data_7Q3B # _entry.id 7Q3B # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.385 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7Q3B pdb_00007q3b 10.2210/pdb7q3b/pdb WWPDB D_1292118842 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-15 2 'Structure model' 1 1 2022-06-22 3 'Structure model' 1 2 2022-08-17 4 'Structure model' 1 3 2023-05-31 5 'Structure model' 1 4 2024-02-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Source and taxonomy' 5 4 'Structure model' 'Structure summary' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' entity 5 4 'Structure model' entity_name_com 6 4 'Structure model' entity_src_gen 7 4 'Structure model' struct_ref 8 4 'Structure model' struct_ref_seq 9 4 'Structure model' struct_ref_seq_dif 10 5 'Structure model' chem_comp_atom 11 5 'Structure model' chem_comp_bond 12 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 4 'Structure model' '_entity.pdbx_description' 13 4 'Structure model' '_entity_src_gen.gene_src_common_name' 14 4 'Structure model' '_entity_src_gen.pdbx_gene_src_gene' 15 4 'Structure model' '_struct_ref.db_code' 16 4 'Structure model' '_struct_ref.pdbx_db_accession' 17 4 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 18 4 'Structure model' '_struct_ref_seq.pdbx_db_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7Q3B _pdbx_database_status.recvd_initial_deposition_date 2021-10-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email boura@uochb.cas.cz _pdbx_contact_author.name_first Evzen _pdbx_contact_author.name_last Boura _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9652-4065 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Smola, M.' 1 0000-0002-4611-739X 'Klima, M.' 2 0000-0002-9083-509X 'Boura, E.' 3 0000-0002-9652-4065 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 0969-2126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 30 _citation.language ? _citation.page_first 1146 _citation.page_last ? _citation.title 'Discovery of isonucleotidic CDNs as potent STING agonists with immunomodulatory potential.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2022.05.012 _citation.pdbx_database_id_PubMed 35690061 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dejmek, M.' 1 ? primary 'Sala, M.' 2 ? primary 'Brazdova, A.' 3 ? primary 'Vanekova, L.' 4 ? primary 'Smola, M.' 5 ? primary 'Klima, M.' 6 ? primary 'Brehova, P.' 7 ? primary 'Budesinsky, M.' 8 ? primary 'Dracinsky, M.' 9 ? primary 'Prochazkova, E.' 10 ? primary 'Zavrel, M.' 11 ? primary 'Simak, O.' 12 ? primary 'Pav, O.' 13 ? primary 'Boura, E.' 14 ? primary 'Birkus, G.' 15 ? primary 'Nencka, R.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Stimulator of interferon genes protein' 23189.064 1 ? ? ? ? 2 non-polymer syn "3'3'-c-(2'F,2'dA-isonucA)MP" 644.404 1 ? ? ? ? 3 water nat water 18.015 43 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'hSTING,Endoplasmic reticulum interferon stimulator,ERIS,Mediator of IRF3 activation,hMITA,Transmembrane protein 173' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;APAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNI RFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDIL ADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTV ; _entity_poly.pdbx_seq_one_letter_code_can ;APAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNI RFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDIL ADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "3'3'-c-(2'F,2'dA-isonucA)MP" 8SC 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 PRO n 1 3 ALA n 1 4 GLU n 1 5 ILE n 1 6 SER n 1 7 ALA n 1 8 VAL n 1 9 CYS n 1 10 GLU n 1 11 LYS n 1 12 GLY n 1 13 ASN n 1 14 PHE n 1 15 ASN n 1 16 VAL n 1 17 ALA n 1 18 HIS n 1 19 GLY n 1 20 LEU n 1 21 ALA n 1 22 TRP n 1 23 SER n 1 24 TYR n 1 25 TYR n 1 26 ILE n 1 27 GLY n 1 28 TYR n 1 29 LEU n 1 30 ARG n 1 31 LEU n 1 32 ILE n 1 33 LEU n 1 34 PRO n 1 35 GLU n 1 36 LEU n 1 37 GLN n 1 38 ALA n 1 39 ARG n 1 40 ILE n 1 41 ARG n 1 42 THR n 1 43 TYR n 1 44 ASN n 1 45 GLN n 1 46 HIS n 1 47 TYR n 1 48 ASN n 1 49 ASN n 1 50 LEU n 1 51 LEU n 1 52 ARG n 1 53 GLY n 1 54 ALA n 1 55 VAL n 1 56 SER n 1 57 GLN n 1 58 ARG n 1 59 LEU n 1 60 TYR n 1 61 ILE n 1 62 LEU n 1 63 LEU n 1 64 PRO n 1 65 LEU n 1 66 ASP n 1 67 CYS n 1 68 GLY n 1 69 VAL n 1 70 PRO n 1 71 ASP n 1 72 ASN n 1 73 LEU n 1 74 SER n 1 75 MET n 1 76 ALA n 1 77 ASP n 1 78 PRO n 1 79 ASN n 1 80 ILE n 1 81 ARG n 1 82 PHE n 1 83 LEU n 1 84 ASP n 1 85 LYS n 1 86 LEU n 1 87 PRO n 1 88 GLN n 1 89 GLN n 1 90 THR n 1 91 GLY n 1 92 ASP n 1 93 ARG n 1 94 ALA n 1 95 GLY n 1 96 ILE n 1 97 LYS n 1 98 ASP n 1 99 ARG n 1 100 VAL n 1 101 TYR n 1 102 SER n 1 103 ASN n 1 104 SER n 1 105 ILE n 1 106 TYR n 1 107 GLU n 1 108 LEU n 1 109 LEU n 1 110 GLU n 1 111 ASN n 1 112 GLY n 1 113 GLN n 1 114 ARG n 1 115 ALA n 1 116 GLY n 1 117 THR n 1 118 CYS n 1 119 VAL n 1 120 LEU n 1 121 GLU n 1 122 TYR n 1 123 ALA n 1 124 THR n 1 125 PRO n 1 126 LEU n 1 127 GLN n 1 128 THR n 1 129 LEU n 1 130 PHE n 1 131 ALA n 1 132 MET n 1 133 SER n 1 134 GLN n 1 135 TYR n 1 136 SER n 1 137 GLN n 1 138 ALA n 1 139 GLY n 1 140 PHE n 1 141 SER n 1 142 ARG n 1 143 GLU n 1 144 ASP n 1 145 ARG n 1 146 LEU n 1 147 GLU n 1 148 GLN n 1 149 ALA n 1 150 LYS n 1 151 LEU n 1 152 PHE n 1 153 CYS n 1 154 ARG n 1 155 THR n 1 156 LEU n 1 157 GLU n 1 158 ASP n 1 159 ILE n 1 160 LEU n 1 161 ALA n 1 162 ASP n 1 163 ALA n 1 164 PRO n 1 165 GLU n 1 166 SER n 1 167 GLN n 1 168 ASN n 1 169 ASN n 1 170 CYS n 1 171 ARG n 1 172 LEU n 1 173 ILE n 1 174 ALA n 1 175 TYR n 1 176 GLN n 1 177 GLU n 1 178 PRO n 1 179 ALA n 1 180 ASP n 1 181 ASP n 1 182 SER n 1 183 SER n 1 184 PHE n 1 185 SER n 1 186 LEU n 1 187 SER n 1 188 GLN n 1 189 GLU n 1 190 VAL n 1 191 LEU n 1 192 ARG n 1 193 HIS n 1 194 LEU n 1 195 ARG n 1 196 GLN n 1 197 GLU n 1 198 GLU n 1 199 LYS n 1 200 GLU n 1 201 GLU n 1 202 VAL n 1 203 THR n 1 204 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 204 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'STING1, ERIS, MITA, STING, TMEM173' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 8SC non-polymer . "3'3'-c-(2'F,2'dA-isonucA)MP" ;9-[(1R,6R,9R,10S,15R,17R,18R)-17-(6-aminopurin-9-yl)-18-fluoranyl-3,12-bis(oxidanyl)-3,12-bis(oxidanylidene)-2,4,7,11,13,16-hexaoxa-3$l^{5},12$l^{5}-diphosphatricyclo[13.3.0.0^{6,10}]octadecan-9-yl]purin-6-amine ; 'C20 H23 F N10 O10 P2' 644.404 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 140 ? ? ? A . n A 1 2 PRO 2 141 ? ? ? A . n A 1 3 ALA 3 142 ? ? ? A . n A 1 4 GLU 4 143 ? ? ? A . n A 1 5 ILE 5 144 ? ? ? A . n A 1 6 SER 6 145 ? ? ? A . n A 1 7 ALA 7 146 ? ? ? A . n A 1 8 VAL 8 147 ? ? ? A . n A 1 9 CYS 9 148 ? ? ? A . n A 1 10 GLU 10 149 ? ? ? A . n A 1 11 LYS 11 150 ? ? ? A . n A 1 12 GLY 12 151 ? ? ? A . n A 1 13 ASN 13 152 ? ? ? A . n A 1 14 PHE 14 153 ? ? ? A . n A 1 15 ASN 15 154 154 ASN ASN A . n A 1 16 VAL 16 155 155 VAL VAL A . n A 1 17 ALA 17 156 156 ALA ALA A . n A 1 18 HIS 18 157 157 HIS HIS A . n A 1 19 GLY 19 158 158 GLY GLY A . n A 1 20 LEU 20 159 159 LEU LEU A . n A 1 21 ALA 21 160 160 ALA ALA A . n A 1 22 TRP 22 161 161 TRP TRP A . n A 1 23 SER 23 162 162 SER SER A . n A 1 24 TYR 24 163 163 TYR TYR A . n A 1 25 TYR 25 164 164 TYR TYR A . n A 1 26 ILE 26 165 165 ILE ILE A . n A 1 27 GLY 27 166 166 GLY GLY A . n A 1 28 TYR 28 167 167 TYR TYR A . n A 1 29 LEU 29 168 168 LEU LEU A . n A 1 30 ARG 30 169 169 ARG ARG A . n A 1 31 LEU 31 170 170 LEU LEU A . n A 1 32 ILE 32 171 171 ILE ILE A . n A 1 33 LEU 33 172 172 LEU LEU A . n A 1 34 PRO 34 173 173 PRO PRO A . n A 1 35 GLU 35 174 174 GLU GLU A . n A 1 36 LEU 36 175 175 LEU LEU A . n A 1 37 GLN 37 176 176 GLN GLN A . n A 1 38 ALA 38 177 177 ALA ALA A . n A 1 39 ARG 39 178 178 ARG ARG A . n A 1 40 ILE 40 179 179 ILE ILE A . n A 1 41 ARG 41 180 180 ARG ARG A . n A 1 42 THR 42 181 181 THR THR A . n A 1 43 TYR 43 182 182 TYR TYR A . n A 1 44 ASN 44 183 183 ASN ASN A . n A 1 45 GLN 45 184 184 GLN GLN A . n A 1 46 HIS 46 185 185 HIS HIS A . n A 1 47 TYR 47 186 ? ? ? A . n A 1 48 ASN 48 187 ? ? ? A . n A 1 49 ASN 49 188 ? ? ? A . n A 1 50 LEU 50 189 ? ? ? A . n A 1 51 LEU 51 190 ? ? ? A . n A 1 52 ARG 52 191 ? ? ? A . n A 1 53 GLY 53 192 ? ? ? A . n A 1 54 ALA 54 193 193 ALA ALA A . n A 1 55 VAL 55 194 194 VAL VAL A . n A 1 56 SER 56 195 195 SER SER A . n A 1 57 GLN 57 196 196 GLN GLN A . n A 1 58 ARG 58 197 197 ARG ARG A . n A 1 59 LEU 59 198 198 LEU LEU A . n A 1 60 TYR 60 199 199 TYR TYR A . n A 1 61 ILE 61 200 200 ILE ILE A . n A 1 62 LEU 62 201 201 LEU LEU A . n A 1 63 LEU 63 202 202 LEU LEU A . n A 1 64 PRO 64 203 203 PRO PRO A . n A 1 65 LEU 65 204 204 LEU LEU A . n A 1 66 ASP 66 205 205 ASP ASP A . n A 1 67 CYS 67 206 206 CYS CYS A . n A 1 68 GLY 68 207 207 GLY GLY A . n A 1 69 VAL 69 208 208 VAL VAL A . n A 1 70 PRO 70 209 209 PRO PRO A . n A 1 71 ASP 71 210 210 ASP ASP A . n A 1 72 ASN 72 211 211 ASN ASN A . n A 1 73 LEU 73 212 212 LEU LEU A . n A 1 74 SER 74 213 213 SER SER A . n A 1 75 MET 75 214 214 MET MET A . n A 1 76 ALA 76 215 215 ALA ALA A . n A 1 77 ASP 77 216 216 ASP ASP A . n A 1 78 PRO 78 217 217 PRO PRO A . n A 1 79 ASN 79 218 218 ASN ASN A . n A 1 80 ILE 80 219 219 ILE ILE A . n A 1 81 ARG 81 220 220 ARG ARG A . n A 1 82 PHE 82 221 221 PHE PHE A . n A 1 83 LEU 83 222 222 LEU LEU A . n A 1 84 ASP 84 223 223 ASP ASP A . n A 1 85 LYS 85 224 224 LYS LYS A . n A 1 86 LEU 86 225 225 LEU LEU A . n A 1 87 PRO 87 226 226 PRO PRO A . n A 1 88 GLN 88 227 227 GLN GLN A . n A 1 89 GLN 89 228 228 GLN GLN A . n A 1 90 THR 90 229 229 THR THR A . n A 1 91 GLY 91 230 230 GLY GLY A . n A 1 92 ASP 92 231 231 ASP ASP A . n A 1 93 ARG 93 232 232 ARG ARG A . n A 1 94 ALA 94 233 233 ALA ALA A . n A 1 95 GLY 95 234 234 GLY GLY A . n A 1 96 ILE 96 235 235 ILE ILE A . n A 1 97 LYS 97 236 236 LYS LYS A . n A 1 98 ASP 98 237 237 ASP ASP A . n A 1 99 ARG 99 238 238 ARG ARG A . n A 1 100 VAL 100 239 239 VAL VAL A . n A 1 101 TYR 101 240 240 TYR TYR A . n A 1 102 SER 102 241 241 SER SER A . n A 1 103 ASN 103 242 242 ASN ASN A . n A 1 104 SER 104 243 243 SER SER A . n A 1 105 ILE 105 244 244 ILE ILE A . n A 1 106 TYR 106 245 245 TYR TYR A . n A 1 107 GLU 107 246 246 GLU GLU A . n A 1 108 LEU 108 247 247 LEU LEU A . n A 1 109 LEU 109 248 248 LEU LEU A . n A 1 110 GLU 110 249 249 GLU GLU A . n A 1 111 ASN 111 250 250 ASN ASN A . n A 1 112 GLY 112 251 251 GLY GLY A . n A 1 113 GLN 113 252 252 GLN GLN A . n A 1 114 ARG 114 253 253 ARG ARG A . n A 1 115 ALA 115 254 254 ALA ALA A . n A 1 116 GLY 116 255 255 GLY GLY A . n A 1 117 THR 117 256 256 THR THR A . n A 1 118 CYS 118 257 257 CYS CYS A . n A 1 119 VAL 119 258 258 VAL VAL A . n A 1 120 LEU 120 259 259 LEU LEU A . n A 1 121 GLU 121 260 260 GLU GLU A . n A 1 122 TYR 122 261 261 TYR TYR A . n A 1 123 ALA 123 262 262 ALA ALA A . n A 1 124 THR 124 263 263 THR THR A . n A 1 125 PRO 125 264 264 PRO PRO A . n A 1 126 LEU 126 265 265 LEU LEU A . n A 1 127 GLN 127 266 266 GLN GLN A . n A 1 128 THR 128 267 267 THR THR A . n A 1 129 LEU 129 268 268 LEU LEU A . n A 1 130 PHE 130 269 269 PHE PHE A . n A 1 131 ALA 131 270 270 ALA ALA A . n A 1 132 MET 132 271 271 MET MET A . n A 1 133 SER 133 272 272 SER SER A . n A 1 134 GLN 134 273 273 GLN GLN A . n A 1 135 TYR 135 274 274 TYR TYR A . n A 1 136 SER 136 275 275 SER SER A . n A 1 137 GLN 137 276 276 GLN GLN A . n A 1 138 ALA 138 277 277 ALA ALA A . n A 1 139 GLY 139 278 278 GLY GLY A . n A 1 140 PHE 140 279 279 PHE PHE A . n A 1 141 SER 141 280 280 SER SER A . n A 1 142 ARG 142 281 281 ARG ARG A . n A 1 143 GLU 143 282 282 GLU GLU A . n A 1 144 ASP 144 283 283 ASP ASP A . n A 1 145 ARG 145 284 284 ARG ARG A . n A 1 146 LEU 146 285 285 LEU LEU A . n A 1 147 GLU 147 286 286 GLU GLU A . n A 1 148 GLN 148 287 287 GLN GLN A . n A 1 149 ALA 149 288 288 ALA ALA A . n A 1 150 LYS 150 289 289 LYS LYS A . n A 1 151 LEU 151 290 290 LEU LEU A . n A 1 152 PHE 152 291 291 PHE PHE A . n A 1 153 CYS 153 292 292 CYS CYS A . n A 1 154 ARG 154 293 293 ARG ARG A . n A 1 155 THR 155 294 294 THR THR A . n A 1 156 LEU 156 295 295 LEU LEU A . n A 1 157 GLU 157 296 296 GLU GLU A . n A 1 158 ASP 158 297 297 ASP ASP A . n A 1 159 ILE 159 298 298 ILE ILE A . n A 1 160 LEU 160 299 299 LEU LEU A . n A 1 161 ALA 161 300 300 ALA ALA A . n A 1 162 ASP 162 301 301 ASP ASP A . n A 1 163 ALA 163 302 302 ALA ALA A . n A 1 164 PRO 164 303 303 PRO PRO A . n A 1 165 GLU 165 304 304 GLU GLU A . n A 1 166 SER 166 305 305 SER SER A . n A 1 167 GLN 167 306 306 GLN GLN A . n A 1 168 ASN 168 307 307 ASN ASN A . n A 1 169 ASN 169 308 308 ASN ASN A . n A 1 170 CYS 170 309 309 CYS CYS A . n A 1 171 ARG 171 310 310 ARG ARG A . n A 1 172 LEU 172 311 311 LEU LEU A . n A 1 173 ILE 173 312 312 ILE ILE A . n A 1 174 ALA 174 313 313 ALA ALA A . n A 1 175 TYR 175 314 314 TYR TYR A . n A 1 176 GLN 176 315 315 GLN GLN A . n A 1 177 GLU 177 316 316 GLU GLU A . n A 1 178 PRO 178 317 317 PRO PRO A . n A 1 179 ALA 179 318 318 ALA ALA A . n A 1 180 ASP 180 319 319 ASP ASP A . n A 1 181 ASP 181 320 320 ASP ASP A . n A 1 182 SER 182 321 321 SER SER A . n A 1 183 SER 183 322 322 SER SER A . n A 1 184 PHE 184 323 323 PHE PHE A . n A 1 185 SER 185 324 324 SER SER A . n A 1 186 LEU 186 325 325 LEU LEU A . n A 1 187 SER 187 326 326 SER SER A . n A 1 188 GLN 188 327 327 GLN GLN A . n A 1 189 GLU 189 328 328 GLU GLU A . n A 1 190 VAL 190 329 329 VAL VAL A . n A 1 191 LEU 191 330 330 LEU LEU A . n A 1 192 ARG 192 331 331 ARG ARG A . n A 1 193 HIS 193 332 332 HIS HIS A . n A 1 194 LEU 194 333 333 LEU LEU A . n A 1 195 ARG 195 334 334 ARG ARG A . n A 1 196 GLN 196 335 335 GLN GLN A . n A 1 197 GLU 197 336 336 GLU GLU A . n A 1 198 GLU 198 337 ? ? ? A . n A 1 199 LYS 199 338 ? ? ? A . n A 1 200 GLU 200 339 ? ? ? A . n A 1 201 GLU 201 340 ? ? ? A . n A 1 202 VAL 202 341 ? ? ? A . n A 1 203 THR 203 342 ? ? ? A . n A 1 204 VAL 204 343 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 8SC 1 401 1 8SC MS1 A . C 3 HOH 1 501 16 HOH HOH A . C 3 HOH 2 502 21 HOH HOH A . C 3 HOH 3 503 4 HOH HOH A . C 3 HOH 4 504 34 HOH HOH A . C 3 HOH 5 505 10 HOH HOH A . C 3 HOH 6 506 20 HOH HOH A . C 3 HOH 7 507 33 HOH HOH A . C 3 HOH 8 508 24 HOH HOH A . C 3 HOH 9 509 42 HOH HOH A . C 3 HOH 10 510 9 HOH HOH A . C 3 HOH 11 511 23 HOH HOH A . C 3 HOH 12 512 1 HOH HOH A . C 3 HOH 13 513 11 HOH HOH A . C 3 HOH 14 514 3 HOH HOH A . C 3 HOH 15 515 15 HOH HOH A . C 3 HOH 16 516 39 HOH HOH A . C 3 HOH 17 517 2 HOH HOH A . C 3 HOH 18 518 38 HOH HOH A . C 3 HOH 19 519 40 HOH HOH A . C 3 HOH 20 520 5 HOH HOH A . C 3 HOH 21 521 17 HOH HOH A . C 3 HOH 22 522 29 HOH HOH A . C 3 HOH 23 523 25 HOH HOH A . C 3 HOH 24 524 30 HOH HOH A . C 3 HOH 25 525 27 HOH HOH A . C 3 HOH 26 526 6 HOH HOH A . C 3 HOH 27 527 18 HOH HOH A . C 3 HOH 28 528 12 HOH HOH A . C 3 HOH 29 529 7 HOH HOH A . C 3 HOH 30 530 31 HOH HOH A . C 3 HOH 31 531 28 HOH HOH A . C 3 HOH 32 532 13 HOH HOH A . C 3 HOH 33 533 32 HOH HOH A . C 3 HOH 34 534 14 HOH HOH A . C 3 HOH 35 535 37 HOH HOH A . C 3 HOH 36 536 8 HOH HOH A . C 3 HOH 37 537 36 HOH HOH A . C 3 HOH 38 538 41 HOH HOH A . C 3 HOH 39 539 35 HOH HOH A . C 3 HOH 40 540 26 HOH HOH A . C 3 HOH 41 541 19 HOH HOH A . C 3 HOH 42 542 43 HOH HOH A . C 3 HOH 43 543 22 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 154 ? CG ? A ASN 15 CG 2 1 Y 1 A ASN 154 ? OD1 ? A ASN 15 OD1 3 1 Y 1 A ASN 154 ? ND2 ? A ASN 15 ND2 4 1 Y 1 A ASN 307 ? CG ? A ASN 168 CG 5 1 Y 1 A ASN 307 ? OD1 ? A ASN 168 OD1 6 1 Y 1 A ASN 307 ? ND2 ? A ASN 168 ND2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? xdsgui2 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? xdsgui2 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.5 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.7.1 4 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 5 # _cell.angle_alpha 90.0 _cell.angle_alpha_esd ? _cell.angle_beta 90.0 _cell.angle_beta_esd ? _cell.angle_gamma 90.0 _cell.angle_gamma_esd ? _cell.entry_id 7Q3B _cell.details ? _cell.formula_units_Z ? _cell.length_a 110.728 _cell.length_a_esd ? _cell.length_b 110.728 _cell.length_b_esd ? _cell.length_c 35.746 _cell.length_c_esd ? _cell.volume 438270.624168 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7Q3B _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall 'P 4abw 2nw' _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7Q3B _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.71 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.53 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 M Lithium acetate, 20% (w/v) PEG 3350 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 200K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-08-05 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.541870 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.541870 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 37.9884992619 _reflns.entry_id 7Q3B _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.557 _reflns.d_resolution_low 34.02 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7594 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.5 _reflns.pdbx_Rmerge_I_obs 0.2218 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.70 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.2367 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star 0.998 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.557 _reflns_shell.d_res_low 2.649 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.97 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 716 _reflns_shell.percent_possible_all 98 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.9621 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 8.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.023 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.777 _reflns_shell.pdbx_CC_star 0.935 _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 39.502334703 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7Q3B _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.55733924728 _refine.ls_d_res_low 34.0173257887 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7593 _refine.ls_number_reflns_R_free 382 _refine.ls_number_reflns_R_work 7211 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.684915321 _refine.ls_percent_reflns_R_free 5.0309495588 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.192989387043 _refine.ls_R_factor_R_free 0.231847861777 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.190811450839 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34751557498 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4ksy _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.7504803796 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.282396223056 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.55733924728 _refine_hist.d_res_low 34.0173257887 _refine_hist.number_atoms_solvent 43 _refine_hist.number_atoms_total 1494 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1408 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 43 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.00708219191527 ? 1487 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.07656026707 ? 2026 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0380045626748 ? 222 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0061980990071 ? 260 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.548009796 ? 558 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.55733924728 2.9272 . . 124 2335 99.5546558704 . . . 0.303749641503 . 0.22100309504 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9272 3.6873 . . 125 2372 99.9599679744 . . . 0.220927961086 . 0.195479628436 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6873 34.0173257887 . . 133 2504 99.5469988675 . . . 0.216143018491 . 0.178635914951 . . . . . . . . . . . # _struct.entry_id 7Q3B _struct.title ;Crystal structure of human STING in complex with 3'3'-c-(2'F,2'dA-isonucA)MP ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7Q3B _struct_keywords.text 'sting, antiviral, activator, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code STING_HUMAN _struct_ref.pdbx_db_accession Q86WV6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;APAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNI RFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDIL ADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTV ; _struct_ref.pdbx_align_begin 140 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7Q3B _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 204 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q86WV6 _struct_ref_seq.db_align_beg 140 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 343 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 140 _struct_ref_seq.pdbx_auth_seq_align_end 343 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7Q3B _struct_ref_seq_dif.mon_id ARG _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 93 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q86WV6 _struct_ref_seq_dif.db_mon_id HIS _struct_ref_seq_dif.pdbx_seq_db_seq_num 232 _struct_ref_seq_dif.details variant _struct_ref_seq_dif.pdbx_auth_seq_num 232 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4100 ? 1 MORE -14 ? 1 'SSA (A^2)' 15560 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_554 -y,-x,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -17.8730000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 15 ? TYR A 28 ? ASN A 154 TYR A 167 1 ? 14 HELX_P HELX_P2 AA2 TYR A 28 ? LEU A 33 ? TYR A 167 LEU A 172 1 ? 6 HELX_P HELX_P3 AA3 GLU A 35 ? GLN A 45 ? GLU A 174 GLN A 184 1 ? 11 HELX_P HELX_P4 AA4 ASN A 72 ? ASP A 77 ? ASN A 211 ASP A 216 1 ? 6 HELX_P HELX_P5 AA5 THR A 124 ? TYR A 135 ? THR A 263 TYR A 274 1 ? 12 HELX_P HELX_P6 AA6 SER A 136 ? GLY A 139 ? SER A 275 GLY A 278 5 ? 4 HELX_P HELX_P7 AA7 SER A 141 ? GLU A 143 ? SER A 280 GLU A 282 5 ? 3 HELX_P HELX_P8 AA8 ASP A 144 ? ASP A 162 ? ASP A 283 ASP A 301 1 ? 19 HELX_P HELX_P9 AA9 SER A 185 ? GLN A 196 ? SER A 324 GLN A 335 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 80 ? LYS A 85 ? ILE A 219 LYS A 224 AA1 2 SER A 104 ? GLU A 110 ? SER A 243 GLU A 249 AA1 3 GLN A 113 ? TYR A 122 ? GLN A 252 TYR A 261 AA1 4 LEU A 59 ? PRO A 64 ? LEU A 198 PRO A 203 AA1 5 CYS A 170 ? TYR A 175 ? CYS A 309 TYR A 314 AA2 1 GLN A 89 ? ARG A 93 ? GLN A 228 ARG A 232 AA2 2 ILE A 96 ? TYR A 101 ? ILE A 235 TYR A 240 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 84 ? N ASP A 223 O ILE A 105 ? O ILE A 244 AA1 2 3 N LEU A 108 ? N LEU A 247 O ALA A 115 ? O ALA A 254 AA1 3 4 O GLU A 121 ? O GLU A 260 N LEU A 62 ? N LEU A 201 AA1 4 5 N ILE A 61 ? N ILE A 200 O ILE A 173 ? O ILE A 312 AA2 1 2 N GLN A 89 ? N GLN A 228 O TYR A 101 ? O TYR A 240 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 167 ? ? -134.51 -70.20 2 1 CYS A 206 ? ? 58.10 19.14 3 1 ASN A 307 ? ? 47.50 21.53 4 1 ASP A 319 ? ? 81.85 -4.96 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 505 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/4 3 y+1/2,-x+1/2,z+3/4 4 x+1/2,-y+1/2,-z+3/4 5 -x+1/2,y+1/2,-z+1/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # _pdbx_entry_details.entry_id 7Q3B _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 140 ? A ALA 1 2 1 Y 1 A PRO 141 ? A PRO 2 3 1 Y 1 A ALA 142 ? A ALA 3 4 1 Y 1 A GLU 143 ? A GLU 4 5 1 Y 1 A ILE 144 ? A ILE 5 6 1 Y 1 A SER 145 ? A SER 6 7 1 Y 1 A ALA 146 ? A ALA 7 8 1 Y 1 A VAL 147 ? A VAL 8 9 1 Y 1 A CYS 148 ? A CYS 9 10 1 Y 1 A GLU 149 ? A GLU 10 11 1 Y 1 A LYS 150 ? A LYS 11 12 1 Y 1 A GLY 151 ? A GLY 12 13 1 Y 1 A ASN 152 ? A ASN 13 14 1 Y 1 A PHE 153 ? A PHE 14 15 1 Y 1 A TYR 186 ? A TYR 47 16 1 Y 1 A ASN 187 ? A ASN 48 17 1 Y 1 A ASN 188 ? A ASN 49 18 1 Y 1 A LEU 189 ? A LEU 50 19 1 Y 1 A LEU 190 ? A LEU 51 20 1 Y 1 A ARG 191 ? A ARG 52 21 1 Y 1 A GLY 192 ? A GLY 53 22 1 Y 1 A GLU 337 ? A GLU 198 23 1 Y 1 A LYS 338 ? A LYS 199 24 1 Y 1 A GLU 339 ? A GLU 200 25 1 Y 1 A GLU 340 ? A GLU 201 26 1 Y 1 A VAL 341 ? A VAL 202 27 1 Y 1 A THR 342 ? A THR 203 28 1 Y 1 A VAL 343 ? A VAL 204 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 8SC N N Y N 1 8SC C17 C N R 2 8SC C14 C Y N 3 8SC C13 C Y N 4 8SC C12 C Y N 5 8SC C11 C Y N 6 8SC C16 C N R 7 8SC C15 C N R 8 8SC N7 N Y N 9 8SC C8 C N R 10 8SC N9 N N N 11 8SC C1 C Y N 12 8SC O1 O N N 13 8SC C4 C Y N 14 8SC C5 C N S 15 8SC P P N N 16 8SC O8 O N N 17 8SC O7 O N N 18 8SC C3 C Y N 19 8SC O3 O N N 20 8SC C2 C Y N 21 8SC O2 O N N 22 8SC C6 C N R 23 8SC N1 N Y N 24 8SC C9 C N N 25 8SC C C Y N 26 8SC O O N N 27 8SC C10 C Y N 28 8SC C18 C N R 29 8SC C19 C N N 30 8SC C7 C N N 31 8SC F6 F N N 32 8SC N11 N N N 33 8SC N2 N Y N 34 8SC N3 N Y N 35 8SC N4 N Y N 36 8SC N5 N Y N 37 8SC N6 N Y N 38 8SC O10 O N N 39 8SC O22 O N N 40 8SC O4 O N N 41 8SC O5 O N N 42 8SC P1 P N N 43 8SC H1 H N N 44 8SC H2 H N N 45 8SC H3 H N N 46 8SC H4 H N N 47 8SC H5 H N N 48 8SC H6 H N N 49 8SC H7 H N N 50 8SC H8 H N N 51 8SC H9 H N N 52 8SC H10 H N N 53 8SC H11 H N N 54 8SC H12 H N N 55 8SC H13 H N N 56 8SC H14 H N N 57 8SC H15 H N N 58 8SC H16 H N N 59 8SC H17 H N N 60 8SC H18 H N N 61 8SC H19 H N N 62 8SC H20 H N N 63 8SC H21 H N N 64 8SC H22 H N N 65 8SC H23 H N N 66 ALA N N N N 67 ALA CA C N S 68 ALA C C N N 69 ALA O O N N 70 ALA CB C N N 71 ALA OXT O N N 72 ALA H H N N 73 ALA H2 H N N 74 ALA HA H N N 75 ALA HB1 H N N 76 ALA HB2 H N N 77 ALA HB3 H N N 78 ALA HXT H N N 79 ARG N N N N 80 ARG CA C N S 81 ARG C C N N 82 ARG O O N N 83 ARG CB C N N 84 ARG CG C N N 85 ARG CD C N N 86 ARG NE N N N 87 ARG CZ C N N 88 ARG NH1 N N N 89 ARG NH2 N N N 90 ARG OXT O N N 91 ARG H H N N 92 ARG H2 H N N 93 ARG HA H N N 94 ARG HB2 H N N 95 ARG HB3 H N N 96 ARG HG2 H N N 97 ARG HG3 H N N 98 ARG HD2 H N N 99 ARG HD3 H N N 100 ARG HE H N N 101 ARG HH11 H N N 102 ARG HH12 H N N 103 ARG HH21 H N N 104 ARG HH22 H N N 105 ARG HXT H N N 106 ASN N N N N 107 ASN CA C N S 108 ASN C C N N 109 ASN O O N N 110 ASN CB C N N 111 ASN CG C N N 112 ASN OD1 O N N 113 ASN ND2 N N N 114 ASN OXT O N N 115 ASN H H N N 116 ASN H2 H N N 117 ASN HA H N N 118 ASN HB2 H N N 119 ASN HB3 H N N 120 ASN HD21 H N N 121 ASN HD22 H N N 122 ASN HXT H N N 123 ASP N N N N 124 ASP CA C N S 125 ASP C C N N 126 ASP O O N N 127 ASP CB C N N 128 ASP CG C N N 129 ASP OD1 O N N 130 ASP OD2 O N N 131 ASP OXT O N N 132 ASP H H N N 133 ASP H2 H N N 134 ASP HA H N N 135 ASP HB2 H N N 136 ASP HB3 H N N 137 ASP HD2 H N N 138 ASP HXT H N N 139 CYS N N N N 140 CYS CA C N R 141 CYS C C N N 142 CYS O O N N 143 CYS CB C N N 144 CYS SG S N N 145 CYS OXT O N N 146 CYS H H N N 147 CYS H2 H N N 148 CYS HA H N N 149 CYS HB2 H N N 150 CYS HB3 H N N 151 CYS HG H N N 152 CYS HXT H N N 153 GLN N N N N 154 GLN CA C N S 155 GLN C C N N 156 GLN O O N N 157 GLN CB C N N 158 GLN CG C N N 159 GLN CD C N N 160 GLN OE1 O N N 161 GLN NE2 N N N 162 GLN OXT O N N 163 GLN H H N N 164 GLN H2 H N N 165 GLN HA H N N 166 GLN HB2 H N N 167 GLN HB3 H N N 168 GLN HG2 H N N 169 GLN HG3 H N N 170 GLN HE21 H N N 171 GLN HE22 H N N 172 GLN HXT H N N 173 GLU N N N N 174 GLU CA C N S 175 GLU C C N N 176 GLU O O N N 177 GLU CB C N N 178 GLU CG C N N 179 GLU CD C N N 180 GLU OE1 O N N 181 GLU OE2 O N N 182 GLU OXT O N N 183 GLU H H N N 184 GLU H2 H N N 185 GLU HA H N N 186 GLU HB2 H N N 187 GLU HB3 H N N 188 GLU HG2 H N N 189 GLU HG3 H N N 190 GLU HE2 H N N 191 GLU HXT H N N 192 GLY N N N N 193 GLY CA C N N 194 GLY C C N N 195 GLY O O N N 196 GLY OXT O N N 197 GLY H H N N 198 GLY H2 H N N 199 GLY HA2 H N N 200 GLY HA3 H N N 201 GLY HXT H N N 202 HIS N N N N 203 HIS CA C N S 204 HIS C C N N 205 HIS O O N N 206 HIS CB C N N 207 HIS CG C Y N 208 HIS ND1 N Y N 209 HIS CD2 C Y N 210 HIS CE1 C Y N 211 HIS NE2 N Y N 212 HIS OXT O N N 213 HIS H H N N 214 HIS H2 H N N 215 HIS HA H N N 216 HIS HB2 H N N 217 HIS HB3 H N N 218 HIS HD1 H N N 219 HIS HD2 H N N 220 HIS HE1 H N N 221 HIS HE2 H N N 222 HIS HXT H N N 223 HOH O O N N 224 HOH H1 H N N 225 HOH H2 H N N 226 ILE N N N N 227 ILE CA C N S 228 ILE C C N N 229 ILE O O N N 230 ILE CB C N S 231 ILE CG1 C N N 232 ILE CG2 C N N 233 ILE CD1 C N N 234 ILE OXT O N N 235 ILE H H N N 236 ILE H2 H N N 237 ILE HA H N N 238 ILE HB H N N 239 ILE HG12 H N N 240 ILE HG13 H N N 241 ILE HG21 H N N 242 ILE HG22 H N N 243 ILE HG23 H N N 244 ILE HD11 H N N 245 ILE HD12 H N N 246 ILE HD13 H N N 247 ILE HXT H N N 248 LEU N N N N 249 LEU CA C N S 250 LEU C C N N 251 LEU O O N N 252 LEU CB C N N 253 LEU CG C N N 254 LEU CD1 C N N 255 LEU CD2 C N N 256 LEU OXT O N N 257 LEU H H N N 258 LEU H2 H N N 259 LEU HA H N N 260 LEU HB2 H N N 261 LEU HB3 H N N 262 LEU HG H N N 263 LEU HD11 H N N 264 LEU HD12 H N N 265 LEU HD13 H N N 266 LEU HD21 H N N 267 LEU HD22 H N N 268 LEU HD23 H N N 269 LEU HXT H N N 270 LYS N N N N 271 LYS CA C N S 272 LYS C C N N 273 LYS O O N N 274 LYS CB C N N 275 LYS CG C N N 276 LYS CD C N N 277 LYS CE C N N 278 LYS NZ N N N 279 LYS OXT O N N 280 LYS H H N N 281 LYS H2 H N N 282 LYS HA H N N 283 LYS HB2 H N N 284 LYS HB3 H N N 285 LYS HG2 H N N 286 LYS HG3 H N N 287 LYS HD2 H N N 288 LYS HD3 H N N 289 LYS HE2 H N N 290 LYS HE3 H N N 291 LYS HZ1 H N N 292 LYS HZ2 H N N 293 LYS HZ3 H N N 294 LYS HXT H N N 295 MET N N N N 296 MET CA C N S 297 MET C C N N 298 MET O O N N 299 MET CB C N N 300 MET CG C N N 301 MET SD S N N 302 MET CE C N N 303 MET OXT O N N 304 MET H H N N 305 MET H2 H N N 306 MET HA H N N 307 MET HB2 H N N 308 MET HB3 H N N 309 MET HG2 H N N 310 MET HG3 H N N 311 MET HE1 H N N 312 MET HE2 H N N 313 MET HE3 H N N 314 MET HXT H N N 315 PHE N N N N 316 PHE CA C N S 317 PHE C C N N 318 PHE O O N N 319 PHE CB C N N 320 PHE CG C Y N 321 PHE CD1 C Y N 322 PHE CD2 C Y N 323 PHE CE1 C Y N 324 PHE CE2 C Y N 325 PHE CZ C Y N 326 PHE OXT O N N 327 PHE H H N N 328 PHE H2 H N N 329 PHE HA H N N 330 PHE HB2 H N N 331 PHE HB3 H N N 332 PHE HD1 H N N 333 PHE HD2 H N N 334 PHE HE1 H N N 335 PHE HE2 H N N 336 PHE HZ H N N 337 PHE HXT H N N 338 PRO N N N N 339 PRO CA C N S 340 PRO C C N N 341 PRO O O N N 342 PRO CB C N N 343 PRO CG C N N 344 PRO CD C N N 345 PRO OXT O N N 346 PRO H H N N 347 PRO HA H N N 348 PRO HB2 H N N 349 PRO HB3 H N N 350 PRO HG2 H N N 351 PRO HG3 H N N 352 PRO HD2 H N N 353 PRO HD3 H N N 354 PRO HXT H N N 355 SER N N N N 356 SER CA C N S 357 SER C C N N 358 SER O O N N 359 SER CB C N N 360 SER OG O N N 361 SER OXT O N N 362 SER H H N N 363 SER H2 H N N 364 SER HA H N N 365 SER HB2 H N N 366 SER HB3 H N N 367 SER HG H N N 368 SER HXT H N N 369 THR N N N N 370 THR CA C N S 371 THR C C N N 372 THR O O N N 373 THR CB C N R 374 THR OG1 O N N 375 THR CG2 C N N 376 THR OXT O N N 377 THR H H N N 378 THR H2 H N N 379 THR HA H N N 380 THR HB H N N 381 THR HG1 H N N 382 THR HG21 H N N 383 THR HG22 H N N 384 THR HG23 H N N 385 THR HXT H N N 386 TRP N N N N 387 TRP CA C N S 388 TRP C C N N 389 TRP O O N N 390 TRP CB C N N 391 TRP CG C Y N 392 TRP CD1 C Y N 393 TRP CD2 C Y N 394 TRP NE1 N Y N 395 TRP CE2 C Y N 396 TRP CE3 C Y N 397 TRP CZ2 C Y N 398 TRP CZ3 C Y N 399 TRP CH2 C Y N 400 TRP OXT O N N 401 TRP H H N N 402 TRP H2 H N N 403 TRP HA H N N 404 TRP HB2 H N N 405 TRP HB3 H N N 406 TRP HD1 H N N 407 TRP HE1 H N N 408 TRP HE3 H N N 409 TRP HZ2 H N N 410 TRP HZ3 H N N 411 TRP HH2 H N N 412 TRP HXT H N N 413 TYR N N N N 414 TYR CA C N S 415 TYR C C N N 416 TYR O O N N 417 TYR CB C N N 418 TYR CG C Y N 419 TYR CD1 C Y N 420 TYR CD2 C Y N 421 TYR CE1 C Y N 422 TYR CE2 C Y N 423 TYR CZ C Y N 424 TYR OH O N N 425 TYR OXT O N N 426 TYR H H N N 427 TYR H2 H N N 428 TYR HA H N N 429 TYR HB2 H N N 430 TYR HB3 H N N 431 TYR HD1 H N N 432 TYR HD2 H N N 433 TYR HE1 H N N 434 TYR HE2 H N N 435 TYR HH H N N 436 TYR HXT H N N 437 VAL N N N N 438 VAL CA C N S 439 VAL C C N N 440 VAL O O N N 441 VAL CB C N N 442 VAL CG1 C N N 443 VAL CG2 C N N 444 VAL OXT O N N 445 VAL H H N N 446 VAL H2 H N N 447 VAL HA H N N 448 VAL HB H N N 449 VAL HG11 H N N 450 VAL HG12 H N N 451 VAL HG13 H N N 452 VAL HG21 H N N 453 VAL HG22 H N N 454 VAL HG23 H N N 455 VAL HXT H N N 456 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 8SC O4 P1 doub N N 1 8SC O22 P1 sing N N 2 8SC P1 O8 sing N N 3 8SC P1 O10 sing N N 4 8SC O5 C17 sing N N 5 8SC O5 C18 sing N N 6 8SC C14 N7 doub Y N 7 8SC C14 N6 sing Y N 8 8SC O8 C19 sing N N 9 8SC N7 C12 sing Y N 10 8SC C19 C18 sing N N 11 8SC N6 C17 sing N N 12 8SC N6 C11 sing Y N 13 8SC C17 C16 sing N N 14 8SC C12 C11 doub Y N 15 8SC C12 C13 sing Y N 16 8SC C18 C15 sing N N 17 8SC N9 C13 sing N N 18 8SC C11 N5 sing Y N 19 8SC O10 C5 sing N N 20 8SC C13 N4 doub Y N 21 8SC N5 C10 doub Y N 22 8SC N4 C10 sing Y N 23 8SC C N1 doub Y N 24 8SC C N sing Y N 25 8SC C16 C15 sing N N 26 8SC C16 F6 sing N N 27 8SC C15 O7 sing N N 28 8SC N1 C1 sing Y N 29 8SC C5 C6 sing N N 30 8SC C5 C8 sing N N 31 8SC N C3 doub Y N 32 8SC C6 N2 sing N N 33 8SC C6 C7 sing N N 34 8SC C1 N2 sing Y N 35 8SC C1 C2 doub Y N 36 8SC N2 C4 sing Y N 37 8SC C3 C2 sing Y N 38 8SC C3 N11 sing N N 39 8SC O7 P sing N N 40 8SC C2 N3 sing Y N 41 8SC C8 C9 sing N N 42 8SC C8 O1 sing N N 43 8SC C4 N3 doub Y N 44 8SC C7 O1 sing N N 45 8SC C9 O2 sing N N 46 8SC O2 P sing N N 47 8SC P O3 doub N N 48 8SC P O sing N N 49 8SC C17 H1 sing N N 50 8SC C14 H2 sing N N 51 8SC C16 H3 sing N N 52 8SC C15 H4 sing N N 53 8SC C8 H5 sing N N 54 8SC N9 H6 sing N N 55 8SC N9 H7 sing N N 56 8SC C4 H8 sing N N 57 8SC C5 H9 sing N N 58 8SC C6 H10 sing N N 59 8SC C9 H11 sing N N 60 8SC C9 H12 sing N N 61 8SC C H13 sing N N 62 8SC O H14 sing N N 63 8SC C10 H15 sing N N 64 8SC C18 H16 sing N N 65 8SC C19 H17 sing N N 66 8SC C19 H18 sing N N 67 8SC C7 H19 sing N N 68 8SC C7 H20 sing N N 69 8SC N11 H21 sing N N 70 8SC N11 H22 sing N N 71 8SC O22 H23 sing N N 72 ALA N CA sing N N 73 ALA N H sing N N 74 ALA N H2 sing N N 75 ALA CA C sing N N 76 ALA CA CB sing N N 77 ALA CA HA sing N N 78 ALA C O doub N N 79 ALA C OXT sing N N 80 ALA CB HB1 sing N N 81 ALA CB HB2 sing N N 82 ALA CB HB3 sing N N 83 ALA OXT HXT sing N N 84 ARG N CA sing N N 85 ARG N H sing N N 86 ARG N H2 sing N N 87 ARG CA C sing N N 88 ARG CA CB sing N N 89 ARG CA HA sing N N 90 ARG C O doub N N 91 ARG C OXT sing N N 92 ARG CB CG sing N N 93 ARG CB HB2 sing N N 94 ARG CB HB3 sing N N 95 ARG CG CD sing N N 96 ARG CG HG2 sing N N 97 ARG CG HG3 sing N N 98 ARG CD NE sing N N 99 ARG CD HD2 sing N N 100 ARG CD HD3 sing N N 101 ARG NE CZ sing N N 102 ARG NE HE sing N N 103 ARG CZ NH1 sing N N 104 ARG CZ NH2 doub N N 105 ARG NH1 HH11 sing N N 106 ARG NH1 HH12 sing N N 107 ARG NH2 HH21 sing N N 108 ARG NH2 HH22 sing N N 109 ARG OXT HXT sing N N 110 ASN N CA sing N N 111 ASN N H sing N N 112 ASN N H2 sing N N 113 ASN CA C sing N N 114 ASN CA CB sing N N 115 ASN CA HA sing N N 116 ASN C O doub N N 117 ASN C OXT sing N N 118 ASN CB CG sing N N 119 ASN CB HB2 sing N N 120 ASN CB HB3 sing N N 121 ASN CG OD1 doub N N 122 ASN CG ND2 sing N N 123 ASN ND2 HD21 sing N N 124 ASN ND2 HD22 sing N N 125 ASN OXT HXT sing N N 126 ASP N CA sing N N 127 ASP N H sing N N 128 ASP N H2 sing N N 129 ASP CA C sing N N 130 ASP CA CB sing N N 131 ASP CA HA sing N N 132 ASP C O doub N N 133 ASP C OXT sing N N 134 ASP CB CG sing N N 135 ASP CB HB2 sing N N 136 ASP CB HB3 sing N N 137 ASP CG OD1 doub N N 138 ASP CG OD2 sing N N 139 ASP OD2 HD2 sing N N 140 ASP OXT HXT sing N N 141 CYS N CA sing N N 142 CYS N H sing N N 143 CYS N H2 sing N N 144 CYS CA C sing N N 145 CYS CA CB sing N N 146 CYS CA HA sing N N 147 CYS C O doub N N 148 CYS C OXT sing N N 149 CYS CB SG sing N N 150 CYS CB HB2 sing N N 151 CYS CB HB3 sing N N 152 CYS SG HG sing N N 153 CYS OXT HXT sing N N 154 GLN N CA sing N N 155 GLN N H sing N N 156 GLN N H2 sing N N 157 GLN CA C sing N N 158 GLN CA CB sing N N 159 GLN CA HA sing N N 160 GLN C O doub N N 161 GLN C OXT sing N N 162 GLN CB CG sing N N 163 GLN CB HB2 sing N N 164 GLN CB HB3 sing N N 165 GLN CG CD sing N N 166 GLN CG HG2 sing N N 167 GLN CG HG3 sing N N 168 GLN CD OE1 doub N N 169 GLN CD NE2 sing N N 170 GLN NE2 HE21 sing N N 171 GLN NE2 HE22 sing N N 172 GLN OXT HXT sing N N 173 GLU N CA sing N N 174 GLU N H sing N N 175 GLU N H2 sing N N 176 GLU CA C sing N N 177 GLU CA CB sing N N 178 GLU CA HA sing N N 179 GLU C O doub N N 180 GLU C OXT sing N N 181 GLU CB CG sing N N 182 GLU CB HB2 sing N N 183 GLU CB HB3 sing N N 184 GLU CG CD sing N N 185 GLU CG HG2 sing N N 186 GLU CG HG3 sing N N 187 GLU CD OE1 doub N N 188 GLU CD OE2 sing N N 189 GLU OE2 HE2 sing N N 190 GLU OXT HXT sing N N 191 GLY N CA sing N N 192 GLY N H sing N N 193 GLY N H2 sing N N 194 GLY CA C sing N N 195 GLY CA HA2 sing N N 196 GLY CA HA3 sing N N 197 GLY C O doub N N 198 GLY C OXT sing N N 199 GLY OXT HXT sing N N 200 HIS N CA sing N N 201 HIS N H sing N N 202 HIS N H2 sing N N 203 HIS CA C sing N N 204 HIS CA CB sing N N 205 HIS CA HA sing N N 206 HIS C O doub N N 207 HIS C OXT sing N N 208 HIS CB CG sing N N 209 HIS CB HB2 sing N N 210 HIS CB HB3 sing N N 211 HIS CG ND1 sing Y N 212 HIS CG CD2 doub Y N 213 HIS ND1 CE1 doub Y N 214 HIS ND1 HD1 sing N N 215 HIS CD2 NE2 sing Y N 216 HIS CD2 HD2 sing N N 217 HIS CE1 NE2 sing Y N 218 HIS CE1 HE1 sing N N 219 HIS NE2 HE2 sing N N 220 HIS OXT HXT sing N N 221 HOH O H1 sing N N 222 HOH O H2 sing N N 223 ILE N CA sing N N 224 ILE N H sing N N 225 ILE N H2 sing N N 226 ILE CA C sing N N 227 ILE CA CB sing N N 228 ILE CA HA sing N N 229 ILE C O doub N N 230 ILE C OXT sing N N 231 ILE CB CG1 sing N N 232 ILE CB CG2 sing N N 233 ILE CB HB sing N N 234 ILE CG1 CD1 sing N N 235 ILE CG1 HG12 sing N N 236 ILE CG1 HG13 sing N N 237 ILE CG2 HG21 sing N N 238 ILE CG2 HG22 sing N N 239 ILE CG2 HG23 sing N N 240 ILE CD1 HD11 sing N N 241 ILE CD1 HD12 sing N N 242 ILE CD1 HD13 sing N N 243 ILE OXT HXT sing N N 244 LEU N CA sing N N 245 LEU N H sing N N 246 LEU N H2 sing N N 247 LEU CA C sing N N 248 LEU CA CB sing N N 249 LEU CA HA sing N N 250 LEU C O doub N N 251 LEU C OXT sing N N 252 LEU CB CG sing N N 253 LEU CB HB2 sing N N 254 LEU CB HB3 sing N N 255 LEU CG CD1 sing N N 256 LEU CG CD2 sing N N 257 LEU CG HG sing N N 258 LEU CD1 HD11 sing N N 259 LEU CD1 HD12 sing N N 260 LEU CD1 HD13 sing N N 261 LEU CD2 HD21 sing N N 262 LEU CD2 HD22 sing N N 263 LEU CD2 HD23 sing N N 264 LEU OXT HXT sing N N 265 LYS N CA sing N N 266 LYS N H sing N N 267 LYS N H2 sing N N 268 LYS CA C sing N N 269 LYS CA CB sing N N 270 LYS CA HA sing N N 271 LYS C O doub N N 272 LYS C OXT sing N N 273 LYS CB CG sing N N 274 LYS CB HB2 sing N N 275 LYS CB HB3 sing N N 276 LYS CG CD sing N N 277 LYS CG HG2 sing N N 278 LYS CG HG3 sing N N 279 LYS CD CE sing N N 280 LYS CD HD2 sing N N 281 LYS CD HD3 sing N N 282 LYS CE NZ sing N N 283 LYS CE HE2 sing N N 284 LYS CE HE3 sing N N 285 LYS NZ HZ1 sing N N 286 LYS NZ HZ2 sing N N 287 LYS NZ HZ3 sing N N 288 LYS OXT HXT sing N N 289 MET N CA sing N N 290 MET N H sing N N 291 MET N H2 sing N N 292 MET CA C sing N N 293 MET CA CB sing N N 294 MET CA HA sing N N 295 MET C O doub N N 296 MET C OXT sing N N 297 MET CB CG sing N N 298 MET CB HB2 sing N N 299 MET CB HB3 sing N N 300 MET CG SD sing N N 301 MET CG HG2 sing N N 302 MET CG HG3 sing N N 303 MET SD CE sing N N 304 MET CE HE1 sing N N 305 MET CE HE2 sing N N 306 MET CE HE3 sing N N 307 MET OXT HXT sing N N 308 PHE N CA sing N N 309 PHE N H sing N N 310 PHE N H2 sing N N 311 PHE CA C sing N N 312 PHE CA CB sing N N 313 PHE CA HA sing N N 314 PHE C O doub N N 315 PHE C OXT sing N N 316 PHE CB CG sing N N 317 PHE CB HB2 sing N N 318 PHE CB HB3 sing N N 319 PHE CG CD1 doub Y N 320 PHE CG CD2 sing Y N 321 PHE CD1 CE1 sing Y N 322 PHE CD1 HD1 sing N N 323 PHE CD2 CE2 doub Y N 324 PHE CD2 HD2 sing N N 325 PHE CE1 CZ doub Y N 326 PHE CE1 HE1 sing N N 327 PHE CE2 CZ sing Y N 328 PHE CE2 HE2 sing N N 329 PHE CZ HZ sing N N 330 PHE OXT HXT sing N N 331 PRO N CA sing N N 332 PRO N CD sing N N 333 PRO N H sing N N 334 PRO CA C sing N N 335 PRO CA CB sing N N 336 PRO CA HA sing N N 337 PRO C O doub N N 338 PRO C OXT sing N N 339 PRO CB CG sing N N 340 PRO CB HB2 sing N N 341 PRO CB HB3 sing N N 342 PRO CG CD sing N N 343 PRO CG HG2 sing N N 344 PRO CG HG3 sing N N 345 PRO CD HD2 sing N N 346 PRO CD HD3 sing N N 347 PRO OXT HXT sing N N 348 SER N CA sing N N 349 SER N H sing N N 350 SER N H2 sing N N 351 SER CA C sing N N 352 SER CA CB sing N N 353 SER CA HA sing N N 354 SER C O doub N N 355 SER C OXT sing N N 356 SER CB OG sing N N 357 SER CB HB2 sing N N 358 SER CB HB3 sing N N 359 SER OG HG sing N N 360 SER OXT HXT sing N N 361 THR N CA sing N N 362 THR N H sing N N 363 THR N H2 sing N N 364 THR CA C sing N N 365 THR CA CB sing N N 366 THR CA HA sing N N 367 THR C O doub N N 368 THR C OXT sing N N 369 THR CB OG1 sing N N 370 THR CB CG2 sing N N 371 THR CB HB sing N N 372 THR OG1 HG1 sing N N 373 THR CG2 HG21 sing N N 374 THR CG2 HG22 sing N N 375 THR CG2 HG23 sing N N 376 THR OXT HXT sing N N 377 TRP N CA sing N N 378 TRP N H sing N N 379 TRP N H2 sing N N 380 TRP CA C sing N N 381 TRP CA CB sing N N 382 TRP CA HA sing N N 383 TRP C O doub N N 384 TRP C OXT sing N N 385 TRP CB CG sing N N 386 TRP CB HB2 sing N N 387 TRP CB HB3 sing N N 388 TRP CG CD1 doub Y N 389 TRP CG CD2 sing Y N 390 TRP CD1 NE1 sing Y N 391 TRP CD1 HD1 sing N N 392 TRP CD2 CE2 doub Y N 393 TRP CD2 CE3 sing Y N 394 TRP NE1 CE2 sing Y N 395 TRP NE1 HE1 sing N N 396 TRP CE2 CZ2 sing Y N 397 TRP CE3 CZ3 doub Y N 398 TRP CE3 HE3 sing N N 399 TRP CZ2 CH2 doub Y N 400 TRP CZ2 HZ2 sing N N 401 TRP CZ3 CH2 sing Y N 402 TRP CZ3 HZ3 sing N N 403 TRP CH2 HH2 sing N N 404 TRP OXT HXT sing N N 405 TYR N CA sing N N 406 TYR N H sing N N 407 TYR N H2 sing N N 408 TYR CA C sing N N 409 TYR CA CB sing N N 410 TYR CA HA sing N N 411 TYR C O doub N N 412 TYR C OXT sing N N 413 TYR CB CG sing N N 414 TYR CB HB2 sing N N 415 TYR CB HB3 sing N N 416 TYR CG CD1 doub Y N 417 TYR CG CD2 sing Y N 418 TYR CD1 CE1 sing Y N 419 TYR CD1 HD1 sing N N 420 TYR CD2 CE2 doub Y N 421 TYR CD2 HD2 sing N N 422 TYR CE1 CZ doub Y N 423 TYR CE1 HE1 sing N N 424 TYR CE2 CZ sing Y N 425 TYR CE2 HE2 sing N N 426 TYR CZ OH sing N N 427 TYR OH HH sing N N 428 TYR OXT HXT sing N N 429 VAL N CA sing N N 430 VAL N H sing N N 431 VAL N H2 sing N N 432 VAL CA C sing N N 433 VAL CA CB sing N N 434 VAL CA HA sing N N 435 VAL C O doub N N 436 VAL C OXT sing N N 437 VAL CB CG1 sing N N 438 VAL CB CG2 sing N N 439 VAL CB HB sing N N 440 VAL CG1 HG11 sing N N 441 VAL CG1 HG12 sing N N 442 VAL CG1 HG13 sing N N 443 VAL CG2 HG21 sing N N 444 VAL CG2 HG22 sing N N 445 VAL CG2 HG23 sing N N 446 VAL OXT HXT sing N N 447 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 8SC _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 8SC _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4KSY _pdbx_initial_refinement_model.details ? # _space_group.id 1 _space_group.name_H-M_alt 'P 41 21 2' _space_group.name_Hall 'P 4abw 2nw' _space_group.IT_number 92 _space_group.crystal_system tetragonal # _atom_sites.entry_id 7Q3B _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009031 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009031 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.027975 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? F ? ? 8.95735 ? 7.27484 ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 15.80542 1.70748 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 1.42069 35.72801 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_