLU OXT O N N 83 GLU H H N N 84 GLU H2 H N N 85 GLU HA H N N 86 GLU HB2 H N N 87 GLU HB3 H N N 88 GLU HG2 H N N 89 GLU HG3 H N N 90 GLU HE2 H N N 91 GLU HXT H N N 92 GLY N N N N 93 GLY CA C N N 94 GLY C C N N 95 GLY O O N N 96 GLY OXT O N N 97 GLY H H N N 98 GLY H2 H N N 99 GLY HA2 H N N 100 GLY HA3 H N N 101 GLY HXT H N N 102 HIS N N N N 103 HIS CA C N S 104 HIS C C N N 105 HIS O O N N 106 HIS CB C N N 107 HIS CG C Y N 108 HIS ND1 N Y N 109 HIS CD2 C Y N 110 HIS CE1 C Y N 111 HIS NE2 N Y N 112 HIS OXT O N N 113 HIS H H N N 114 HIS H2 H N N 115 HIS HA H N N 116 HIS HB2 H N N 117 HIS HB3 H N N 118 HIS HD1 H N N 119 HIS HD2 H N N 120 HIS HE1 H N N 121 HIS HE2 H N N 122 HIS HXT H N N 123 HOH O O N N 124 HOH H1 H N N 125 HOH H2 H N N 126 ILE N N N N 127 ILE CA C N S 128 ILE C C N N 129 ILE O O N N 130 ILE CB C N S 131 ILE CG1 C N N 132 ILE CG2 C N N 133 ILE CD1 C N N 134 ILE OXT O N N 135 ILE H H N N 136 ILE H2 H N N 137 ILE HA H N N 138 ILE HB H N N 139 ILE HG12 H N N 140 ILE HG13 H N N 141 ILE HG21 H N N 142 ILE HG22 H N N 143 ILE HG23 H N N 144 ILE HD11 H N N 145 ILE HD12 H N N 146 ILE HD13 H N N 147 ILE HXT H N N 148 LEU N N N N 149 LEU CA C N S 150 LEU C C N N 151 LEU O O N N 152 LEU CB C N N 153 LEU CG C N N 154 LEU CD1 C N N 155 LEU CD2 C N N 156 LEU OXT O N N 157 LEU H H N N 158 LEU H2 H N N 159 LEU HA H N N 160 LEU HB2 H N N 161 LEU HB3 H N N 162 LEU HG H N N 163 LEU HD11 H N N 164 LEU HD12 H N N 165 LEU HD13 H N N 166 LEU HD21 H N N 167 LEU HD22 H N N 168 LEU HD23 H N N 169 LEU HXT H N N 170 MET N N N N 171 MET CA C N S 172 MET C C N N 173 MET O O N N 174 MET CB C N N 175 MET CG C N N 176 MET SD S N N 177 MET CE C N N 178 MET OXT O N N 179 MET H H N N 180 MET H2 H N N 181 MET HA H N N 182 MET HB2 H N N 183 MET HB3 H N N 184 MET HG2 H N N 185 MET HG3 H N N 186 MET HE1 H N N 187 MET HE2 H N N 188 MET HE3 H N N 189 MET HXT H N N 190 PRO N N N N 191 PRO CA C N S 192 PRO C C N N 193 PRO O O N N 194 PRO CB C N N 195 PRO CG C N N 196 PRO CD C N N 197 PRO OXT O N N 198 PRO H H N N 199 PRO HA H N N 200 PRO HB2 H N N 201 PRO HB3 H N N 202 PRO HG2 H N N 203 PRO HG3 H N N 204 PRO HD2 H N N 205 PRO HD3 H N N 206 PRO HXT H N N 207 SER N N N N 208 SER CA C N S 209 SER C C N N 210 SER O O N N 211 SER CB C N N 212 SER OG O N N 213 SER OXT O N N 214 SER H H N N 215 SER H2 H N N 216 SER HA H N N 217 SER HB2 H N N 218 SER HB3 H N N 219 SER HG H N N 220 SER HXT H N N 221 THR N N N N 222 THR CA C N S 223 THR C C N N 224 THR O O N N 225 THR CB C N R 226 THR OG1 O N N 227 THR CG2 C N N 228 THR OXT O N N 229 THR H H N N 230 THR H2 H N N 231 THR HA H N N 232 THR HB H N N 233 THR HG1 H N N 234 THR HG21 H N N 235 THR HG22 H N N 236 THR HG23 H N N 237 THR HXT H N N 238 TRP N N N N 239 TRP CA C N S 240 TRP C C N N 241 TRP O O N N 242 TRP CB C N N 243 TRP CG C Y N 244 TRP CD1 C Y N 245 TRP CD2 C Y N 246 TRP NE1 N Y N 247 TRP CE2 C Y N 248 TRP CE3 C Y N 249 TRP CZ2 C Y N 250 TRP CZ3 C Y N 251 TRP CH2 C Y N 252 TRP OXT O N N 253 TRP H H N N 254 TRP H2 H N N 255 TRP HA H N N 256 TRP HB2 H N N 257 TRP HB3 H N N 258 TRP HD1 H N N 259 TRP HE1 H N N 260 TRP HE3 H N N 261 TRP HZ2 H N N 262 TRP HZ3 H N N 263 TRP HH2 H N N 264 TRP HXT H N N 265 TYR N N N N 266 TYR CA C N S 267 TYR C C N N 268 TYR O O N N 269 TYR CB C N N 270 TYR CG C Y N 271 TYR CD1 C Y N 272 TYR CD2 C Y N 273 TYR CE1 C Y N 274 TYR CE2 C Y N 275 TYR CZ C Y N 276 TYR OH O N N 277 TYR OXT O N N 278 TYR H H N N 279 TYR H2 H N N 280 TYR HA H N N 281 TYR HB2 H N N 282 TYR HB3 H N N 283 TYR HD1 H N N 284 TYR HD2 H N N 285 TYR HE1 H N N 286 TYR HE2 H N N 287 TYR HH H N N 288 TYR HXT H N N 289 VAL N N N N 290 VAL CA C N S 291 VAL C C N N 292 VAL O O N N 293 VAL CB C N N 294 VAL CG1 C N N 295 VAL CG2 C N N 296 VAL OXT O N N 297 VAL H H N N 298 VAL H2 H N N 299 VAL HA H N N 300 VAL HB H N N 301 VAL HG11 H N N 302 VAL HG12 H N N 303 VAL HG13 H N N 304 VAL HG21 H N N 305 VAL HG22 H N N 306 VAL HG23 H N N 307 VAL HXT H N N 308 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLU N CA sing N N 70 GLU N H sing N N 71 GLU N H2 sing N N 72 GLU CA C sing N N 73 GLU CA CB sing N N 74 GLU CA HA sing N N 75 GLU C O doub N N 76 GLU C OXT sing N N 77 GLU CB CG sing N N 78 GLU CB HB2 sing N N 79 GLU CB HB3 sing N N 80 GLU CG CD sing N N 81 GLU CG HG2 sing N N 82 GLU CG HG3 sing N N 83 GLU CD OE1 doub N N 84 GLU CD OE2 sing N N 85 GLU OE2 HE2 sing N N 86 GLU OXT HXT sing N N 87 GLY N CA sing N N 88 GLY N H sing N N 89 GLY N H2 sing N N 90 GLY CA C sing N N 91 GLY CA HA2 sing N N 92 GLY CA HA3 sing N N 93 GLY C O doub N N 94 GLY C OXT sing N N 95 GLY OXT HXT sing N N 96 HIS N CA sing N N 97 HIS N H sing N N 98 HIS N H2 sing N N 99 HIS CA C sing N N 100 HIS CA CB sing N N 101 HIS CA HA sing N N 102 HIS C O doub N N 103 HIS C OXT sing N N 104 HIS CB CG sing N N 105 HIS CB HB2 sing N N 106 HIS CB HB3 sing N N 107 HIS CG ND1 sing Y N 108 HIS CG CD2 doub Y N 109 HIS ND1 CE1 doub Y N 110 HIS ND1 HD1 sing N N 111 HIS CD2 NE2 sing Y N 112 HIS CD2 HD2 sing N N 113 HIS CE1 NE2 sing Y N 114 HIS CE1 HE1 sing N N 115 HIS NE2 HE2 sing N N 116 HIS OXT HXT sing N N 117 HOH O H1 sing N N 118 HOH O H2 sing N N 119 ILE N CA sing N N 120 ILE N H sing N N 121 ILE N H2 sing N N 122 ILE CA C sing N N 123 ILE CA CB sing N N 124 ILE CA HA sing N N 125 ILE C O doub N N 126 ILE C OXT sing N N 127 ILE CB CG1 sing N N 128 ILE CB CG2 sing N N 129 ILE CB HB sing N N 130 ILE CG1 CD1 sing N N 131 ILE CG1 HG12 sing N N 132 ILE CG1 HG13 sing N N 133 ILE CG2 HG21 sing N N 134 ILE CG2 HG22 sing N N 135 ILE CG2 HG23 sing N N 136 ILE CD1 HD11 sing N N 137 ILE CD1 HD12 sing N N 138 ILE CD1 HD13 sing N N 139 ILE OXT HXT sing N N 140 LEU N CA sing N N 141 LEU N H sing N N 142 LEU N H2 sing N N 143 LEU CA C sing N N 144 LEU CA CB sing N N 145 LEU CA HA sing N N 146 LEU C O doub N N 147 LEU C OXT sing N N 148 LEU CB CG sing N N 149 LEU CB HB2 sing N N 150 LEU CB HB3 sing N N 151 LEU CG CD1 sing N N 152 LEU CG CD2 sing N N 153 LEU CG HG sing N N 154 LEU CD1 HD11 sing N N 155 LEU CD1 HD12 sing N N 156 LEU CD1 HD13 sing N N 157 LEU CD2 HD21 sing N N 158 LEU CD2 HD22 sing N N 159 LEU CD2 HD23 sing N N 160 LEU OXT HXT sing N N 161 MET N CA sing N N 162 MET N H sing N N 163 MET N H2 sing N N 164 MET CA C sing N N 165 MET CA CB sing N N 166 MET CA HA sing N N 167 MET C O doub N N 168 MET C OXT sing N N 169 MET CB CG sing N N 170 MET CB HB2 sing N N 171 MET CB HB3 sing N N 172 MET CG SD sing N N 173 MET CG HG2 sing N N 174 MET CG HG3 sing N N 175 MET SD CE sing N N 176 MET CE HE1 sing N N 177 MET CE HE2 sing N N 178 MET CE HE3 sing N N 179 MET OXT HXT sing N N 180 PRO N CA sing N N 181 PRO N CD sing N N 182 PRO N H sing N N 183 PRO CA C sing N N 184 PRO CA CB sing N N 185 PRO CA HA sing N N 186 PRO C O doub N N 187 PRO C OXT sing N N 188 PRO CB CG sing N N 189 PRO CB HB2 sing N N 190 PRO CB HB3 sing N N 191 PRO CG CD sing N N 192 PRO CG HG2 sing N N 193 PRO CG HG3 sing N N 194 PRO CD HD2 sing N N 195 PRO CD HD3 sing N N 196 PRO OXT HXT sing N N 197 SER N CA sing N N 198 SER N H sing N N 199 SER N H2 sing N N 200 SER CA C sing N N 201 SER CA CB sing N N 202 SER CA HA sing N N 203 SER C O doub N N 204 SER C OXT sing N N 205 SER CB OG sing N N 206 SER CB HB2 sing N N 207 SER CB HB3 sing N N 208 SER OG HG sing N N 209 SER OXT HXT sing N N 210 THR N CA sing N N 211 THR N H sing N N 212 THR N H2 sing N N 213 THR CA C sing N N 214 THR CA CB sing N N 215 THR CA HA sing N N 216 THR C O doub N N 217 THR C OXT sing N N 218 THR CB OG1 sing N N 219 THR CB CG2 sing N N 220 THR CB HB sing N N 221 THR OG1 HG1 sing N N 222 THR CG2 HG21 sing N N 223 THR CG2 HG22 sing N N 224 THR CG2 HG23 sing N N 225 THR OXT HXT sing N N 226 TRP N CA sing N N 227 TRP N H sing N N 228 TRP N H2 sing N N 229 TRP CA C sing N N 230 TRP CA CB sing N N 231 TRP CA HA sing N N 232 TRP C O doub N N 233 TRP C OXT sing N N 234 TRP CB CG sing N N 235 TRP CB HB2 sing N N 236 TRP CB HB3 sing N N 237 TRP CG CD1 doub Y N 238 TRP CG CD2 sing Y N 239 TRP CD1 NE1 sing Y N 240 TRP CD1 HD1 sing N N 241 TRP CD2 CE2 doub Y N 242 TRP CD2 CE3 sing Y N 243 TRP NE1 CE2 sing Y N 244 TRP NE1 HE1 sing N N 245 TRP CE2 CZ2 sing Y N 246 TRP CE3 CZ3 doub Y N 247 TRP CE3 HE3 sing N N 248 TRP CZ2 CH2 doub Y N 249 TRP CZ2 HZ2 sing N N 250 TRP CZ3 CH2 sing Y N 251 TRP CZ3 HZ3 sing N N 252 TRP CH2 HH2 sing N N 253 TRP OXT HXT sing N N 254 TYR N CA sing N N 255 TYR N H sing N N 256 TYR N H2 sing N N 257 TYR CA C sing N N 258 TYR CA CB sing N N 259 TYR CA HA sing N N 260 TYR C O doub N N 261 TYR C OXT sing N N 262 TYR CB CG sing N N 263 TYR CB HB2 sing N N 264 TYR CB HB3 sing N N 265 TYR CG CD1 doub Y N 266 TYR CG CD2 sing Y N 267 TYR CD1 CE1 sing Y N 268 TYR CD1 HD1 sing N N 269 TYR CD2 CE2 doub Y N 270 TYR CD2 HD2 sing N N 271 TYR CE1 CZ doub Y N 272 TYR CE1 HE1 sing N N 273 TYR CE2 CZ sing Y N 274 TYR CE2 HE2 sing N N 275 TYR CZ OH sing N N 276 TYR OH HH sing N N 277 TYR OXT HXT sing N N 278 VAL N CA sing N N 279 VAL N H sing N N 280 VAL N H2 sing N N 281 VAL CA C sing N N 282 VAL CA CB sing N N 283 VAL CA HA sing N N 284 VAL C O doub N N 285 VAL C OXT sing N N 286 VAL CB CG1 sing N N 287 VAL CB CG2 sing N N 288 VAL CB HB sing N N 289 VAL CG1 HG11 sing N N 290 VAL CG1 HG12 sing N N 291 VAL CG1 HG13 sing N N 292 VAL CG2 HG21 sing N N 293 VAL CG2 HG22 sing N N 294 VAL CG2 HG23 sing N N 295 VAL OXT HXT sing N N 296 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Research Foundation - Flanders (FWO)' Belgium 1S89918N 1 'Research Foundation - Flanders (FWO)' Belgium G0F9316N 2 'Research Foundation - Flanders (FWO)' Belgium G051917N 3 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'Designed model' # _atom_sites.entry_id 7PVP _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.029119 _atom_sites.fract_transf_matrix[1][2] -0.000017 _atom_sites.fract_transf_matrix[1][3] 0.000004 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021341 _atom_sites.fract_transf_matrix[2][3] -0.012293 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024601 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_