data_7PX5 # _entry.id 7PX5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7PX5 pdb_00007px5 10.2210/pdb7px5/pdb WWPDB D_1292118584 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-02 2 'Structure model' 1 1 2022-11-23 3 'Structure model' 1 2 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 2 'Structure model' '_citation_author.identifier_ORCID' 12 2 'Structure model' '_citation_author.name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7PX5 _pdbx_database_status.recvd_initial_deposition_date 2021-10-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email martin.noble@ncl.ac.uk _pdbx_contact_author.name_first Martin _pdbx_contact_author.name_last Noble _pdbx_contact_author.name_mi E.N. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3595-9807 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Martin, M.P.' 1 ? 'Noble, M.E.N.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr D Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2059-7983 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 78 _citation.language ? _citation.page_first 1294 _citation.page_last 1302 _citation.title 'Exiting the tunnel of uncertainty: crystal soak to validated hit.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798322009986 _citation.pdbx_database_id_PubMed 36322414 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Martin, M.P.' 1 0000-0003-4810-3351 primary 'Noble, M.E.M.' 2 0000-0002-3595-9807 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ATPase family AAA domain-containing protein 2' 15453.514 1 3.6.1.3 ? ? ? 2 non-polymer syn '1-METHYLQUINOLIN-2(1H)-ONE' 159.185 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 non-polymer syn 1,2-ETHANEDIOL 62.068 3 ? ? ? ? 5 water nat water 18.015 96 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AAA nuclear coregulator cancer-associated protein,ANCCA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _entity_poly.pdbx_seq_one_letter_code_can ;SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _entity_poly.pdbx_strand_id AAA _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-METHYLQUINOLIN-2(1H)-ONE' 12Q 3 'SULFATE ION' SO4 4 1,2-ETHANEDIOL EDO 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 GLN n 1 4 GLU n 1 5 GLU n 1 6 ASP n 1 7 THR n 1 8 PHE n 1 9 ARG n 1 10 GLU n 1 11 LEU n 1 12 ARG n 1 13 ILE n 1 14 PHE n 1 15 LEU n 1 16 ARG n 1 17 ASN n 1 18 VAL n 1 19 THR n 1 20 HIS n 1 21 ARG n 1 22 LEU n 1 23 ALA n 1 24 ILE n 1 25 ASP n 1 26 LYS n 1 27 ARG n 1 28 PHE n 1 29 ARG n 1 30 VAL n 1 31 PHE n 1 32 THR n 1 33 LYS n 1 34 PRO n 1 35 VAL n 1 36 ASP n 1 37 PRO n 1 38 ASP n 1 39 GLU n 1 40 VAL n 1 41 PRO n 1 42 ASP n 1 43 TYR n 1 44 VAL n 1 45 THR n 1 46 VAL n 1 47 ILE n 1 48 LYS n 1 49 GLN n 1 50 PRO n 1 51 MET n 1 52 ASP n 1 53 LEU n 1 54 SER n 1 55 SER n 1 56 VAL n 1 57 ILE n 1 58 SER n 1 59 LYS n 1 60 ILE n 1 61 ASP n 1 62 LEU n 1 63 HIS n 1 64 LYS n 1 65 TYR n 1 66 LEU n 1 67 THR n 1 68 VAL n 1 69 LYS n 1 70 ASP n 1 71 TYR n 1 72 LEU n 1 73 ARG n 1 74 ASP n 1 75 ILE n 1 76 ASP n 1 77 LEU n 1 78 ILE n 1 79 CYS n 1 80 SER n 1 81 ASN n 1 82 ALA n 1 83 LEU n 1 84 GLU n 1 85 TYR n 1 86 ASN n 1 87 PRO n 1 88 ASP n 1 89 ARG n 1 90 ASP n 1 91 PRO n 1 92 GLY n 1 93 ASP n 1 94 ARG n 1 95 LEU n 1 96 ILE n 1 97 ARG n 1 98 HIS n 1 99 ARG n 1 100 ALA n 1 101 CYS n 1 102 ALA n 1 103 LEU n 1 104 ARG n 1 105 ASP n 1 106 THR n 1 107 ALA n 1 108 TYR n 1 109 ALA n 1 110 ILE n 1 111 ILE n 1 112 LYS n 1 113 GLU n 1 114 GLU n 1 115 LEU n 1 116 ASP n 1 117 GLU n 1 118 ASP n 1 119 PHE n 1 120 GLU n 1 121 GLN n 1 122 LEU n 1 123 CYS n 1 124 GLU n 1 125 GLU n 1 126 ILE n 1 127 GLN n 1 128 GLU n 1 129 SER n 1 130 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 130 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ATAD2, L16, PRO2000' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pET28a _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 12Q non-polymer . '1-METHYLQUINOLIN-2(1H)-ONE' 1-METHYL-2-QUINOLONE 'C10 H9 N O' 159.185 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 979 ? ? ? AAA . n A 1 2 MET 2 980 ? ? ? AAA . n A 1 3 GLN 3 981 981 GLN GLN AAA . n A 1 4 GLU 4 982 982 GLU GLU AAA . n A 1 5 GLU 5 983 983 GLU GLU AAA . n A 1 6 ASP 6 984 984 ASP ASP AAA . n A 1 7 THR 7 985 985 THR THR AAA . n A 1 8 PHE 8 986 986 PHE PHE AAA . n A 1 9 ARG 9 987 987 ARG ARG AAA . n A 1 10 GLU 10 988 988 GLU GLU AAA . n A 1 11 LEU 11 989 989 LEU LEU AAA . n A 1 12 ARG 12 990 990 ARG ARG AAA . n A 1 13 ILE 13 991 991 ILE ILE AAA . n A 1 14 PHE 14 992 992 PHE PHE AAA . n A 1 15 LEU 15 993 993 LEU LEU AAA . n A 1 16 ARG 16 994 994 ARG ARG AAA . n A 1 17 ASN 17 995 995 ASN ASN AAA . n A 1 18 VAL 18 996 996 VAL VAL AAA . n A 1 19 THR 19 997 997 THR THR AAA . n A 1 20 HIS 20 998 998 HIS HIS AAA . n A 1 21 ARG 21 999 999 ARG ARG AAA . n A 1 22 LEU 22 1000 1000 LEU LEU AAA . n A 1 23 ALA 23 1001 1001 ALA ALA AAA . n A 1 24 ILE 24 1002 1002 ILE ILE AAA . n A 1 25 ASP 25 1003 1003 ASP ASP AAA . n A 1 26 LYS 26 1004 1004 LYS LYS AAA . n A 1 27 ARG 27 1005 1005 ARG ARG AAA . n A 1 28 PHE 28 1006 1006 PHE PHE AAA . n A 1 29 ARG 29 1007 1007 ARG ARG AAA . n A 1 30 VAL 30 1008 1008 VAL VAL AAA . n A 1 31 PHE 31 1009 1009 PHE PHE AAA . n A 1 32 THR 32 1010 1010 THR THR AAA . n A 1 33 LYS 33 1011 1011 LYS LYS AAA . n A 1 34 PRO 34 1012 1012 PRO PRO AAA . n A 1 35 VAL 35 1013 1013 VAL VAL AAA . n A 1 36 ASP 36 1014 1014 ASP ASP AAA . n A 1 37 PRO 37 1015 1015 PRO PRO AAA . n A 1 38 ASP 38 1016 1016 ASP ASP AAA . n A 1 39 GLU 39 1017 1017 GLU GLU AAA . n A 1 40 VAL 40 1018 1018 VAL VAL AAA . n A 1 41 PRO 41 1019 1019 PRO PRO AAA . n A 1 42 ASP 42 1020 1020 ASP ASP AAA . n A 1 43 TYR 43 1021 1021 TYR TYR AAA . n A 1 44 VAL 44 1022 1022 VAL VAL AAA . n A 1 45 THR 45 1023 1023 THR THR AAA . n A 1 46 VAL 46 1024 1024 VAL VAL AAA . n A 1 47 ILE 47 1025 1025 ILE ILE AAA . n A 1 48 LYS 48 1026 1026 LYS LYS AAA . n A 1 49 GLN 49 1027 1027 GLN GLN AAA . n A 1 50 PRO 50 1028 1028 PRO PRO AAA . n A 1 51 MET 51 1029 1029 MET MET AAA . n A 1 52 ASP 52 1030 1030 ASP ASP AAA . n A 1 53 LEU 53 1031 1031 LEU LEU AAA . n A 1 54 SER 54 1032 1032 SER SER AAA . n A 1 55 SER 55 1033 1033 SER SER AAA . n A 1 56 VAL 56 1034 1034 VAL VAL AAA . n A 1 57 ILE 57 1035 1035 ILE ILE AAA . n A 1 58 SER 58 1036 1036 SER SER AAA . n A 1 59 LYS 59 1037 1037 LYS LYS AAA . n A 1 60 ILE 60 1038 1038 ILE ILE AAA . n A 1 61 ASP 61 1039 1039 ASP ASP AAA . n A 1 62 LEU 62 1040 1040 LEU LEU AAA . n A 1 63 HIS 63 1041 1041 HIS HIS AAA . n A 1 64 LYS 64 1042 1042 LYS LYS AAA . n A 1 65 TYR 65 1043 1043 TYR TYR AAA . n A 1 66 LEU 66 1044 1044 LEU LEU AAA . n A 1 67 THR 67 1045 1045 THR THR AAA . n A 1 68 VAL 68 1046 1046 VAL VAL AAA . n A 1 69 LYS 69 1047 1047 LYS LYS AAA . n A 1 70 ASP 70 1048 1048 ASP ASP AAA . n A 1 71 TYR 71 1049 1049 TYR TYR AAA . n A 1 72 LEU 72 1050 1050 LEU LEU AAA . n A 1 73 ARG 73 1051 1051 ARG ARG AAA . n A 1 74 ASP 74 1052 1052 ASP ASP AAA . n A 1 75 ILE 75 1053 1053 ILE ILE AAA . n A 1 76 ASP 76 1054 1054 ASP ASP AAA . n A 1 77 LEU 77 1055 1055 LEU LEU AAA . n A 1 78 ILE 78 1056 1056 ILE ILE AAA . n A 1 79 CYS 79 1057 1057 CYS CYS AAA . n A 1 80 SER 80 1058 1058 SER SER AAA . n A 1 81 ASN 81 1059 1059 ASN ASN AAA . n A 1 82 ALA 82 1060 1060 ALA ALA AAA . n A 1 83 LEU 83 1061 1061 LEU LEU AAA . n A 1 84 GLU 84 1062 1062 GLU GLU AAA . n A 1 85 TYR 85 1063 1063 TYR TYR AAA . n A 1 86 ASN 86 1064 1064 ASN ASN AAA . n A 1 87 PRO 87 1065 1065 PRO PRO AAA . n A 1 88 ASP 88 1066 1066 ASP ASP AAA . n A 1 89 ARG 89 1067 1067 ARG ARG AAA . n A 1 90 ASP 90 1068 1068 ASP ASP AAA . n A 1 91 PRO 91 1069 1069 PRO PRO AAA . n A 1 92 GLY 92 1070 1070 GLY GLY AAA . n A 1 93 ASP 93 1071 1071 ASP ASP AAA . n A 1 94 ARG 94 1072 1072 ARG ARG AAA . n A 1 95 LEU 95 1073 1073 LEU LEU AAA . n A 1 96 ILE 96 1074 1074 ILE ILE AAA . n A 1 97 ARG 97 1075 1075 ARG ARG AAA . n A 1 98 HIS 98 1076 1076 HIS HIS AAA . n A 1 99 ARG 99 1077 1077 ARG ARG AAA . n A 1 100 ALA 100 1078 1078 ALA ALA AAA . n A 1 101 CYS 101 1079 1079 CYS CYS AAA . n A 1 102 ALA 102 1080 1080 ALA ALA AAA . n A 1 103 LEU 103 1081 1081 LEU LEU AAA . n A 1 104 ARG 104 1082 1082 ARG ARG AAA . n A 1 105 ASP 105 1083 1083 ASP ASP AAA . n A 1 106 THR 106 1084 1084 THR THR AAA . n A 1 107 ALA 107 1085 1085 ALA ALA AAA . n A 1 108 TYR 108 1086 1086 TYR TYR AAA . n A 1 109 ALA 109 1087 1087 ALA ALA AAA . n A 1 110 ILE 110 1088 1088 ILE ILE AAA . n A 1 111 ILE 111 1089 1089 ILE ILE AAA . n A 1 112 LYS 112 1090 1090 LYS LYS AAA . n A 1 113 GLU 113 1091 1091 GLU GLU AAA . n A 1 114 GLU 114 1092 1092 GLU GLU AAA . n A 1 115 LEU 115 1093 1093 LEU LEU AAA . n A 1 116 ASP 116 1094 1094 ASP ASP AAA . n A 1 117 GLU 117 1095 1095 GLU GLU AAA . n A 1 118 ASP 118 1096 1096 ASP ASP AAA . n A 1 119 PHE 119 1097 1097 PHE PHE AAA . n A 1 120 GLU 120 1098 1098 GLU GLU AAA . n A 1 121 GLN 121 1099 1099 GLN GLN AAA . n A 1 122 LEU 122 1100 1100 LEU LEU AAA . n A 1 123 CYS 123 1101 1101 CYS CYS AAA . n A 1 124 GLU 124 1102 1102 GLU GLU AAA . n A 1 125 GLU 125 1103 1103 GLU GLU AAA . n A 1 126 ILE 126 1104 1104 ILE ILE AAA . n A 1 127 GLN 127 1105 1105 GLN GLN AAA . n A 1 128 GLU 128 1106 1106 GLU GLU AAA . n A 1 129 SER 129 1107 1107 SER SER AAA . n A 1 130 ARG 130 1108 1108 ARG ARG AAA . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 12Q 1 1201 1201 12Q DRG AAA . C 3 SO4 1 1202 1 SO4 SO4 AAA . D 4 EDO 1 1203 1 EDO EDO AAA . E 4 EDO 1 1204 2 EDO EDO AAA . F 4 EDO 1 1205 3 EDO EDO AAA . G 5 HOH 1 1301 100 HOH HOH AAA . G 5 HOH 2 1302 92 HOH HOH AAA . G 5 HOH 3 1303 43 HOH HOH AAA . G 5 HOH 4 1304 32 HOH HOH AAA . G 5 HOH 5 1305 52 HOH HOH AAA . G 5 HOH 6 1306 39 HOH HOH AAA . G 5 HOH 7 1307 49 HOH HOH AAA . G 5 HOH 8 1308 54 HOH HOH AAA . G 5 HOH 9 1309 93 HOH HOH AAA . G 5 HOH 10 1310 36 HOH HOH AAA . G 5 HOH 11 1311 13 HOH HOH AAA . G 5 HOH 12 1312 6 HOH HOH AAA . G 5 HOH 13 1313 10 HOH HOH AAA . G 5 HOH 14 1314 24 HOH HOH AAA . G 5 HOH 15 1315 8 HOH HOH AAA . G 5 HOH 16 1316 17 HOH HOH AAA . G 5 HOH 17 1317 87 HOH HOH AAA . G 5 HOH 18 1318 25 HOH HOH AAA . G 5 HOH 19 1319 9 HOH HOH AAA . G 5 HOH 20 1320 20 HOH HOH AAA . G 5 HOH 21 1321 94 HOH HOH AAA . G 5 HOH 22 1322 47 HOH HOH AAA . G 5 HOH 23 1323 51 HOH HOH AAA . G 5 HOH 24 1324 44 HOH HOH AAA . G 5 HOH 25 1325 46 HOH HOH AAA . G 5 HOH 26 1326 27 HOH HOH AAA . G 5 HOH 27 1327 98 HOH HOH AAA . G 5 HOH 28 1328 58 HOH HOH AAA . G 5 HOH 29 1329 82 HOH HOH AAA . G 5 HOH 30 1330 53 HOH HOH AAA . G 5 HOH 31 1331 31 HOH HOH AAA . G 5 HOH 32 1332 41 HOH HOH AAA . G 5 HOH 33 1333 14 HOH HOH AAA . G 5 HOH 34 1334 21 HOH HOH AAA . G 5 HOH 35 1335 37 HOH HOH AAA . G 5 HOH 36 1336 22 HOH HOH AAA . G 5 HOH 37 1337 23 HOH HOH AAA . G 5 HOH 38 1338 1 HOH HOH AAA . G 5 HOH 39 1339 34 HOH HOH AAA . G 5 HOH 40 1340 45 HOH HOH AAA . G 5 HOH 41 1341 19 HOH HOH AAA . G 5 HOH 42 1342 38 HOH HOH AAA . G 5 HOH 43 1343 99 HOH HOH AAA . G 5 HOH 44 1344 4 HOH HOH AAA . G 5 HOH 45 1345 5 HOH HOH AAA . G 5 HOH 46 1346 57 HOH HOH AAA . G 5 HOH 47 1347 16 HOH HOH AAA . G 5 HOH 48 1348 26 HOH HOH AAA . G 5 HOH 49 1349 33 HOH HOH AAA . G 5 HOH 50 1350 42 HOH HOH AAA . G 5 HOH 51 1351 50 HOH HOH AAA . G 5 HOH 52 1352 59 HOH HOH AAA . G 5 HOH 53 1353 48 HOH HOH AAA . G 5 HOH 54 1354 11 HOH HOH AAA . G 5 HOH 55 1355 60 HOH HOH AAA . G 5 HOH 56 1356 7 HOH HOH AAA . G 5 HOH 57 1357 80 HOH HOH AAA . G 5 HOH 58 1358 64 HOH HOH AAA . G 5 HOH 59 1359 3 HOH HOH AAA . G 5 HOH 60 1360 91 HOH HOH AAA . G 5 HOH 61 1361 2 HOH HOH AAA . G 5 HOH 62 1362 29 HOH HOH AAA . G 5 HOH 63 1363 15 HOH HOH AAA . G 5 HOH 64 1364 12 HOH HOH AAA . G 5 HOH 65 1365 40 HOH HOH AAA . G 5 HOH 66 1366 28 HOH HOH AAA . G 5 HOH 67 1367 81 HOH HOH AAA . G 5 HOH 68 1368 69 HOH HOH AAA . G 5 HOH 69 1369 97 HOH HOH AAA . G 5 HOH 70 1370 70 HOH HOH AAA . G 5 HOH 71 1371 68 HOH HOH AAA . G 5 HOH 72 1372 95 HOH HOH AAA . G 5 HOH 73 1373 77 HOH HOH AAA . G 5 HOH 74 1374 18 HOH HOH AAA . G 5 HOH 75 1375 85 HOH HOH AAA . G 5 HOH 76 1376 76 HOH HOH AAA . G 5 HOH 77 1377 71 HOH HOH AAA . G 5 HOH 78 1378 55 HOH HOH AAA . G 5 HOH 79 1379 84 HOH HOH AAA . G 5 HOH 80 1380 96 HOH HOH AAA . G 5 HOH 81 1381 35 HOH HOH AAA . G 5 HOH 82 1382 72 HOH HOH AAA . G 5 HOH 83 1383 78 HOH HOH AAA . G 5 HOH 84 1384 62 HOH HOH AAA . G 5 HOH 85 1385 86 HOH HOH AAA . G 5 HOH 86 1386 61 HOH HOH AAA . G 5 HOH 87 1387 30 HOH HOH AAA . G 5 HOH 88 1388 89 HOH HOH AAA . G 5 HOH 89 1389 63 HOH HOH AAA . G 5 HOH 90 1390 67 HOH HOH AAA . G 5 HOH 91 1391 88 HOH HOH AAA . G 5 HOH 92 1392 56 HOH HOH AAA . G 5 HOH 93 1393 83 HOH HOH AAA . G 5 HOH 94 1394 66 HOH HOH AAA . G 5 HOH 95 1395 79 HOH HOH AAA . G 5 HOH 96 1396 65 HOH HOH AAA . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7PX5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 79.507 _cell.length_a_esd ? _cell.length_b 79.507 _cell.length_b_esd ? _cell.length_c 138.224 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7PX5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7PX5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.08 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 69.86 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M BisTris pH 6-7, 1.7-2.1M Ammonium sulphate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR scanner 300 mm plate' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-08-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54190 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54190 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7PX5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.18 _reflns.d_resolution_low 38.322 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13347 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.4 _reflns.pdbx_Rmerge_I_obs 0.059 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.081 _reflns.pdbx_Rpim_I_all 0.054 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.18 38.29 ? ? ? ? ? ? 13347 95.2 ? ? ? ? 0.016 ? ? ? ? ? ? ? ? 2.2 ? ? ? ? 0.022 0.015 ? 1 1 0.999 ? ? ? ? ? ? ? ? ? ? 2.18 2.25 ? ? ? ? ? ? 1007 83.1 ? ? ? ? 0.386 ? ? ? ? ? ? ? ? 2.0 ? ? ? ? 0.512 0.331 ? 2 1 0.724 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 0.042 _refine.aniso_B[1][2] 0.021 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] 0.042 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] -0.136 _refine.B_iso_max ? _refine.B_iso_mean 32.330 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.939 _refine.correlation_coeff_Fo_to_Fc_free 0.907 _refine.details 'Hydrogens have been used if present in the input file' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7PX5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.180 _refine.ls_d_res_low 38.322 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13335 _refine.ls_number_reflns_R_free 665 _refine.ls_number_reflns_R_work 12670 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.387 _refine.ls_percent_reflns_R_free 4.987 _refine.ls_R_factor_all 0.208 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2461 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2064 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3DAI _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.181 _refine.pdbx_overall_ESU_R_Free 0.171 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 5.151 _refine.overall_SU_ML 0.125 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.180 _refine_hist.d_res_low 38.322 _refine_hist.number_atoms_solvent 96 _refine_hist.number_atoms_total 1194 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1069 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.012 1113 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.769 1.655 1499 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 5.841 5.000 127 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.554 21.216 74 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.251 15.000 204 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.563 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.118 0.200 144 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 842 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.232 0.200 556 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.327 0.200 774 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.185 0.200 88 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.282 0.200 33 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.181 0.200 11 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 2.491 2.932 511 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.530 4.380 637 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 4.348 3.338 602 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 6.529 4.834 862 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 8.245 40.323 1775 ? r_lrange_it ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.180 2.237 . . 38 790 81.0970 . . . 0.303 . 0.259 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.237 2.298 . . 39 930 98.1763 . . . 0.310 . 0.252 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.298 2.365 . . 44 896 98.3264 . . . 0.279 . 0.244 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.365 2.438 . . 40 882 98.0851 . . . 0.277 . 0.247 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.438 2.518 . . 38 857 98.3516 . . . 0.255 . 0.238 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.518 2.606 . . 50 815 97.5197 . . . 0.334 . 0.245 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.606 2.704 . . 48 778 95.1613 . . . 0.234 . 0.221 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.704 2.815 . . 34 735 95.0556 . . . 0.283 . 0.200 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.815 2.940 . . 38 709 93.3750 . . . 0.202 . 0.210 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.940 3.083 . . 35 659 91.7989 . . . 0.248 . 0.241 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.083 3.250 . . 34 644 93.1319 . . . 0.365 . 0.225 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.250 3.447 . . 41 620 94.2939 . . . 0.255 . 0.228 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.447 3.685 . . 35 567 93.1889 . . . 0.230 . 0.203 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.685 3.980 . . 30 566 95.3600 . . . 0.194 . 0.173 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.980 4.359 . . 29 498 95.1264 . . . 0.253 . 0.157 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.359 4.873 . . 31 472 95.6274 . . . 0.221 . 0.147 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.873 5.626 . . 21 424 95.0855 . . . 0.192 . 0.155 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.626 6.888 . . 13 369 94.3210 . . . 0.195 . 0.201 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.888 9.728 . . 20 293 94.8485 . . . 0.184 . 0.171 . . . . . . . . . . . 'X-RAY DIFFRACTION' 9.728 38.322 . . 7 166 81.9905 . . . 0.206 . 0.245 . . . . . . . . . . . # _struct.entry_id 7PX5 _struct.title 'ATAD2 in complex with 1-Methyl-2-quinolone' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7PX5 _struct_keywords.text 'Transcription, Transcription regulation, Activator, Hydrolase, Nucleotide-binding, Fragment binding, inhibitor' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATAD2_HUMAN _struct_ref.pdbx_db_accession Q6PL18 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNA LEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _struct_ref.pdbx_align_begin 981 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7PX5 _struct_ref_seq.pdbx_strand_id AAA _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6PL18 _struct_ref_seq.db_align_beg 981 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 981 _struct_ref_seq.pdbx_auth_seq_align_end 1108 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7PX5 SER AAA 1 ? UNP Q6PL18 ? ? 'expression tag' 979 1 1 7PX5 MET AAA 2 ? UNP Q6PL18 ? ? 'expression tag' 980 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 990 ? 1 MORE -6 ? 1 'SSA (A^2)' 7970 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 3 ? ILE A 24 ? GLN AAA 981 ILE AAA 1002 1 ? 22 HELX_P HELX_P2 AA2 ASP A 25 ? THR A 32 ? ASP AAA 1003 THR AAA 1010 5 ? 8 HELX_P HELX_P3 AA3 ASP A 42 ? ILE A 47 ? ASP AAA 1020 ILE AAA 1025 1 ? 6 HELX_P HELX_P4 AA4 ASP A 52 ? LEU A 62 ? ASP AAA 1030 LEU AAA 1040 1 ? 11 HELX_P HELX_P5 AA5 THR A 67 ? ASN A 86 ? THR AAA 1045 ASN AAA 1064 1 ? 20 HELX_P HELX_P6 AA6 ASP A 90 ? LEU A 115 ? ASP AAA 1068 LEU AAA 1093 1 ? 26 HELX_P HELX_P7 AA7 ASP A 116 ? SER A 129 ? ASP AAA 1094 SER AAA 1107 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id AAA _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 1316 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id G _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_entry_details.entry_id 7PX5 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AAA SER 979 ? A SER 1 2 1 Y 1 AAA MET 980 ? A MET 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 12Q CAH C N N 1 12Q NAC N Y N 2 12Q CAA C Y N 3 12Q CAD C Y N 4 12Q CAI C Y N 5 12Q CAK C Y N 6 12Q CAF C Y N 7 12Q CAB C Y N 8 12Q CAE C Y N 9 12Q CAJ C Y N 10 12Q CAG C Y N 11 12Q OAL O N N 12 12Q HAH1 H N N 13 12Q HAH2 H N N 14 12Q HAH3 H N N 15 12Q HAD H N N 16 12Q HAI H N N 17 12Q HAK H N N 18 12Q HAF H N N 19 12Q HAE H N N 20 12Q HAJ H N N 21 ALA N N N N 22 ALA CA C N S 23 ALA C C N N 24 ALA O O N N 25 ALA CB C N N 26 ALA OXT O N N 27 ALA H H N N 28 ALA H2 H N N 29 ALA HA H N N 30 ALA HB1 H N N 31 ALA HB2 H N N 32 ALA HB3 H N N 33 ALA HXT H N N 34 ARG N N N N 35 ARG CA C N S 36 ARG C C N N 37 ARG O O N N 38 ARG CB C N N 39 ARG CG C N N 40 ARG CD C N N 41 ARG NE N N N 42 ARG CZ C N N 43 ARG NH1 N N N 44 ARG NH2 N N N 45 ARG OXT O N N 46 ARG H H N N 47 ARG H2 H N N 48 ARG HA H N N 49 ARG HB2 H N N 50 ARG HB3 H N N 51 ARG HG2 H N N 52 ARG HG3 H N N 53 ARG HD2 H N N 54 ARG HD3 H N N 55 ARG HE H N N 56 ARG HH11 H N N 57 ARG HH12 H N N 58 ARG HH21 H N N 59 ARG HH22 H N N 60 ARG HXT H N N 61 ASN N N N N 62 ASN CA C N S 63 ASN C C N N 64 ASN O O N N 65 ASN CB C N N 66 ASN CG C N N 67 ASN OD1 O N N 68 ASN ND2 N N N 69 ASN OXT O N N 70 ASN H H N N 71 ASN H2 H N N 72 ASN HA H N N 73 ASN HB2 H N N 74 ASN HB3 H N N 75 ASN HD21 H N N 76 ASN HD22 H N N 77 ASN HXT H N N 78 ASP N N N N 79 ASP CA C N S 80 ASP C C N N 81 ASP O O N N 82 ASP CB C N N 83 ASP CG C N N 84 ASP OD1 O N N 85 ASP OD2 O N N 86 ASP OXT O N N 87 ASP H H N N 88 ASP H2 H N N 89 ASP HA H N N 90 ASP HB2 H N N 91 ASP HB3 H N N 92 ASP HD2 H N N 93 ASP HXT H N N 94 CYS N N N N 95 CYS CA C N R 96 CYS C C N N 97 CYS O O N N 98 CYS CB C N N 99 CYS SG S N N 100 CYS OXT O N N 101 CYS H H N N 102 CYS H2 H N N 103 CYS HA H N N 104 CYS HB2 H N N 105 CYS HB3 H N N 106 CYS HG H N N 107 CYS HXT H N N 108 EDO C1 C N N 109 EDO O1 O N N 110 EDO C2 C N N 111 EDO O2 O N N 112 EDO H11 H N N 113 EDO H12 H N N 114 EDO HO1 H N N 115 EDO H21 H N N 116 EDO H22 H N N 117 EDO HO2 H N N 118 GLN N N N N 119 GLN CA C N S 120 GLN C C N N 121 GLN O O N N 122 GLN CB C N N 123 GLN CG C N N 124 GLN CD C N N 125 GLN OE1 O N N 126 GLN NE2 N N N 127 GLN OXT O N N 128 GLN H H N N 129 GLN H2 H N N 130 GLN HA H N N 131 GLN HB2 H N N 132 GLN HB3 H N N 133 GLN HG2 H N N 134 GLN HG3 H N N 135 GLN HE21 H N N 136 GLN HE22 H N N 137 GLN HXT H N N 138 GLU N N N N 139 GLU CA C N S 140 GLU C C N N 141 GLU O O N N 142 GLU CB C N N 143 GLU CG C N N 144 GLU CD C N N 145 GLU OE1 O N N 146 GLU OE2 O N N 147 GLU OXT O N N 148 GLU H H N N 149 GLU H2 H N N 150 GLU HA H N N 151 GLU HB2 H N N 152 GLU HB3 H N N 153 GLU HG2 H N N 154 GLU HG3 H N N 155 GLU HE2 H N N 156 GLU HXT H N N 157 GLY N N N N 158 GLY CA C N N 159 GLY C C N N 160 GLY O O N N 161 GLY OXT O N N 162 GLY H H N N 163 GLY H2 H N N 164 GLY HA2 H N N 165 GLY HA3 H N N 166 GLY HXT H N N 167 HIS N N N N 168 HIS CA C N S 169 HIS C C N N 170 HIS O O N N 171 HIS CB C N N 172 HIS CG C Y N 173 HIS ND1 N Y N 174 HIS CD2 C Y N 175 HIS CE1 C Y N 176 HIS NE2 N Y N 177 HIS OXT O N N 178 HIS H H N N 179 HIS H2 H N N 180 HIS HA H N N 181 HIS HB2 H N N 182 HIS HB3 H N N 183 HIS HD1 H N N 184 HIS HD2 H N N 185 HIS HE1 H N N 186 HIS HE2 H N N 187 HIS HXT H N N 188 HOH O O N N 189 HOH H1 H N N 190 HOH H2 H N N 191 ILE N N N N 192 ILE CA C N S 193 ILE C C N N 194 ILE O O N N 195 ILE CB C N S 196 ILE CG1 C N N 197 ILE CG2 C N N 198 ILE CD1 C N N 199 ILE OXT O N N 200 ILE H H N N 201 ILE H2 H N N 202 ILE HA H N N 203 ILE HB H N N 204 ILE HG12 H N N 205 ILE HG13 H N N 206 ILE HG21 H N N 207 ILE HG22 H N N 208 ILE HG23 H N N 209 ILE HD11 H N N 210 ILE HD12 H N N 211 ILE HD13 H N N 212 ILE HXT H N N 213 LEU N N N N 214 LEU CA C N S 215 LEU C C N N 216 LEU O O N N 217 LEU CB C N N 218 LEU CG C N N 219 LEU CD1 C N N 220 LEU CD2 C N N 221 LEU OXT O N N 222 LEU H H N N 223 LEU H2 H N N 224 LEU HA H N N 225 LEU HB2 H N N 226 LEU HB3 H N N 227 LEU HG H N N 228 LEU HD11 H N N 229 LEU HD12 H N N 230 LEU HD13 H N N 231 LEU HD21 H N N 232 LEU HD22 H N N 233 LEU HD23 H N N 234 LEU HXT H N N 235 LYS N N N N 236 LYS CA C N S 237 LYS C C N N 238 LYS O O N N 239 LYS CB C N N 240 LYS CG C N N 241 LYS CD C N N 242 LYS CE C N N 243 LYS NZ N N N 244 LYS OXT O N N 245 LYS H H N N 246 LYS H2 H N N 247 LYS HA H N N 248 LYS HB2 H N N 249 LYS HB3 H N N 250 LYS HG2 H N N 251 LYS HG3 H N N 252 LYS HD2 H N N 253 LYS HD3 H N N 254 LYS HE2 H N N 255 LYS HE3 H N N 256 LYS HZ1 H N N 257 LYS HZ2 H N N 258 LYS HZ3 H N N 259 LYS HXT H N N 260 MET N N N N 261 MET CA C N S 262 MET C C N N 263 MET O O N N 264 MET CB C N N 265 MET CG C N N 266 MET SD S N N 267 MET CE C N N 268 MET OXT O N N 269 MET H H N N 270 MET H2 H N N 271 MET HA H N N 272 MET HB2 H N N 273 MET HB3 H N N 274 MET HG2 H N N 275 MET HG3 H N N 276 MET HE1 H N N 277 MET HE2 H N N 278 MET HE3 H N N 279 MET HXT H N N 280 PHE N N N N 281 PHE CA C N S 282 PHE C C N N 283 PHE O O N N 284 PHE CB C N N 285 PHE CG C Y N 286 PHE CD1 C Y N 287 PHE CD2 C Y N 288 PHE CE1 C Y N 289 PHE CE2 C Y N 290 PHE CZ C Y N 291 PHE OXT O N N 292 PHE H H N N 293 PHE H2 H N N 294 PHE HA H N N 295 PHE HB2 H N N 296 PHE HB3 H N N 297 PHE HD1 H N N 298 PHE HD2 H N N 299 PHE HE1 H N N 300 PHE HE2 H N N 301 PHE HZ H N N 302 PHE HXT H N N 303 PRO N N N N 304 PRO CA C N S 305 PRO C C N N 306 PRO O O N N 307 PRO CB C N N 308 PRO CG C N N 309 PRO CD C N N 310 PRO OXT O N N 311 PRO H H N N 312 PRO HA H N N 313 PRO HB2 H N N 314 PRO HB3 H N N 315 PRO HG2 H N N 316 PRO HG3 H N N 317 PRO HD2 H N N 318 PRO HD3 H N N 319 PRO HXT H N N 320 SER N N N N 321 SER CA C N S 322 SER C C N N 323 SER O O N N 324 SER CB C N N 325 SER OG O N N 326 SER OXT O N N 327 SER H H N N 328 SER H2 H N N 329 SER HA H N N 330 SER HB2 H N N 331 SER HB3 H N N 332 SER HG H N N 333 SER HXT H N N 334 SO4 S S N N 335 SO4 O1 O N N 336 SO4 O2 O N N 337 SO4 O3 O N N 338 SO4 O4 O N N 339 THR N N N N 340 THR CA C N S 341 THR C C N N 342 THR O O N N 343 THR CB C N R 344 THR OG1 O N N 345 THR CG2 C N N 346 THR OXT O N N 347 THR H H N N 348 THR H2 H N N 349 THR HA H N N 350 THR HB H N N 351 THR HG1 H N N 352 THR HG21 H N N 353 THR HG22 H N N 354 THR HG23 H N N 355 THR HXT H N N 356 TYR N N N N 357 TYR CA C N S 358 TYR C C N N 359 TYR O O N N 360 TYR CB C N N 361 TYR CG C Y N 362 TYR CD1 C Y N 363 TYR CD2 C Y N 364 TYR CE1 C Y N 365 TYR CE2 C Y N 366 TYR CZ C Y N 367 TYR OH O N N 368 TYR OXT O N N 369 TYR H H N N 370 TYR H2 H N N 371 TYR HA H N N 372 TYR HB2 H N N 373 TYR HB3 H N N 374 TYR HD1 H N N 375 TYR HD2 H N N 376 TYR HE1 H N N 377 TYR HE2 H N N 378 TYR HH H N N 379 TYR HXT H N N 380 VAL N N N N 381 VAL CA C N S 382 VAL C C N N 383 VAL O O N N 384 VAL CB C N N 385 VAL CG1 C N N 386 VAL CG2 C N N 387 VAL OXT O N N 388 VAL H H N N 389 VAL H2 H N N 390 VAL HA H N N 391 VAL HB H N N 392 VAL HG11 H N N 393 VAL HG12 H N N 394 VAL HG13 H N N 395 VAL HG21 H N N 396 VAL HG22 H N N 397 VAL HG23 H N N 398 VAL HXT H N N 399 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 12Q CAH NAC sing N N 1 12Q CAH HAH1 sing N N 2 12Q CAH HAH2 sing N N 3 12Q CAH HAH3 sing N N 4 12Q NAC CAA sing Y N 5 12Q NAC CAG sing Y N 6 12Q CAA CAD sing Y N 7 12Q CAA CAB doub Y N 8 12Q CAD CAI doub Y N 9 12Q CAD HAD sing N N 10 12Q CAI CAK sing Y N 11 12Q CAI HAI sing N N 12 12Q CAK CAF doub Y N 13 12Q CAK HAK sing N N 14 12Q CAF CAB sing Y N 15 12Q CAF HAF sing N N 16 12Q CAB CAE sing Y N 17 12Q CAE CAJ doub Y N 18 12Q CAE HAE sing N N 19 12Q CAJ CAG sing Y N 20 12Q CAJ HAJ sing N N 21 12Q CAG OAL doub N N 22 ALA N CA sing N N 23 ALA N H sing N N 24 ALA N H2 sing N N 25 ALA CA C sing N N 26 ALA CA CB sing N N 27 ALA CA HA sing N N 28 ALA C O doub N N 29 ALA C OXT sing N N 30 ALA CB HB1 sing N N 31 ALA CB HB2 sing N N 32 ALA CB HB3 sing N N 33 ALA OXT HXT sing N N 34 ARG N CA sing N N 35 ARG N H sing N N 36 ARG N H2 sing N N 37 ARG CA C sing N N 38 ARG CA CB sing N N 39 ARG CA HA sing N N 40 ARG C O doub N N 41 ARG C OXT sing N N 42 ARG CB CG sing N N 43 ARG CB HB2 sing N N 44 ARG CB HB3 sing N N 45 ARG CG CD sing N N 46 ARG CG HG2 sing N N 47 ARG CG HG3 sing N N 48 ARG CD NE sing N N 49 ARG CD HD2 sing N N 50 ARG CD HD3 sing N N 51 ARG NE CZ sing N N 52 ARG NE HE sing N N 53 ARG CZ NH1 sing N N 54 ARG CZ NH2 doub N N 55 ARG NH1 HH11 sing N N 56 ARG NH1 HH12 sing N N 57 ARG NH2 HH21 sing N N 58 ARG NH2 HH22 sing N N 59 ARG OXT HXT sing N N 60 ASN N CA sing N N 61 ASN N H sing N N 62 ASN N H2 sing N N 63 ASN CA C sing N N 64 ASN CA CB sing N N 65 ASN CA HA sing N N 66 ASN C O doub N N 67 ASN C OXT sing N N 68 ASN CB CG sing N N 69 ASN CB HB2 sing N N 70 ASN CB HB3 sing N N 71 ASN CG OD1 doub N N 72 ASN CG ND2 sing N N 73 ASN ND2 HD21 sing N N 74 ASN ND2 HD22 sing N N 75 ASN OXT HXT sing N N 76 ASP N CA sing N N 77 ASP N H sing N N 78 ASP N H2 sing N N 79 ASP CA C sing N N 80 ASP CA CB sing N N 81 ASP CA HA sing N N 82 ASP C O doub N N 83 ASP C OXT sing N N 84 ASP CB CG sing N N 85 ASP CB HB2 sing N N 86 ASP CB HB3 sing N N 87 ASP CG OD1 doub N N 88 ASP CG OD2 sing N N 89 ASP OD2 HD2 sing N N 90 ASP OXT HXT sing N N 91 CYS N CA sing N N 92 CYS N H sing N N 93 CYS N H2 sing N N 94 CYS CA C sing N N 95 CYS CA CB sing N N 96 CYS CA HA sing N N 97 CYS C O doub N N 98 CYS C OXT sing N N 99 CYS CB SG sing N N 100 CYS CB HB2 sing N N 101 CYS CB HB3 sing N N 102 CYS SG HG sing N N 103 CYS OXT HXT sing N N 104 EDO C1 O1 sing N N 105 EDO C1 C2 sing N N 106 EDO C1 H11 sing N N 107 EDO C1 H12 sing N N 108 EDO O1 HO1 sing N N 109 EDO C2 O2 sing N N 110 EDO C2 H21 sing N N 111 EDO C2 H22 sing N N 112 EDO O2 HO2 sing N N 113 GLN N CA sing N N 114 GLN N H sing N N 115 GLN N H2 sing N N 116 GLN CA C sing N N 117 GLN CA CB sing N N 118 GLN CA HA sing N N 119 GLN C O doub N N 120 GLN C OXT sing N N 121 GLN CB CG sing N N 122 GLN CB HB2 sing N N 123 GLN CB HB3 sing N N 124 GLN CG CD sing N N 125 GLN CG HG2 sing N N 126 GLN CG HG3 sing N N 127 GLN CD OE1 doub N N 128 GLN CD NE2 sing N N 129 GLN NE2 HE21 sing N N 130 GLN NE2 HE22 sing N N 131 GLN OXT HXT sing N N 132 GLU N CA sing N N 133 GLU N H sing N N 134 GLU N H2 sing N N 135 GLU CA C sing N N 136 GLU CA CB sing N N 137 GLU CA HA sing N N 138 GLU C O doub N N 139 GLU C OXT sing N N 140 GLU CB CG sing N N 141 GLU CB HB2 sing N N 142 GLU CB HB3 sing N N 143 GLU CG CD sing N N 144 GLU CG HG2 sing N N 145 GLU CG HG3 sing N N 146 GLU CD OE1 doub N N 147 GLU CD OE2 sing N N 148 GLU OE2 HE2 sing N N 149 GLU OXT HXT sing N N 150 GLY N CA sing N N 151 GLY N H sing N N 152 GLY N H2 sing N N 153 GLY CA C sing N N 154 GLY CA HA2 sing N N 155 GLY CA HA3 sing N N 156 GLY C O doub N N 157 GLY C OXT sing N N 158 GLY OXT HXT sing N N 159 HIS N CA sing N N 160 HIS N H sing N N 161 HIS N H2 sing N N 162 HIS CA C sing N N 163 HIS CA CB sing N N 164 HIS CA HA sing N N 165 HIS C O doub N N 166 HIS C OXT sing N N 167 HIS CB CG sing N N 168 HIS CB HB2 sing N N 169 HIS CB HB3 sing N N 170 HIS CG ND1 sing Y N 171 HIS CG CD2 doub Y N 172 HIS ND1 CE1 doub Y N 173 HIS ND1 HD1 sing N N 174 HIS CD2 NE2 sing Y N 175 HIS CD2 HD2 sing N N 176 HIS CE1 NE2 sing Y N 177 HIS CE1 HE1 sing N N 178 HIS NE2 HE2 sing N N 179 HIS OXT HXT sing N N 180 HOH O H1 sing N N 181 HOH O H2 sing N N 182 ILE N CA sing N N 183 ILE N H sing N N 184 ILE N H2 sing N N 185 ILE CA C sing N N 186 ILE CA CB sing N N 187 ILE CA HA sing N N 188 ILE C O doub N N 189 ILE C OXT sing N N 190 ILE CB CG1 sing N N 191 ILE CB CG2 sing N N 192 ILE CB HB sing N N 193 ILE CG1 CD1 sing N N 194 ILE CG1 HG12 sing N N 195 ILE CG1 HG13 sing N N 196 ILE CG2 HG21 sing N N 197 ILE CG2 HG22 sing N N 198 ILE CG2 HG23 sing N N 199 ILE CD1 HD11 sing N N 200 ILE CD1 HD12 sing N N 201 ILE CD1 HD13 sing N N 202 ILE OXT HXT sing N N 203 LEU N CA sing N N 204 LEU N H sing N N 205 LEU N H2 sing N N 206 LEU CA C sing N N 207 LEU CA CB sing N N 208 LEU CA HA sing N N 209 LEU C O doub N N 210 LEU C OXT sing N N 211 LEU CB CG sing N N 212 LEU CB HB2 sing N N 213 LEU CB HB3 sing N N 214 LEU CG CD1 sing N N 215 LEU CG CD2 sing N N 216 LEU CG HG sing N N 217 LEU CD1 HD11 sing N N 218 LEU CD1 HD12 sing N N 219 LEU CD1 HD13 sing N N 220 LEU CD2 HD21 sing N N 221 LEU CD2 HD22 sing N N 222 LEU CD2 HD23 sing N N 223 LEU OXT HXT sing N N 224 LYS N CA sing N N 225 LYS N H sing N N 226 LYS N H2 sing N N 227 LYS CA C sing N N 228 LYS CA CB sing N N 229 LYS CA HA sing N N 230 LYS C O doub N N 231 LYS C OXT sing N N 232 LYS CB CG sing N N 233 LYS CB HB2 sing N N 234 LYS CB HB3 sing N N 235 LYS CG CD sing N N 236 LYS CG HG2 sing N N 237 LYS CG HG3 sing N N 238 LYS CD CE sing N N 239 LYS CD HD2 sing N N 240 LYS CD HD3 sing N N 241 LYS CE NZ sing N N 242 LYS CE HE2 sing N N 243 LYS CE HE3 sing N N 244 LYS NZ HZ1 sing N N 245 LYS NZ HZ2 sing N N 246 LYS NZ HZ3 sing N N 247 LYS OXT HXT sing N N 248 MET N CA sing N N 249 MET N H sing N N 250 MET N H2 sing N N 251 MET CA C sing N N 252 MET CA CB sing N N 253 MET CA HA sing N N 254 MET C O doub N N 255 MET C OXT sing N N 256 MET CB CG sing N N 257 MET CB HB2 sing N N 258 MET CB HB3 sing N N 259 MET CG SD sing N N 260 MET CG HG2 sing N N 261 MET CG HG3 sing N N 262 MET SD CE sing N N 263 MET CE HE1 sing N N 264 MET CE HE2 sing N N 265 MET CE HE3 sing N N 266 MET OXT HXT sing N N 267 PHE N CA sing N N 268 PHE N H sing N N 269 PHE N H2 sing N N 270 PHE CA C sing N N 271 PHE CA CB sing N N 272 PHE CA HA sing N N 273 PHE C O doub N N 274 PHE C OXT sing N N 275 PHE CB CG sing N N 276 PHE CB HB2 sing N N 277 PHE CB HB3 sing N N 278 PHE CG CD1 doub Y N 279 PHE CG CD2 sing Y N 280 PHE CD1 CE1 sing Y N 281 PHE CD1 HD1 sing N N 282 PHE CD2 CE2 doub Y N 283 PHE CD2 HD2 sing N N 284 PHE CE1 CZ doub Y N 285 PHE CE1 HE1 sing N N 286 PHE CE2 CZ sing Y N 287 PHE CE2 HE2 sing N N 288 PHE CZ HZ sing N N 289 PHE OXT HXT sing N N 290 PRO N CA sing N N 291 PRO N CD sing N N 292 PRO N H sing N N 293 PRO CA C sing N N 294 PRO CA CB sing N N 295 PRO CA HA sing N N 296 PRO C O doub N N 297 PRO C OXT sing N N 298 PRO CB CG sing N N 299 PRO CB HB2 sing N N 300 PRO CB HB3 sing N N 301 PRO CG CD sing N N 302 PRO CG HG2 sing N N 303 PRO CG HG3 sing N N 304 PRO CD HD2 sing N N 305 PRO CD HD3 sing N N 306 PRO OXT HXT sing N N 307 SER N CA sing N N 308 SER N H sing N N 309 SER N H2 sing N N 310 SER CA C sing N N 311 SER CA CB sing N N 312 SER CA HA sing N N 313 SER C O doub N N 314 SER C OXT sing N N 315 SER CB OG sing N N 316 SER CB HB2 sing N N 317 SER CB HB3 sing N N 318 SER OG HG sing N N 319 SER OXT HXT sing N N 320 SO4 S O1 doub N N 321 SO4 S O2 doub N N 322 SO4 S O3 sing N N 323 SO4 S O4 sing N N 324 THR N CA sing N N 325 THR N H sing N N 326 THR N H2 sing N N 327 THR CA C sing N N 328 THR CA CB sing N N 329 THR CA HA sing N N 330 THR C O doub N N 331 THR C OXT sing N N 332 THR CB OG1 sing N N 333 THR CB CG2 sing N N 334 THR CB HB sing N N 335 THR OG1 HG1 sing N N 336 THR CG2 HG21 sing N N 337 THR CG2 HG22 sing N N 338 THR CG2 HG23 sing N N 339 THR OXT HXT sing N N 340 TYR N CA sing N N 341 TYR N H sing N N 342 TYR N H2 sing N N 343 TYR CA C sing N N 344 TYR CA CB sing N N 345 TYR CA HA sing N N 346 TYR C O doub N N 347 TYR C OXT sing N N 348 TYR CB CG sing N N 349 TYR CB HB2 sing N N 350 TYR CB HB3 sing N N 351 TYR CG CD1 doub Y N 352 TYR CG CD2 sing Y N 353 TYR CD1 CE1 sing Y N 354 TYR CD1 HD1 sing N N 355 TYR CD2 CE2 doub Y N 356 TYR CD2 HD2 sing N N 357 TYR CE1 CZ doub Y N 358 TYR CE1 HE1 sing N N 359 TYR CE2 CZ sing Y N 360 TYR CE2 HE2 sing N N 361 TYR CZ OH sing N N 362 TYR OH HH sing N N 363 TYR OXT HXT sing N N 364 VAL N CA sing N N 365 VAL N H sing N N 366 VAL N H2 sing N N 367 VAL CA C sing N N 368 VAL CA CB sing N N 369 VAL CA HA sing N N 370 VAL C O doub N N 371 VAL C OXT sing N N 372 VAL CB CG1 sing N N 373 VAL CB CG2 sing N N 374 VAL CB HB sing N N 375 VAL CG1 HG11 sing N N 376 VAL CG1 HG12 sing N N 377 VAL CG1 HG13 sing N N 378 VAL CG2 HG21 sing N N 379 VAL CG2 HG22 sing N N 380 VAL CG2 HG23 sing N N 381 VAL OXT HXT sing N N 382 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Medical Research Council (MRC, United Kingdom)' 'United Kingdom' MR/N009738/1 1 'Cancer Research UK' 'United Kingdom' C2215/A21421 2 'Cancer Research UK' 'United Kingdom' C57659/A27310 3 'Cancer Research UK' 'United Kingdom' C1362/A20263 4 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 12Q _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 12Q _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3DAI _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7PX5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012578 _atom_sites.fract_transf_matrix[1][2] 0.007262 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014523 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007235 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 # loop_