data_7Q3W
# 
_entry.id   7Q3W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.384 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7Q3W         pdb_00007q3w 10.2210/pdb7q3w/pdb 
WWPDB D_1292118942 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2022-11-09 
2 'Structure model' 1 1 2024-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 2 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom                
2 2 'Structure model' chem_comp_bond                
3 2 'Structure model' pdbx_initial_refinement_model 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7Q3W 
_pdbx_database_status.recvd_initial_deposition_date   2021-10-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_pdbx_contact_author.id                 2 
_pdbx_contact_author.email              guichou@cbs.cnrs.fr 
_pdbx_contact_author.name_first         Jean-Francois 
_pdbx_contact_author.name_last          Guichou 
_pdbx_contact_author.name_mi            ? 
_pdbx_contact_author.role               'principal investigator/group leader' 
_pdbx_contact_author.identifier_ORCID   0000-0002-7699-3235 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Duclovel, C.'   1 0000-0002-6908-3284 
'Gelin, M.'      2 ?                   
'Krimm, I.'      3 ?                   
'Cerdan, R.'     4 ?                   
'Guichou, J.-F.' 5 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Crystallographic screening using ultra-low-molecular-weight ligands to guide drug design of PfCCT inhibitors.' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Duclovel, C.'  1 ? 
primary 'Gelin, M.'     2 ? 
primary 'Wein, S.'      3 ? 
primary 'Wengelnik, K.' 4 ? 
primary 'Krimm, I.'     5 ? 
primary 'Guichou, J.F.' 6 ? 
primary 'Cerdan, R.'    7 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cholinephosphate cytidylyltransferase' 20810.123 1   2.7.7.15 ? ? ? 
2 non-polymer syn Guanidinium                             60.078    1   ?        ? ? ? 
3 non-polymer syn '(R)-2-Aminobutanamide'                 102.135   3   ?        ? ? ? 
4 water       nat water                                   18.015    133 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GHMAVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDN
ETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQR
TEGVSTTDLIVRILKNYEDY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GHMAVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDN
ETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQR
TEGVSTTDLIVRILKNYEDY
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 Guanidinium             GZ6 
3 '(R)-2-Aminobutanamide' 8R1 
4 water                   HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   HIS n 
1 3   MET n 
1 4   ALA n 
1 5   VAL n 
1 6   PRO n 
1 7   ASP n 
1 8   ASP n 
1 9   ASP n 
1 10  ASP n 
1 11  ASP n 
1 12  ASP n 
1 13  ASP n 
1 14  ASN n 
1 15  SER n 
1 16  ASN n 
1 17  ASP n 
1 18  GLU n 
1 19  SER n 
1 20  GLU n 
1 21  TYR n 
1 22  GLU n 
1 23  SER n 
1 24  SER n 
1 25  GLN n 
1 26  MET n 
1 27  ASP n 
1 28  SER n 
1 29  GLU n 
1 30  LYS n 
1 31  ASN n 
1 32  LYS n 
1 33  GLY n 
1 34  SER n 
1 35  ILE n 
1 36  LYS n 
1 37  ASN n 
1 38  SER n 
1 39  LYS n 
1 40  ASN n 
1 41  VAL n 
1 42  VAL n 
1 43  ILE n 
1 44  TYR n 
1 45  ALA n 
1 46  ASP n 
1 47  GLY n 
1 48  VAL n 
1 49  TYR n 
1 50  ASP n 
1 51  MET n 
1 52  LEU n 
1 53  HIS n 
1 54  LEU n 
1 55  GLY n 
1 56  HIS n 
1 57  MET n 
1 58  LYS n 
1 59  GLN n 
1 60  LEU n 
1 61  GLU n 
1 62  GLN n 
1 63  ALA n 
1 64  LYS n 
1 65  LYS n 
1 66  LEU n 
1 67  PHE n 
1 68  GLU n 
1 69  ASN n 
1 70  THR n 
1 71  THR n 
1 72  LEU n 
1 73  ILE n 
1 74  VAL n 
1 75  GLY n 
1 76  VAL n 
1 77  THR n 
1 78  SER n 
1 79  ASP n 
1 80  ASN n 
1 81  GLU n 
1 82  THR n 
1 83  LYS n 
1 84  LEU n 
1 85  PHE n 
1 86  LYS n 
1 87  GLY n 
1 88  GLN n 
1 89  VAL n 
1 90  VAL n 
1 91  GLN n 
1 92  THR n 
1 93  LEU n 
1 94  GLU n 
1 95  GLU n 
1 96  ARG n 
1 97  THR n 
1 98  GLU n 
1 99  THR n 
1 100 LEU n 
1 101 LYS n 
1 102 HIS n 
1 103 ILE n 
1 104 ARG n 
1 105 TRP n 
1 106 VAL n 
1 107 ASP n 
1 108 GLU n 
1 109 ILE n 
1 110 ILE n 
1 111 SER n 
1 112 PRO n 
1 113 CYS n 
1 114 PRO n 
1 115 TRP n 
1 116 VAL n 
1 117 VAL n 
1 118 THR n 
1 119 PRO n 
1 120 GLU n 
1 121 PHE n 
1 122 LEU n 
1 123 GLU n 
1 124 LYS n 
1 125 TYR n 
1 126 LYS n 
1 127 ILE n 
1 128 ASP n 
1 129 TYR n 
1 130 VAL n 
1 131 ALA n 
1 132 HIS n 
1 133 ASP n 
1 134 ASP n 
1 135 ILE n 
1 136 PRO n 
1 137 TYR n 
1 138 ALA n 
1 139 ASN n 
1 140 ASN n 
1 141 GLN n 
1 142 LYS n 
1 143 GLU n 
1 144 ASP n 
1 145 ILE n 
1 146 TYR n 
1 147 ALA n 
1 148 TRP n 
1 149 LEU n 
1 150 LYS n 
1 151 ARG n 
1 152 ALA n 
1 153 GLY n 
1 154 LYS n 
1 155 PHE n 
1 156 LYS n 
1 157 ALA n 
1 158 THR n 
1 159 GLN n 
1 160 ARG n 
1 161 THR n 
1 162 GLU n 
1 163 GLY n 
1 164 VAL n 
1 165 SER n 
1 166 THR n 
1 167 THR n 
1 168 ASP n 
1 169 LEU n 
1 170 ILE n 
1 171 VAL n 
1 172 ARG n 
1 173 ILE n 
1 174 LEU n 
1 175 LYS n 
1 176 ASN n 
1 177 TYR n 
1 178 GLU n 
1 179 ASP n 
1 180 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   180 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ctP, MAL13P1.86' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Plasmodium falciparum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     5833 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
8R1 non-polymer         . '(R)-2-Aminobutanamide' '(2R)-2-azanylbutanamide' 'C4 H10 N2 O'    102.135 
ALA 'L-peptide linking' y ALANINE                 ?                         'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ?                         'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ?                         'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ?                         'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                ?                         'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE               ?                         'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ?                         'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ?                         'C2 H5 N O2'     75.067  
GZ6 non-polymer         . Guanidinium             ?                         'C H6 N3 1'      60.078  
HIS 'L-peptide linking' y HISTIDINE               ?                         'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ?                         'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ?                         'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                 ?                         'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ?                         'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE              ?                         'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE           ?                         'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                 ?                         'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                  ?                         'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ?                         'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ?                         'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                ?                         'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ?                         'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   578 ?   ?   ?   A . n 
A 1 2   HIS 2   579 ?   ?   ?   A . n 
A 1 3   MET 3   580 ?   ?   ?   A . n 
A 1 4   ALA 4   581 ?   ?   ?   A . n 
A 1 5   VAL 5   582 ?   ?   ?   A . n 
A 1 6   PRO 6   583 ?   ?   ?   A . n 
A 1 7   ASP 7   584 ?   ?   ?   A . n 
A 1 8   ASP 8   585 ?   ?   ?   A . n 
A 1 9   ASP 9   586 ?   ?   ?   A . n 
A 1 10  ASP 10  587 ?   ?   ?   A . n 
A 1 11  ASP 11  588 ?   ?   ?   A . n 
A 1 12  ASP 12  589 ?   ?   ?   A . n 
A 1 13  ASP 13  590 ?   ?   ?   A . n 
A 1 14  ASN 14  591 ?   ?   ?   A . n 
A 1 15  SER 15  592 ?   ?   ?   A . n 
A 1 16  ASN 16  593 ?   ?   ?   A . n 
A 1 17  ASP 17  594 ?   ?   ?   A . n 
A 1 18  GLU 18  595 ?   ?   ?   A . n 
A 1 19  SER 19  596 ?   ?   ?   A . n 
A 1 20  GLU 20  597 ?   ?   ?   A . n 
A 1 21  TYR 21  598 ?   ?   ?   A . n 
A 1 22  GLU 22  599 ?   ?   ?   A . n 
A 1 23  SER 23  600 ?   ?   ?   A . n 
A 1 24  SER 24  601 ?   ?   ?   A . n 
A 1 25  GLN 25  602 ?   ?   ?   A . n 
A 1 26  MET 26  603 ?   ?   ?   A . n 
A 1 27  ASP 27  604 ?   ?   ?   A . n 
A 1 28  SER 28  605 ?   ?   ?   A . n 
A 1 29  GLU 29  606 ?   ?   ?   A . n 
A 1 30  LYS 30  607 ?   ?   ?   A . n 
A 1 31  ASN 31  608 ?   ?   ?   A . n 
A 1 32  LYS 32  609 ?   ?   ?   A . n 
A 1 33  GLY 33  610 ?   ?   ?   A . n 
A 1 34  SER 34  611 ?   ?   ?   A . n 
A 1 35  ILE 35  612 ?   ?   ?   A . n 
A 1 36  LYS 36  613 ?   ?   ?   A . n 
A 1 37  ASN 37  614 ?   ?   ?   A . n 
A 1 38  SER 38  615 615 SER SER A . n 
A 1 39  LYS 39  616 616 LYS LYS A . n 
A 1 40  ASN 40  617 617 ASN ASN A . n 
A 1 41  VAL 41  618 618 VAL VAL A . n 
A 1 42  VAL 42  619 619 VAL VAL A . n 
A 1 43  ILE 43  620 620 ILE ILE A . n 
A 1 44  TYR 44  621 621 TYR TYR A . n 
A 1 45  ALA 45  622 622 ALA ALA A . n 
A 1 46  ASP 46  623 623 ASP ASP A . n 
A 1 47  GLY 47  624 624 GLY GLY A . n 
A 1 48  VAL 48  625 625 VAL VAL A . n 
A 1 49  TYR 49  626 626 TYR TYR A . n 
A 1 50  ASP 50  627 627 ASP ASP A . n 
A 1 51  MET 51  628 628 MET MET A . n 
A 1 52  LEU 52  629 629 LEU LEU A . n 
A 1 53  HIS 53  630 630 HIS HIS A . n 
A 1 54  LEU 54  631 631 LEU LEU A . n 
A 1 55  GLY 55  632 632 GLY GLY A . n 
A 1 56  HIS 56  633 633 HIS HIS A . n 
A 1 57  MET 57  634 634 MET MET A . n 
A 1 58  LYS 58  635 635 LYS LYS A . n 
A 1 59  GLN 59  636 636 GLN GLN A . n 
A 1 60  LEU 60  637 637 LEU LEU A . n 
A 1 61  GLU 61  638 638 GLU GLU A . n 
A 1 62  GLN 62  639 639 GLN GLN A . n 
A 1 63  ALA 63  640 640 ALA ALA A . n 
A 1 64  LYS 64  641 641 LYS LYS A . n 
A 1 65  LYS 65  642 642 LYS LYS A . n 
A 1 66  LEU 66  643 643 LEU LEU A . n 
A 1 67  PHE 67  644 644 PHE PHE A . n 
A 1 68  GLU 68  645 645 GLU GLU A . n 
A 1 69  ASN 69  646 646 ASN ASN A . n 
A 1 70  THR 70  647 647 THR THR A . n 
A 1 71  THR 71  648 648 THR THR A . n 
A 1 72  LEU 72  649 649 LEU LEU A . n 
A 1 73  ILE 73  650 650 ILE ILE A . n 
A 1 74  VAL 74  651 651 VAL VAL A . n 
A 1 75  GLY 75  652 652 GLY GLY A . n 
A 1 76  VAL 76  653 653 VAL VAL A . n 
A 1 77  THR 77  654 654 THR THR A . n 
A 1 78  SER 78  655 655 SER SER A . n 
A 1 79  ASP 79  656 656 ASP ASP A . n 
A 1 80  ASN 80  657 657 ASN ASN A . n 
A 1 81  GLU 81  658 658 GLU GLU A . n 
A 1 82  THR 82  659 659 THR THR A . n 
A 1 83  LYS 83  660 660 LYS LYS A . n 
A 1 84  LEU 84  661 661 LEU LEU A . n 
A 1 85  PHE 85  662 662 PHE PHE A . n 
A 1 86  LYS 86  663 663 LYS LYS A . n 
A 1 87  GLY 87  664 664 GLY GLY A . n 
A 1 88  GLN 88  665 665 GLN GLN A . n 
A 1 89  VAL 89  666 666 VAL VAL A . n 
A 1 90  VAL 90  667 667 VAL VAL A . n 
A 1 91  GLN 91  668 668 GLN GLN A . n 
A 1 92  THR 92  669 669 THR THR A . n 
A 1 93  LEU 93  670 670 LEU LEU A . n 
A 1 94  GLU 94  671 671 GLU GLU A . n 
A 1 95  GLU 95  672 672 GLU GLU A . n 
A 1 96  ARG 96  673 673 ARG ARG A . n 
A 1 97  THR 97  674 674 THR THR A . n 
A 1 98  GLU 98  675 675 GLU GLU A . n 
A 1 99  THR 99  676 676 THR THR A . n 
A 1 100 LEU 100 677 677 LEU LEU A . n 
A 1 101 LYS 101 678 678 LYS LYS A . n 
A 1 102 HIS 102 679 679 HIS HIS A . n 
A 1 103 ILE 103 680 680 ILE ILE A . n 
A 1 104 ARG 104 681 681 ARG ARG A . n 
A 1 105 TRP 105 682 682 TRP TRP A . n 
A 1 106 VAL 106 683 683 VAL VAL A . n 
A 1 107 ASP 107 684 684 ASP ASP A . n 
A 1 108 GLU 108 685 685 GLU GLU A . n 
A 1 109 ILE 109 686 686 ILE ILE A . n 
A 1 110 ILE 110 687 687 ILE ILE A . n 
A 1 111 SER 111 688 688 SER SER A . n 
A 1 112 PRO 112 689 689 PRO PRO A . n 
A 1 113 CYS 113 690 690 CYS CYS A . n 
A 1 114 PRO 114 691 691 PRO PRO A . n 
A 1 115 TRP 115 692 692 TRP TRP A . n 
A 1 116 VAL 116 693 693 VAL VAL A . n 
A 1 117 VAL 117 694 694 VAL VAL A . n 
A 1 118 THR 118 695 695 THR THR A . n 
A 1 119 PRO 119 696 696 PRO PRO A . n 
A 1 120 GLU 120 697 697 GLU GLU A . n 
A 1 121 PHE 121 698 698 PHE PHE A . n 
A 1 122 LEU 122 699 699 LEU LEU A . n 
A 1 123 GLU 123 700 700 GLU GLU A . n 
A 1 124 LYS 124 701 701 LYS LYS A . n 
A 1 125 TYR 125 702 702 TYR TYR A . n 
A 1 126 LYS 126 703 703 LYS LYS A . n 
A 1 127 ILE 127 704 704 ILE ILE A . n 
A 1 128 ASP 128 705 705 ASP ASP A . n 
A 1 129 TYR 129 706 706 TYR TYR A . n 
A 1 130 VAL 130 707 707 VAL VAL A . n 
A 1 131 ALA 131 708 708 ALA ALA A . n 
A 1 132 HIS 132 709 709 HIS HIS A . n 
A 1 133 ASP 133 710 710 ASP ASP A . n 
A 1 134 ASP 134 729 ?   ?   ?   A . n 
A 1 135 ILE 135 730 ?   ?   ?   A . n 
A 1 136 PRO 136 731 ?   ?   ?   A . n 
A 1 137 TYR 137 732 ?   ?   ?   A . n 
A 1 138 ALA 138 733 ?   ?   ?   A . n 
A 1 139 ASN 139 734 ?   ?   ?   A . n 
A 1 140 ASN 140 735 ?   ?   ?   A . n 
A 1 141 GLN 141 736 ?   ?   ?   A . n 
A 1 142 LYS 142 737 ?   ?   ?   A . n 
A 1 143 GLU 143 738 ?   ?   ?   A . n 
A 1 144 ASP 144 739 739 ASP ASP A . n 
A 1 145 ILE 145 740 740 ILE ILE A . n 
A 1 146 TYR 146 741 741 TYR TYR A . n 
A 1 147 ALA 147 742 742 ALA ALA A . n 
A 1 148 TRP 148 743 743 TRP TRP A . n 
A 1 149 LEU 149 744 744 LEU LEU A . n 
A 1 150 LYS 150 745 745 LYS LYS A . n 
A 1 151 ARG 151 746 746 ARG ARG A . n 
A 1 152 ALA 152 747 747 ALA ALA A . n 
A 1 153 GLY 153 748 748 GLY GLY A . n 
A 1 154 LYS 154 749 749 LYS LYS A . n 
A 1 155 PHE 155 750 750 PHE PHE A . n 
A 1 156 LYS 156 751 751 LYS LYS A . n 
A 1 157 ALA 157 752 752 ALA ALA A . n 
A 1 158 THR 158 753 753 THR THR A . n 
A 1 159 GLN 159 754 754 GLN GLN A . n 
A 1 160 ARG 160 755 755 ARG ARG A . n 
A 1 161 THR 161 756 756 THR THR A . n 
A 1 162 GLU 162 757 757 GLU GLU A . n 
A 1 163 GLY 163 758 758 GLY GLY A . n 
A 1 164 VAL 164 759 759 VAL VAL A . n 
A 1 165 SER 165 760 760 SER SER A . n 
A 1 166 THR 166 761 761 THR THR A . n 
A 1 167 THR 167 762 762 THR THR A . n 
A 1 168 ASP 168 763 763 ASP ASP A . n 
A 1 169 LEU 169 764 764 LEU LEU A . n 
A 1 170 ILE 170 765 765 ILE ILE A . n 
A 1 171 VAL 171 766 766 VAL VAL A . n 
A 1 172 ARG 172 767 767 ARG ARG A . n 
A 1 173 ILE 173 768 768 ILE ILE A . n 
A 1 174 LEU 174 769 769 LEU LEU A . n 
A 1 175 LYS 175 770 770 LYS LYS A . n 
A 1 176 ASN 176 771 771 ASN ASN A . n 
A 1 177 TYR 177 772 772 TYR TYR A . n 
A 1 178 GLU 178 773 773 GLU GLU A . n 
A 1 179 ASP 179 774 774 ASP ASP A . n 
A 1 180 TYR 180 775 775 TYR TYR A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 GZ6 1   801  801 GZ6 GZ6 A . 
C 3 8R1 1   802  1   8R1 LIG A . 
D 3 8R1 1   803  3   8R1 LIG A . 
E 3 8R1 1   804  5   8R1 LIG A . 
F 4 HOH 1   901  127 HOH HOH A . 
F 4 HOH 2   902  120 HOH HOH A . 
F 4 HOH 3   903  113 HOH HOH A . 
F 4 HOH 4   904  161 HOH HOH A . 
F 4 HOH 5   905  88  HOH HOH A . 
F 4 HOH 6   906  106 HOH HOH A . 
F 4 HOH 7   907  163 HOH HOH A . 
F 4 HOH 8   908  19  HOH HOH A . 
F 4 HOH 9   909  92  HOH HOH A . 
F 4 HOH 10  910  80  HOH HOH A . 
F 4 HOH 11  911  143 HOH HOH A . 
F 4 HOH 12  912  29  HOH HOH A . 
F 4 HOH 13  913  43  HOH HOH A . 
F 4 HOH 14  914  48  HOH HOH A . 
F 4 HOH 15  915  65  HOH HOH A . 
F 4 HOH 16  916  45  HOH HOH A . 
F 4 HOH 17  917  7   HOH HOH A . 
F 4 HOH 18  918  74  HOH HOH A . 
F 4 HOH 19  919  8   HOH HOH A . 
F 4 HOH 20  920  4   HOH HOH A . 
F 4 HOH 21  921  11  HOH HOH A . 
F 4 HOH 22  922  40  HOH HOH A . 
F 4 HOH 23  923  96  HOH HOH A . 
F 4 HOH 24  924  5   HOH HOH A . 
F 4 HOH 25  925  85  HOH HOH A . 
F 4 HOH 26  926  110 HOH HOH A . 
F 4 HOH 27  927  30  HOH HOH A . 
F 4 HOH 28  928  69  HOH HOH A . 
F 4 HOH 29  929  22  HOH HOH A . 
F 4 HOH 30  930  37  HOH HOH A . 
F 4 HOH 31  931  16  HOH HOH A . 
F 4 HOH 32  932  14  HOH HOH A . 
F 4 HOH 33  933  31  HOH HOH A . 
F 4 HOH 34  934  27  HOH HOH A . 
F 4 HOH 35  935  93  HOH HOH A . 
F 4 HOH 36  936  55  HOH HOH A . 
F 4 HOH 37  937  59  HOH HOH A . 
F 4 HOH 38  938  76  HOH HOH A . 
F 4 HOH 39  939  128 HOH HOH A . 
F 4 HOH 40  940  49  HOH HOH A . 
F 4 HOH 41  941  3   HOH HOH A . 
F 4 HOH 42  942  17  HOH HOH A . 
F 4 HOH 43  943  9   HOH HOH A . 
F 4 HOH 44  944  114 HOH HOH A . 
F 4 HOH 45  945  39  HOH HOH A . 
F 4 HOH 46  946  28  HOH HOH A . 
F 4 HOH 47  947  61  HOH HOH A . 
F 4 HOH 48  948  84  HOH HOH A . 
F 4 HOH 49  949  1   HOH HOH A . 
F 4 HOH 50  950  89  HOH HOH A . 
F 4 HOH 51  951  56  HOH HOH A . 
F 4 HOH 52  952  78  HOH HOH A . 
F 4 HOH 53  953  38  HOH HOH A . 
F 4 HOH 54  954  25  HOH HOH A . 
F 4 HOH 55  955  108 HOH HOH A . 
F 4 HOH 56  956  36  HOH HOH A . 
F 4 HOH 57  957  168 HOH HOH A . 
F 4 HOH 58  958  60  HOH HOH A . 
F 4 HOH 59  959  20  HOH HOH A . 
F 4 HOH 60  960  12  HOH HOH A . 
F 4 HOH 61  961  47  HOH HOH A . 
F 4 HOH 62  962  129 HOH HOH A . 
F 4 HOH 63  963  67  HOH HOH A . 
F 4 HOH 64  964  33  HOH HOH A . 
F 4 HOH 65  965  24  HOH HOH A . 
F 4 HOH 66  966  72  HOH HOH A . 
F 4 HOH 67  967  90  HOH HOH A . 
F 4 HOH 68  968  26  HOH HOH A . 
F 4 HOH 69  969  54  HOH HOH A . 
F 4 HOH 70  970  32  HOH HOH A . 
F 4 HOH 71  971  41  HOH HOH A . 
F 4 HOH 72  972  91  HOH HOH A . 
F 4 HOH 73  973  94  HOH HOH A . 
F 4 HOH 74  974  111 HOH HOH A . 
F 4 HOH 75  975  34  HOH HOH A . 
F 4 HOH 76  976  52  HOH HOH A . 
F 4 HOH 77  977  83  HOH HOH A . 
F 4 HOH 78  978  6   HOH HOH A . 
F 4 HOH 79  979  23  HOH HOH A . 
F 4 HOH 80  980  167 HOH HOH A . 
F 4 HOH 81  981  15  HOH HOH A . 
F 4 HOH 82  982  62  HOH HOH A . 
F 4 HOH 83  983  98  HOH HOH A . 
F 4 HOH 84  984  2   HOH HOH A . 
F 4 HOH 85  985  86  HOH HOH A . 
F 4 HOH 86  986  44  HOH HOH A . 
F 4 HOH 87  987  13  HOH HOH A . 
F 4 HOH 88  988  50  HOH HOH A . 
F 4 HOH 89  989  10  HOH HOH A . 
F 4 HOH 90  990  53  HOH HOH A . 
F 4 HOH 91  991  35  HOH HOH A . 
F 4 HOH 92  992  136 HOH HOH A . 
F 4 HOH 93  993  21  HOH HOH A . 
F 4 HOH 94  994  171 HOH HOH A . 
F 4 HOH 95  995  46  HOH HOH A . 
F 4 HOH 96  996  51  HOH HOH A . 
F 4 HOH 97  997  126 HOH HOH A . 
F 4 HOH 98  998  66  HOH HOH A . 
F 4 HOH 99  999  147 HOH HOH A . 
F 4 HOH 100 1000 63  HOH HOH A . 
F 4 HOH 101 1001 95  HOH HOH A . 
F 4 HOH 102 1002 18  HOH HOH A . 
F 4 HOH 103 1003 123 HOH HOH A . 
F 4 HOH 104 1004 140 HOH HOH A . 
F 4 HOH 105 1005 164 HOH HOH A . 
F 4 HOH 106 1006 139 HOH HOH A . 
F 4 HOH 107 1007 105 HOH HOH A . 
F 4 HOH 108 1008 104 HOH HOH A . 
F 4 HOH 109 1009 160 HOH HOH A . 
F 4 HOH 110 1010 115 HOH HOH A . 
F 4 HOH 111 1011 102 HOH HOH A . 
F 4 HOH 112 1012 79  HOH HOH A . 
F 4 HOH 113 1013 170 HOH HOH A . 
F 4 HOH 114 1014 122 HOH HOH A . 
F 4 HOH 115 1015 135 HOH HOH A . 
F 4 HOH 116 1016 71  HOH HOH A . 
F 4 HOH 117 1017 73  HOH HOH A . 
F 4 HOH 118 1018 58  HOH HOH A . 
F 4 HOH 119 1019 77  HOH HOH A . 
F 4 HOH 120 1020 132 HOH HOH A . 
F 4 HOH 121 1021 131 HOH HOH A . 
F 4 HOH 122 1022 70  HOH HOH A . 
F 4 HOH 123 1023 97  HOH HOH A . 
F 4 HOH 124 1024 100 HOH HOH A . 
F 4 HOH 125 1025 169 HOH HOH A . 
F 4 HOH 126 1026 134 HOH HOH A . 
F 4 HOH 127 1027 166 HOH HOH A . 
F 4 HOH 128 1028 157 HOH HOH A . 
F 4 HOH 129 1029 81  HOH HOH A . 
F 4 HOH 130 1030 109 HOH HOH A . 
F 4 HOH 131 1031 42  HOH HOH A . 
F 4 HOH 132 1032 68  HOH HOH A . 
F 4 HOH 133 1033 118 HOH HOH A . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A TYR 741 ? CG  ? A TYR 146 CG  
2 1 Y 1 A TYR 741 ? CD1 ? A TYR 146 CD1 
3 1 Y 1 A TYR 741 ? CD2 ? A TYR 146 CD2 
4 1 Y 1 A TYR 741 ? CE1 ? A TYR 146 CE1 
5 1 Y 1 A TYR 741 ? CE2 ? A TYR 146 CE2 
6 1 Y 1 A TYR 741 ? CZ  ? A TYR 146 CZ  
7 1 Y 1 A TYR 741 ? OH  ? A TYR 146 OH  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? v1.19 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? .     2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27  3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .     4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .     5 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7Q3W 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     50.918 
_cell.length_a_esd                 ? 
_cell.length_b                     69.002 
_cell.length_b_esd                 ? 
_cell.length_c                     116.702 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7Q3W 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7Q3W 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.46 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         50.06 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;PEG 4000 19%, TRIS pH8 0.1M
Guanidine HCl 6-7-8-9-10%
Glycerol 5-6-7%
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 2M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2021-03-12 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.96546 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE MASSIF-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.96546 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   MASSIF-1 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate                          28.110 
_reflns.entry_id                                       7Q3W 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              1.421 
_reflns.d_resolution_low                               59.396 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     20816 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     ? 
_reflns.observed_criterion_sigma_I                     ? 
_reflns.percent_possible_obs                           92.600 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                4.400 
_reflns.pdbx_Rmerge_I_obs                              0.056 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                ? 
_reflns.pdbx_netI_over_av_sigmaI                       ? 
_reflns.pdbx_netI_over_sigmaI                          14.500 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               ? 
_reflns.pdbx_scaling_rejects                           ? 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                0.065 
_reflns.pdbx_Rpim_I_all                                0.032 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       105773 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   0.988 
_reflns.pdbx_CC_star                                   ? 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
_reflns_shell.pdbx_percent_possible_ellipsoidal 
_reflns_shell.pdbx_percent_possible_spherical 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous 
_reflns_shell.pdbx_percent_possible_spherical_anomalous 
_reflns_shell.pdbx_redundancy_anomalous 
_reflns_shell.pdbx_CC_half_anomalous 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous 
_reflns_shell.pdbx_percent_possible_anomalous 
1.421 1.591  ? ? 5986 ? ? ? 1203 78.900 ? ? ? ? 1.024 ? ? ? ? ? ? ? ? 5.000 ? ? ? 1.400  1.148 0.510 ? 1 1 0.537 ? ? ? ? ? ? ? ? ? 
? 
4.670 59.396 ? ? 5164 ? ? ? 1202 98.800 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 4.300 ? ? ? 41.200 0.038 0.019 ? 2 1 0.987 ? ? ? ? ? ? ? ? ? 
? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                84.700 
_refine.B_iso_mean                               35.2339 
_refine.B_iso_min                                18.270 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7Q3W 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.7500 
_refine.ls_d_res_low                             59.4000 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     20794 
_refine.ls_number_reflns_R_free                  1860 
_refine.ls_number_reflns_R_work                  36560 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    95.4700 
_refine.ls_percent_reflns_R_free                 4.8400 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1907 
_refine.ls_R_factor_R_free                       0.2062 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1899 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4ZCT 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 24.0300 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2300 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.7500 
_refine_hist.d_res_low                        59.4000 
_refine_hist.number_atoms_solvent             133 
_refine_hist.number_atoms_total               1251 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       133 
_refine_hist.pdbx_B_iso_mean_ligand           51.93 
_refine_hist.pdbx_B_iso_mean_solvent          41.47 
_refine_hist.pdbx_number_atoms_protein        1088 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.7500 1.8000  3019 . 180 2839 98.0000 . . . 0.3263 0.0000 0.3191 . . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 1.8000 1.8500  3028 . 191 2837 98.0000 . . . 0.3245 0.0000 0.2793 . . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 1.8500 1.9100  3061 . 150 2911 98.0000 . . . 0.2647 0.0000 0.2424 . . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 1.9100 1.9800  2976 . 167 2809 97.0000 . . . 0.2669 0.0000 0.2355 . . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 1.9800 2.0600  2987 . 127 2860 97.0000 . . . 0.2839 0.0000 0.2340 . . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.0600 2.1500  2973 . 136 2837 96.0000 . . . 0.1911 0.0000 0.1962 . . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.1500 2.2600  2981 . 133 2848 95.0000 . . . 0.1921 0.0000 0.1858 . . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.2600 2.4000  2755 . 101 2654 90.0000 . . . 0.2618 0.0000 0.1807 . . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.4000 2.5900  3012 . 118 2894 97.0000 . . . 0.1961 0.0000 0.1873 . . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.5900 2.8500  2945 . 121 2824 96.0000 . . . 0.2657 0.0000 0.2011 . . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 2.8500 3.2600  2927 . 117 2810 95.0000 . . . 0.2197 0.0000 0.1951 . . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 3.2600 4.1100  2864 . 167 2697 92.0000 . . . 0.1711 0.0000 0.1679 . . . . . . . 13 . . . 
'X-RAY DIFFRACTION' 4.1100 59.4000 2892 . 152 2740 93.0000 . . . 0.1767 0.0000 0.1667 . . . . . . . 13 . . . 
# 
_struct.entry_id                     7Q3W 
_struct.title                        
;Crystal structure of the C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase with (R)-2-Aminobutanamide hydrochloride
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7Q3W 
_struct_keywords.text            'Plasmodium Falciparum CCT Inhibitors Fragments, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q8IEE9_PLAF7 
_struct_ref.pdbx_db_accession          Q8IEE9 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETK
LFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKKKKKKKSKGKSFSFDEENEDI
YAWLKRAGKFKATQRTEGVSTTDLIVRILKNYEDY
;
_struct_ref.pdbx_align_begin           581 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              7Q3W 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 180 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8IEE9 
_struct_ref_seq.db_align_beg                  581 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  775 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       581 
_struct_ref_seq.pdbx_auth_seq_align_end       775 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 7Q3W GLY A 1 ? UNP Q8IEE9 ?   ?   'expression tag' 578 1  
1 7Q3W HIS A 2 ? UNP Q8IEE9 ?   ?   'expression tag' 579 2  
1 7Q3W MET A 3 ? UNP Q8IEE9 ?   ?   'expression tag' 580 3  
1 7Q3W ?   A ? ? UNP Q8IEE9 LYS 720 deletion         ?   4  
1 7Q3W ?   A ? ? UNP Q8IEE9 LYS 721 deletion         ?   5  
1 7Q3W ?   A ? ? UNP Q8IEE9 LYS 722 deletion         ?   6  
1 7Q3W ?   A ? ? UNP Q8IEE9 LYS 723 deletion         ?   7  
1 7Q3W ?   A ? ? UNP Q8IEE9 LYS 724 deletion         ?   8  
1 7Q3W ?   A ? ? UNP Q8IEE9 LYS 725 deletion         ?   9  
1 7Q3W ?   A ? ? UNP Q8IEE9 SER 726 deletion         ?   10 
1 7Q3W ?   A ? ? UNP Q8IEE9 LYS 727 deletion         ?   11 
1 7Q3W ?   A ? ? UNP Q8IEE9 GLY 728 deletion         ?   12 
1 7Q3W ?   A ? ? UNP Q8IEE9 LYS 729 deletion         ?   13 
1 7Q3W ?   A ? ? UNP Q8IEE9 SER 730 deletion         ?   14 
1 7Q3W ?   A ? ? UNP Q8IEE9 PHE 731 deletion         ?   15 
1 7Q3W ?   A ? ? UNP Q8IEE9 SER 732 deletion         ?   16 
1 7Q3W ?   A ? ? UNP Q8IEE9 PHE 733 deletion         ?   17 
1 7Q3W ?   A ? ? UNP Q8IEE9 ASP 734 deletion         ?   18 
1 7Q3W ?   A ? ? UNP Q8IEE9 GLU 735 deletion         ?   19 
1 7Q3W ?   A ? ? UNP Q8IEE9 GLU 736 deletion         ?   20 
1 7Q3W ?   A ? ? UNP Q8IEE9 ASN 737 deletion         ?   21 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F 
1 2 A,B,C,D,E,F 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_455 -x-1,-y,z -1.0000000000 0.0000000000 0.0000000000 -50.9180000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 HIS A 53  ? LYS A 65  ? HIS A 630 LYS A 642 1 ? 13 
HELX_P HELX_P2 AA2 SER A 78  ? LYS A 86  ? SER A 655 LYS A 663 1 ? 9  
HELX_P HELX_P3 AA3 THR A 92  ? LYS A 101 ? THR A 669 LYS A 678 1 ? 10 
HELX_P HELX_P4 AA4 THR A 118 ? TYR A 125 ? THR A 695 TYR A 702 1 ? 8  
HELX_P HELX_P5 AA5 TYR A 146 ? ALA A 152 ? TYR A 741 ALA A 747 1 ? 7  
HELX_P HELX_P6 AA6 SER A 165 ? LYS A 175 ? SER A 760 LYS A 770 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           111 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            688 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    112 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     689 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.74 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA1 2 3 ? parallel 
AA1 3 4 ? parallel 
AA1 4 5 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLU A 108 ? CYS A 113 ? GLU A 685 CYS A 690 
AA1 2 THR A 70  ? THR A 77  ? THR A 647 THR A 654 
AA1 3 VAL A 41  ? GLY A 47  ? VAL A 618 GLY A 624 
AA1 4 TYR A 129 ? HIS A 132 ? TYR A 706 HIS A 709 
AA1 5 PHE A 155 ? ALA A 157 ? PHE A 750 ALA A 752 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLU A 108 ? O GLU A 685 N VAL A 74  ? N VAL A 651 
AA1 2 3 O ILE A 73  ? O ILE A 650 N ILE A 43  ? N ILE A 620 
AA1 3 4 N TYR A 44  ? N TYR A 621 O ALA A 131 ? O ALA A 708 
AA1 4 5 N VAL A 130 ? N VAL A 707 O LYS A 156 ? O LYS A 751 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    LYS 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     663 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -124.55 
_pdbx_validate_torsion.psi             -59.85 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     980 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   F 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined -21.7294 -12.7018 -23.6609 0.1771 ? 0.0065  ? -0.0127 ? 0.1531 ? -0.0161 ? 0.2070 ? 2.3845  ? 
-0.3091 ? -0.5695 ? 3.0400  ? 0.1651 ? 3.2699 ? -0.0344 ? 0.1065  ? -0.1646 ? -0.1475 ? -0.0254 ? -0.0877 ? 0.2458  ? 0.0480  ? 
0.0435  ? 
2 'X-RAY DIFFRACTION' ? refined -8.5577  -20.0293 -24.9718 0.4045 ? 0.0886  ? 0.0078  ? 0.4800 ? -0.0029 ? 0.3609 ? 9.0667  ? 
-4.2123 ? -2.1560 ? 2.0749  ? 0.6353 ? 0.8722 ? -0.4510 ? -0.9568 ? -0.4355 ? 0.9487  ? 0.3961  ? -0.5600 ? 0.3302  ? 0.4289  ? 
-0.0071 ? 
3 'X-RAY DIFFRACTION' ? refined -16.6658 2.2150   -4.7203  0.2234 ? -0.0389 ? -0.0008 ? 0.3598 ? -0.0062 ? 0.3130 ? -0.0546 ? 
0.1158  ? -0.2973 ? -0.1694 ? 0.9300 ? 7.3277 ? 0.0723  ? 0.0791  ? 0.0146  ? -0.3198 ? 0.1157  ? -0.1637 ? -0.2984 ? 0.7013  ? 
-0.3100 ? 
4 'X-RAY DIFFRACTION' ? refined -27.3177 -1.2917  -13.2329 0.8170 ? 0.2265  ? 0.3353  ? 0.4905 ? 0.3222  ? 0.6009 ? 2.0000  ? 
2.0001  ? 2.0000  ? 2.0002  ? 1.9998 ? 2.0001 ? 0.0481  ? 1.0721  ? -0.9362 ? 2.4980  ? -0.0317 ? -1.2448 ? -1.9195 ? -0.8560 ? 
-0.0231 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_PDB_ins_code 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_PDB_ins_code 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? A 615 ? ? ? A 706 ? ? 
;chain 'A' and (resid 615 through 706 )
;
2 'X-RAY DIFFRACTION' 2 ? ? A 707 ? ? ? A 752 ? ? 
;chain 'A' and (resid 707 through 752 )
;
3 'X-RAY DIFFRACTION' 3 ? ? A 753 ? ? ? A 775 ? ? 
;chain 'A' and (resid 753 through 775 )
;
4 'X-RAY DIFFRACTION' 4 ? ? A 801 ? ? ? A 801 ? ? 
;chain 'A' and (resid 801 through 801 )
;
# 
_pdbx_entry_details.entry_id                 7Q3W 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 578 ? A GLY 1   
2  1 Y 1 A HIS 579 ? A HIS 2   
3  1 Y 1 A MET 580 ? A MET 3   
4  1 Y 1 A ALA 581 ? A ALA 4   
5  1 Y 1 A VAL 582 ? A VAL 5   
6  1 Y 1 A PRO 583 ? A PRO 6   
7  1 Y 1 A ASP 584 ? A ASP 7   
8  1 Y 1 A ASP 585 ? A ASP 8   
9  1 Y 1 A ASP 586 ? A ASP 9   
10 1 Y 1 A ASP 587 ? A ASP 10  
11 1 Y 1 A ASP 588 ? A ASP 11  
12 1 Y 1 A ASP 589 ? A ASP 12  
13 1 Y 1 A ASP 590 ? A ASP 13  
14 1 Y 1 A ASN 591 ? A ASN 14  
15 1 Y 1 A SER 592 ? A SER 15  
16 1 Y 1 A ASN 593 ? A ASN 16  
17 1 Y 1 A ASP 594 ? A ASP 17  
18 1 Y 1 A GLU 595 ? A GLU 18  
19 1 Y 1 A SER 596 ? A SER 19  
20 1 Y 1 A GLU 597 ? A GLU 20  
21 1 Y 1 A TYR 598 ? A TYR 21  
22 1 Y 1 A GLU 599 ? A GLU 22  
23 1 Y 1 A SER 600 ? A SER 23  
24 1 Y 1 A SER 601 ? A SER 24  
25 1 Y 1 A GLN 602 ? A GLN 25  
26 1 Y 1 A MET 603 ? A MET 26  
27 1 Y 1 A ASP 604 ? A ASP 27  
28 1 Y 1 A SER 605 ? A SER 28  
29 1 Y 1 A GLU 606 ? A GLU 29  
30 1 Y 1 A LYS 607 ? A LYS 30  
31 1 Y 1 A ASN 608 ? A ASN 31  
32 1 Y 1 A LYS 609 ? A LYS 32  
33 1 Y 1 A GLY 610 ? A GLY 33  
34 1 Y 1 A SER 611 ? A SER 34  
35 1 Y 1 A ILE 612 ? A ILE 35  
36 1 Y 1 A LYS 613 ? A LYS 36  
37 1 Y 1 A ASN 614 ? A ASN 37  
38 1 Y 1 A ASP 729 ? A ASP 134 
39 1 Y 1 A ILE 730 ? A ILE 135 
40 1 Y 1 A PRO 731 ? A PRO 136 
41 1 Y 1 A TYR 732 ? A TYR 137 
42 1 Y 1 A ALA 733 ? A ALA 138 
43 1 Y 1 A ASN 734 ? A ASN 139 
44 1 Y 1 A ASN 735 ? A ASN 140 
45 1 Y 1 A GLN 736 ? A GLN 141 
46 1 Y 1 A LYS 737 ? A LYS 142 
47 1 Y 1 A GLU 738 ? A GLU 143 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
8R1 C01  C N N 1   
8R1 C02  C N N 2   
8R1 C03  C N R 3   
8R1 C04  C N N 4   
8R1 N06  N N N 5   
8R1 N07  N N N 6   
8R1 O05  O N N 7   
8R1 H1   H N N 8   
8R1 H2   H N N 9   
8R1 H3   H N N 10  
8R1 H4   H N N 11  
8R1 H5   H N N 12  
8R1 H6   H N N 13  
8R1 H7   H N N 14  
8R1 H8   H N N 15  
8R1 H9   H N N 16  
8R1 H10  H N N 17  
ALA N    N N N 18  
ALA CA   C N S 19  
ALA C    C N N 20  
ALA O    O N N 21  
ALA CB   C N N 22  
ALA OXT  O N N 23  
ALA H    H N N 24  
ALA H2   H N N 25  
ALA HA   H N N 26  
ALA HB1  H N N 27  
ALA HB2  H N N 28  
ALA HB3  H N N 29  
ALA HXT  H N N 30  
ARG N    N N N 31  
ARG CA   C N S 32  
ARG C    C N N 33  
ARG O    O N N 34  
ARG CB   C N N 35  
ARG CG   C N N 36  
ARG CD   C N N 37  
ARG NE   N N N 38  
ARG CZ   C N N 39  
ARG NH1  N N N 40  
ARG NH2  N N N 41  
ARG OXT  O N N 42  
ARG H    H N N 43  
ARG H2   H N N 44  
ARG HA   H N N 45  
ARG HB2  H N N 46  
ARG HB3  H N N 47  
ARG HG2  H N N 48  
ARG HG3  H N N 49  
ARG HD2  H N N 50  
ARG HD3  H N N 51  
ARG HE   H N N 52  
ARG HH11 H N N 53  
ARG HH12 H N N 54  
ARG HH21 H N N 55  
ARG HH22 H N N 56  
ARG HXT  H N N 57  
ASN N    N N N 58  
ASN CA   C N S 59  
ASN C    C N N 60  
ASN O    O N N 61  
ASN CB   C N N 62  
ASN CG   C N N 63  
ASN OD1  O N N 64  
ASN ND2  N N N 65  
ASN OXT  O N N 66  
ASN H    H N N 67  
ASN H2   H N N 68  
ASN HA   H N N 69  
ASN HB2  H N N 70  
ASN HB3  H N N 71  
ASN HD21 H N N 72  
ASN HD22 H N N 73  
ASN HXT  H N N 74  
ASP N    N N N 75  
ASP CA   C N S 76  
ASP C    C N N 77  
ASP O    O N N 78  
ASP CB   C N N 79  
ASP CG   C N N 80  
ASP OD1  O N N 81  
ASP OD2  O N N 82  
ASP OXT  O N N 83  
ASP H    H N N 84  
ASP H2   H N N 85  
ASP HA   H N N 86  
ASP HB2  H N N 87  
ASP HB3  H N N 88  
ASP HD2  H N N 89  
ASP HXT  H N N 90  
CYS N    N N N 91  
CYS CA   C N R 92  
CYS C    C N N 93  
CYS O    O N N 94  
CYS CB   C N N 95  
CYS SG   S N N 96  
CYS OXT  O N N 97  
CYS H    H N N 98  
CYS H2   H N N 99  
CYS HA   H N N 100 
CYS HB2  H N N 101 
CYS HB3  H N N 102 
CYS HG   H N N 103 
CYS HXT  H N N 104 
GLN N    N N N 105 
GLN CA   C N S 106 
GLN C    C N N 107 
GLN O    O N N 108 
GLN CB   C N N 109 
GLN CG   C N N 110 
GLN CD   C N N 111 
GLN OE1  O N N 112 
GLN NE2  N N N 113 
GLN OXT  O N N 114 
GLN H    H N N 115 
GLN H2   H N N 116 
GLN HA   H N N 117 
GLN HB2  H N N 118 
GLN HB3  H N N 119 
GLN HG2  H N N 120 
GLN HG3  H N N 121 
GLN HE21 H N N 122 
GLN HE22 H N N 123 
GLN HXT  H N N 124 
GLU N    N N N 125 
GLU CA   C N S 126 
GLU C    C N N 127 
GLU O    O N N 128 
GLU CB   C N N 129 
GLU CG   C N N 130 
GLU CD   C N N 131 
GLU OE1  O N N 132 
GLU OE2  O N N 133 
GLU OXT  O N N 134 
GLU H    H N N 135 
GLU H2   H N N 136 
GLU HA   H N N 137 
GLU HB2  H N N 138 
GLU HB3  H N N 139 
GLU HG2  H N N 140 
GLU HG3  H N N 141 
GLU HE2  H N N 142 
GLU HXT  H N N 143 
GLY N    N N N 144 
GLY CA   C N N 145 
GLY C    C N N 146 
GLY O    O N N 147 
GLY OXT  O N N 148 
GLY H    H N N 149 
GLY H2   H N N 150 
GLY HA2  H N N 151 
GLY HA3  H N N 152 
GLY HXT  H N N 153 
GZ6 C    C N N 154 
GZ6 N1   N N N 155 
GZ6 N2   N N N 156 
GZ6 N3   N N N 157 
GZ6 H1   H N N 158 
GZ6 H2   H N N 159 
GZ6 H3   H N N 160 
GZ6 H4   H N N 161 
GZ6 H5   H N N 162 
GZ6 H6   H N N 163 
HIS N    N N N 164 
HIS CA   C N S 165 
HIS C    C N N 166 
HIS O    O N N 167 
HIS CB   C N N 168 
HIS CG   C Y N 169 
HIS ND1  N Y N 170 
HIS CD2  C Y N 171 
HIS CE1  C Y N 172 
HIS NE2  N Y N 173 
HIS OXT  O N N 174 
HIS H    H N N 175 
HIS H2   H N N 176 
HIS HA   H N N 177 
HIS HB2  H N N 178 
HIS HB3  H N N 179 
HIS HD1  H N N 180 
HIS HD2  H N N 181 
HIS HE1  H N N 182 
HIS HE2  H N N 183 
HIS HXT  H N N 184 
HOH O    O N N 185 
HOH H1   H N N 186 
HOH H2   H N N 187 
ILE N    N N N 188 
ILE CA   C N S 189 
ILE C    C N N 190 
ILE O    O N N 191 
ILE CB   C N S 192 
ILE CG1  C N N 193 
ILE CG2  C N N 194 
ILE CD1  C N N 195 
ILE OXT  O N N 196 
ILE H    H N N 197 
ILE H2   H N N 198 
ILE HA   H N N 199 
ILE HB   H N N 200 
ILE HG12 H N N 201 
ILE HG13 H N N 202 
ILE HG21 H N N 203 
ILE HG22 H N N 204 
ILE HG23 H N N 205 
ILE HD11 H N N 206 
ILE HD12 H N N 207 
ILE HD13 H N N 208 
ILE HXT  H N N 209 
LEU N    N N N 210 
LEU CA   C N S 211 
LEU C    C N N 212 
LEU O    O N N 213 
LEU CB   C N N 214 
LEU CG   C N N 215 
LEU CD1  C N N 216 
LEU CD2  C N N 217 
LEU OXT  O N N 218 
LEU H    H N N 219 
LEU H2   H N N 220 
LEU HA   H N N 221 
LEU HB2  H N N 222 
LEU HB3  H N N 223 
LEU HG   H N N 224 
LEU HD11 H N N 225 
LEU HD12 H N N 226 
LEU HD13 H N N 227 
LEU HD21 H N N 228 
LEU HD22 H N N 229 
LEU HD23 H N N 230 
LEU HXT  H N N 231 
LYS N    N N N 232 
LYS CA   C N S 233 
LYS C    C N N 234 
LYS O    O N N 235 
LYS CB   C N N 236 
LYS CG   C N N 237 
LYS CD   C N N 238 
LYS CE   C N N 239 
LYS NZ   N N N 240 
LYS OXT  O N N 241 
LYS H    H N N 242 
LYS H2   H N N 243 
LYS HA   H N N 244 
LYS HB2  H N N 245 
LYS HB3  H N N 246 
LYS HG2  H N N 247 
LYS HG3  H N N 248 
LYS HD2  H N N 249 
LYS HD3  H N N 250 
LYS HE2  H N N 251 
LYS HE3  H N N 252 
LYS HZ1  H N N 253 
LYS HZ2  H N N 254 
LYS HZ3  H N N 255 
LYS HXT  H N N 256 
MET N    N N N 257 
MET CA   C N S 258 
MET C    C N N 259 
MET O    O N N 260 
MET CB   C N N 261 
MET CG   C N N 262 
MET SD   S N N 263 
MET CE   C N N 264 
MET OXT  O N N 265 
MET H    H N N 266 
MET H2   H N N 267 
MET HA   H N N 268 
MET HB2  H N N 269 
MET HB3  H N N 270 
MET HG2  H N N 271 
MET HG3  H N N 272 
MET HE1  H N N 273 
MET HE2  H N N 274 
MET HE3  H N N 275 
MET HXT  H N N 276 
PHE N    N N N 277 
PHE CA   C N S 278 
PHE C    C N N 279 
PHE O    O N N 280 
PHE CB   C N N 281 
PHE CG   C Y N 282 
PHE CD1  C Y N 283 
PHE CD2  C Y N 284 
PHE CE1  C Y N 285 
PHE CE2  C Y N 286 
PHE CZ   C Y N 287 
PHE OXT  O N N 288 
PHE H    H N N 289 
PHE H2   H N N 290 
PHE HA   H N N 291 
PHE HB2  H N N 292 
PHE HB3  H N N 293 
PHE HD1  H N N 294 
PHE HD2  H N N 295 
PHE HE1  H N N 296 
PHE HE2  H N N 297 
PHE HZ   H N N 298 
PHE HXT  H N N 299 
PRO N    N N N 300 
PRO CA   C N S 301 
PRO C    C N N 302 
PRO O    O N N 303 
PRO CB   C N N 304 
PRO CG   C N N 305 
PRO CD   C N N 306 
PRO OXT  O N N 307 
PRO H    H N N 308 
PRO HA   H N N 309 
PRO HB2  H N N 310 
PRO HB3  H N N 311 
PRO HG2  H N N 312 
PRO HG3  H N N 313 
PRO HD2  H N N 314 
PRO HD3  H N N 315 
PRO HXT  H N N 316 
SER N    N N N 317 
SER CA   C N S 318 
SER C    C N N 319 
SER O    O N N 320 
SER CB   C N N 321 
SER OG   O N N 322 
SER OXT  O N N 323 
SER H    H N N 324 
SER H2   H N N 325 
SER HA   H N N 326 
SER HB2  H N N 327 
SER HB3  H N N 328 
SER HG   H N N 329 
SER HXT  H N N 330 
THR N    N N N 331 
THR CA   C N S 332 
THR C    C N N 333 
THR O    O N N 334 
THR CB   C N R 335 
THR OG1  O N N 336 
THR CG2  C N N 337 
THR OXT  O N N 338 
THR H    H N N 339 
THR H2   H N N 340 
THR HA   H N N 341 
THR HB   H N N 342 
THR HG1  H N N 343 
THR HG21 H N N 344 
THR HG22 H N N 345 
THR HG23 H N N 346 
THR HXT  H N N 347 
TRP N    N N N 348 
TRP CA   C N S 349 
TRP C    C N N 350 
TRP O    O N N 351 
TRP CB   C N N 352 
TRP CG   C Y N 353 
TRP CD1  C Y N 354 
TRP CD2  C Y N 355 
TRP NE1  N Y N 356 
TRP CE2  C Y N 357 
TRP CE3  C Y N 358 
TRP CZ2  C Y N 359 
TRP CZ3  C Y N 360 
TRP CH2  C Y N 361 
TRP OXT  O N N 362 
TRP H    H N N 363 
TRP H2   H N N 364 
TRP HA   H N N 365 
TRP HB2  H N N 366 
TRP HB3  H N N 367 
TRP HD1  H N N 368 
TRP HE1  H N N 369 
TRP HE3  H N N 370 
TRP HZ2  H N N 371 
TRP HZ3  H N N 372 
TRP HH2  H N N 373 
TRP HXT  H N N 374 
TYR N    N N N 375 
TYR CA   C N S 376 
TYR C    C N N 377 
TYR O    O N N 378 
TYR CB   C N N 379 
TYR CG   C Y N 380 
TYR CD1  C Y N 381 
TYR CD2  C Y N 382 
TYR CE1  C Y N 383 
TYR CE2  C Y N 384 
TYR CZ   C Y N 385 
TYR OH   O N N 386 
TYR OXT  O N N 387 
TYR H    H N N 388 
TYR H2   H N N 389 
TYR HA   H N N 390 
TYR HB2  H N N 391 
TYR HB3  H N N 392 
TYR HD1  H N N 393 
TYR HD2  H N N 394 
TYR HE1  H N N 395 
TYR HE2  H N N 396 
TYR HH   H N N 397 
TYR HXT  H N N 398 
VAL N    N N N 399 
VAL CA   C N S 400 
VAL C    C N N 401 
VAL O    O N N 402 
VAL CB   C N N 403 
VAL CG1  C N N 404 
VAL CG2  C N N 405 
VAL OXT  O N N 406 
VAL H    H N N 407 
VAL H2   H N N 408 
VAL HA   H N N 409 
VAL HB   H N N 410 
VAL HG11 H N N 411 
VAL HG12 H N N 412 
VAL HG13 H N N 413 
VAL HG21 H N N 414 
VAL HG22 H N N 415 
VAL HG23 H N N 416 
VAL HXT  H N N 417 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
8R1 N07 C03  sing N N 1   
8R1 C03 C04  sing N N 2   
8R1 C03 C02  sing N N 3   
8R1 C04 N06  sing N N 4   
8R1 C04 O05  doub N N 5   
8R1 C02 C01  sing N N 6   
8R1 C01 H1   sing N N 7   
8R1 C01 H2   sing N N 8   
8R1 C01 H3   sing N N 9   
8R1 C02 H4   sing N N 10  
8R1 C02 H5   sing N N 11  
8R1 C03 H6   sing N N 12  
8R1 N06 H7   sing N N 13  
8R1 N06 H8   sing N N 14  
8R1 N07 H9   sing N N 15  
8R1 N07 H10  sing N N 16  
ALA N   CA   sing N N 17  
ALA N   H    sing N N 18  
ALA N   H2   sing N N 19  
ALA CA  C    sing N N 20  
ALA CA  CB   sing N N 21  
ALA CA  HA   sing N N 22  
ALA C   O    doub N N 23  
ALA C   OXT  sing N N 24  
ALA CB  HB1  sing N N 25  
ALA CB  HB2  sing N N 26  
ALA CB  HB3  sing N N 27  
ALA OXT HXT  sing N N 28  
ARG N   CA   sing N N 29  
ARG N   H    sing N N 30  
ARG N   H2   sing N N 31  
ARG CA  C    sing N N 32  
ARG CA  CB   sing N N 33  
ARG CA  HA   sing N N 34  
ARG C   O    doub N N 35  
ARG C   OXT  sing N N 36  
ARG CB  CG   sing N N 37  
ARG CB  HB2  sing N N 38  
ARG CB  HB3  sing N N 39  
ARG CG  CD   sing N N 40  
ARG CG  HG2  sing N N 41  
ARG CG  HG3  sing N N 42  
ARG CD  NE   sing N N 43  
ARG CD  HD2  sing N N 44  
ARG CD  HD3  sing N N 45  
ARG NE  CZ   sing N N 46  
ARG NE  HE   sing N N 47  
ARG CZ  NH1  sing N N 48  
ARG CZ  NH2  doub N N 49  
ARG NH1 HH11 sing N N 50  
ARG NH1 HH12 sing N N 51  
ARG NH2 HH21 sing N N 52  
ARG NH2 HH22 sing N N 53  
ARG OXT HXT  sing N N 54  
ASN N   CA   sing N N 55  
ASN N   H    sing N N 56  
ASN N   H2   sing N N 57  
ASN CA  C    sing N N 58  
ASN CA  CB   sing N N 59  
ASN CA  HA   sing N N 60  
ASN C   O    doub N N 61  
ASN C   OXT  sing N N 62  
ASN CB  CG   sing N N 63  
ASN CB  HB2  sing N N 64  
ASN CB  HB3  sing N N 65  
ASN CG  OD1  doub N N 66  
ASN CG  ND2  sing N N 67  
ASN ND2 HD21 sing N N 68  
ASN ND2 HD22 sing N N 69  
ASN OXT HXT  sing N N 70  
ASP N   CA   sing N N 71  
ASP N   H    sing N N 72  
ASP N   H2   sing N N 73  
ASP CA  C    sing N N 74  
ASP CA  CB   sing N N 75  
ASP CA  HA   sing N N 76  
ASP C   O    doub N N 77  
ASP C   OXT  sing N N 78  
ASP CB  CG   sing N N 79  
ASP CB  HB2  sing N N 80  
ASP CB  HB3  sing N N 81  
ASP CG  OD1  doub N N 82  
ASP CG  OD2  sing N N 83  
ASP OD2 HD2  sing N N 84  
ASP OXT HXT  sing N N 85  
CYS N   CA   sing N N 86  
CYS N   H    sing N N 87  
CYS N   H2   sing N N 88  
CYS CA  C    sing N N 89  
CYS CA  CB   sing N N 90  
CYS CA  HA   sing N N 91  
CYS C   O    doub N N 92  
CYS C   OXT  sing N N 93  
CYS CB  SG   sing N N 94  
CYS CB  HB2  sing N N 95  
CYS CB  HB3  sing N N 96  
CYS SG  HG   sing N N 97  
CYS OXT HXT  sing N N 98  
GLN N   CA   sing N N 99  
GLN N   H    sing N N 100 
GLN N   H2   sing N N 101 
GLN CA  C    sing N N 102 
GLN CA  CB   sing N N 103 
GLN CA  HA   sing N N 104 
GLN C   O    doub N N 105 
GLN C   OXT  sing N N 106 
GLN CB  CG   sing N N 107 
GLN CB  HB2  sing N N 108 
GLN CB  HB3  sing N N 109 
GLN CG  CD   sing N N 110 
GLN CG  HG2  sing N N 111 
GLN CG  HG3  sing N N 112 
GLN CD  OE1  doub N N 113 
GLN CD  NE2  sing N N 114 
GLN NE2 HE21 sing N N 115 
GLN NE2 HE22 sing N N 116 
GLN OXT HXT  sing N N 117 
GLU N   CA   sing N N 118 
GLU N   H    sing N N 119 
GLU N   H2   sing N N 120 
GLU CA  C    sing N N 121 
GLU CA  CB   sing N N 122 
GLU CA  HA   sing N N 123 
GLU C   O    doub N N 124 
GLU C   OXT  sing N N 125 
GLU CB  CG   sing N N 126 
GLU CB  HB2  sing N N 127 
GLU CB  HB3  sing N N 128 
GLU CG  CD   sing N N 129 
GLU CG  HG2  sing N N 130 
GLU CG  HG3  sing N N 131 
GLU CD  OE1  doub N N 132 
GLU CD  OE2  sing N N 133 
GLU OE2 HE2  sing N N 134 
GLU OXT HXT  sing N N 135 
GLY N   CA   sing N N 136 
GLY N   H    sing N N 137 
GLY N   H2   sing N N 138 
GLY CA  C    sing N N 139 
GLY CA  HA2  sing N N 140 
GLY CA  HA3  sing N N 141 
GLY C   O    doub N N 142 
GLY C   OXT  sing N N 143 
GLY OXT HXT  sing N N 144 
GZ6 N1  C    doub N N 145 
GZ6 C   N3   sing N N 146 
GZ6 C   N2   sing N N 147 
GZ6 N1  H1   sing N N 148 
GZ6 N2  H2   sing N N 149 
GZ6 N2  H3   sing N N 150 
GZ6 N3  H4   sing N N 151 
GZ6 N3  H5   sing N N 152 
GZ6 N1  H6   sing N N 153 
HIS N   CA   sing N N 154 
HIS N   H    sing N N 155 
HIS N   H2   sing N N 156 
HIS CA  C    sing N N 157 
HIS CA  CB   sing N N 158 
HIS CA  HA   sing N N 159 
HIS C   O    doub N N 160 
HIS C   OXT  sing N N 161 
HIS CB  CG   sing N N 162 
HIS CB  HB2  sing N N 163 
HIS CB  HB3  sing N N 164 
HIS CG  ND1  sing Y N 165 
HIS CG  CD2  doub Y N 166 
HIS ND1 CE1  doub Y N 167 
HIS ND1 HD1  sing N N 168 
HIS CD2 NE2  sing Y N 169 
HIS CD2 HD2  sing N N 170 
HIS CE1 NE2  sing Y N 171 
HIS CE1 HE1  sing N N 172 
HIS NE2 HE2  sing N N 173 
HIS OXT HXT  sing N N 174 
HOH O   H1   sing N N 175 
HOH O   H2   sing N N 176 
ILE N   CA   sing N N 177 
ILE N   H    sing N N 178 
ILE N   H2   sing N N 179 
ILE CA  C    sing N N 180 
ILE CA  CB   sing N N 181 
ILE CA  HA   sing N N 182 
ILE C   O    doub N N 183 
ILE C   OXT  sing N N 184 
ILE CB  CG1  sing N N 185 
ILE CB  CG2  sing N N 186 
ILE CB  HB   sing N N 187 
ILE CG1 CD1  sing N N 188 
ILE CG1 HG12 sing N N 189 
ILE CG1 HG13 sing N N 190 
ILE CG2 HG21 sing N N 191 
ILE CG2 HG22 sing N N 192 
ILE CG2 HG23 sing N N 193 
ILE CD1 HD11 sing N N 194 
ILE CD1 HD12 sing N N 195 
ILE CD1 HD13 sing N N 196 
ILE OXT HXT  sing N N 197 
LEU N   CA   sing N N 198 
LEU N   H    sing N N 199 
LEU N   H2   sing N N 200 
LEU CA  C    sing N N 201 
LEU CA  CB   sing N N 202 
LEU CA  HA   sing N N 203 
LEU C   O    doub N N 204 
LEU C   OXT  sing N N 205 
LEU CB  CG   sing N N 206 
LEU CB  HB2  sing N N 207 
LEU CB  HB3  sing N N 208 
LEU CG  CD1  sing N N 209 
LEU CG  CD2  sing N N 210 
LEU CG  HG   sing N N 211 
LEU CD1 HD11 sing N N 212 
LEU CD1 HD12 sing N N 213 
LEU CD1 HD13 sing N N 214 
LEU CD2 HD21 sing N N 215 
LEU CD2 HD22 sing N N 216 
LEU CD2 HD23 sing N N 217 
LEU OXT HXT  sing N N 218 
LYS N   CA   sing N N 219 
LYS N   H    sing N N 220 
LYS N   H2   sing N N 221 
LYS CA  C    sing N N 222 
LYS CA  CB   sing N N 223 
LYS CA  HA   sing N N 224 
LYS C   O    doub N N 225 
LYS C   OXT  sing N N 226 
LYS CB  CG   sing N N 227 
LYS CB  HB2  sing N N 228 
LYS CB  HB3  sing N N 229 
LYS CG  CD   sing N N 230 
LYS CG  HG2  sing N N 231 
LYS CG  HG3  sing N N 232 
LYS CD  CE   sing N N 233 
LYS CD  HD2  sing N N 234 
LYS CD  HD3  sing N N 235 
LYS CE  NZ   sing N N 236 
LYS CE  HE2  sing N N 237 
LYS CE  HE3  sing N N 238 
LYS NZ  HZ1  sing N N 239 
LYS NZ  HZ2  sing N N 240 
LYS NZ  HZ3  sing N N 241 
LYS OXT HXT  sing N N 242 
MET N   CA   sing N N 243 
MET N   H    sing N N 244 
MET N   H2   sing N N 245 
MET CA  C    sing N N 246 
MET CA  CB   sing N N 247 
MET CA  HA   sing N N 248 
MET C   O    doub N N 249 
MET C   OXT  sing N N 250 
MET CB  CG   sing N N 251 
MET CB  HB2  sing N N 252 
MET CB  HB3  sing N N 253 
MET CG  SD   sing N N 254 
MET CG  HG2  sing N N 255 
MET CG  HG3  sing N N 256 
MET SD  CE   sing N N 257 
MET CE  HE1  sing N N 258 
MET CE  HE2  sing N N 259 
MET CE  HE3  sing N N 260 
MET OXT HXT  sing N N 261 
PHE N   CA   sing N N 262 
PHE N   H    sing N N 263 
PHE N   H2   sing N N 264 
PHE CA  C    sing N N 265 
PHE CA  CB   sing N N 266 
PHE CA  HA   sing N N 267 
PHE C   O    doub N N 268 
PHE C   OXT  sing N N 269 
PHE CB  CG   sing N N 270 
PHE CB  HB2  sing N N 271 
PHE CB  HB3  sing N N 272 
PHE CG  CD1  doub Y N 273 
PHE CG  CD2  sing Y N 274 
PHE CD1 CE1  sing Y N 275 
PHE CD1 HD1  sing N N 276 
PHE CD2 CE2  doub Y N 277 
PHE CD2 HD2  sing N N 278 
PHE CE1 CZ   doub Y N 279 
PHE CE1 HE1  sing N N 280 
PHE CE2 CZ   sing Y N 281 
PHE CE2 HE2  sing N N 282 
PHE CZ  HZ   sing N N 283 
PHE OXT HXT  sing N N 284 
PRO N   CA   sing N N 285 
PRO N   CD   sing N N 286 
PRO N   H    sing N N 287 
PRO CA  C    sing N N 288 
PRO CA  CB   sing N N 289 
PRO CA  HA   sing N N 290 
PRO C   O    doub N N 291 
PRO C   OXT  sing N N 292 
PRO CB  CG   sing N N 293 
PRO CB  HB2  sing N N 294 
PRO CB  HB3  sing N N 295 
PRO CG  CD   sing N N 296 
PRO CG  HG2  sing N N 297 
PRO CG  HG3  sing N N 298 
PRO CD  HD2  sing N N 299 
PRO CD  HD3  sing N N 300 
PRO OXT HXT  sing N N 301 
SER N   CA   sing N N 302 
SER N   H    sing N N 303 
SER N   H2   sing N N 304 
SER CA  C    sing N N 305 
SER CA  CB   sing N N 306 
SER CA  HA   sing N N 307 
SER C   O    doub N N 308 
SER C   OXT  sing N N 309 
SER CB  OG   sing N N 310 
SER CB  HB2  sing N N 311 
SER CB  HB3  sing N N 312 
SER OG  HG   sing N N 313 
SER OXT HXT  sing N N 314 
THR N   CA   sing N N 315 
THR N   H    sing N N 316 
THR N   H2   sing N N 317 
THR CA  C    sing N N 318 
THR CA  CB   sing N N 319 
THR CA  HA   sing N N 320 
THR C   O    doub N N 321 
THR C   OXT  sing N N 322 
THR CB  OG1  sing N N 323 
THR CB  CG2  sing N N 324 
THR CB  HB   sing N N 325 
THR OG1 HG1  sing N N 326 
THR CG2 HG21 sing N N 327 
THR CG2 HG22 sing N N 328 
THR CG2 HG23 sing N N 329 
THR OXT HXT  sing N N 330 
TRP N   CA   sing N N 331 
TRP N   H    sing N N 332 
TRP N   H2   sing N N 333 
TRP CA  C    sing N N 334 
TRP CA  CB   sing N N 335 
TRP CA  HA   sing N N 336 
TRP C   O    doub N N 337 
TRP C   OXT  sing N N 338 
TRP CB  CG   sing N N 339 
TRP CB  HB2  sing N N 340 
TRP CB  HB3  sing N N 341 
TRP CG  CD1  doub Y N 342 
TRP CG  CD2  sing Y N 343 
TRP CD1 NE1  sing Y N 344 
TRP CD1 HD1  sing N N 345 
TRP CD2 CE2  doub Y N 346 
TRP CD2 CE3  sing Y N 347 
TRP NE1 CE2  sing Y N 348 
TRP NE1 HE1  sing N N 349 
TRP CE2 CZ2  sing Y N 350 
TRP CE3 CZ3  doub Y N 351 
TRP CE3 HE3  sing N N 352 
TRP CZ2 CH2  doub Y N 353 
TRP CZ2 HZ2  sing N N 354 
TRP CZ3 CH2  sing Y N 355 
TRP CZ3 HZ3  sing N N 356 
TRP CH2 HH2  sing N N 357 
TRP OXT HXT  sing N N 358 
TYR N   CA   sing N N 359 
TYR N   H    sing N N 360 
TYR N   H2   sing N N 361 
TYR CA  C    sing N N 362 
TYR CA  CB   sing N N 363 
TYR CA  HA   sing N N 364 
TYR C   O    doub N N 365 
TYR C   OXT  sing N N 366 
TYR CB  CG   sing N N 367 
TYR CB  HB2  sing N N 368 
TYR CB  HB3  sing N N 369 
TYR CG  CD1  doub Y N 370 
TYR CG  CD2  sing Y N 371 
TYR CD1 CE1  sing Y N 372 
TYR CD1 HD1  sing N N 373 
TYR CD2 CE2  doub Y N 374 
TYR CD2 HD2  sing N N 375 
TYR CE1 CZ   doub Y N 376 
TYR CE1 HE1  sing N N 377 
TYR CE2 CZ   sing Y N 378 
TYR CE2 HE2  sing N N 379 
TYR CZ  OH   sing N N 380 
TYR OH  HH   sing N N 381 
TYR OXT HXT  sing N N 382 
VAL N   CA   sing N N 383 
VAL N   H    sing N N 384 
VAL N   H2   sing N N 385 
VAL CA  C    sing N N 386 
VAL CA  CB   sing N N 387 
VAL CA  HA   sing N N 388 
VAL C   O    doub N N 389 
VAL C   OXT  sing N N 390 
VAL CB  CG1  sing N N 391 
VAL CB  CG2  sing N N 392 
VAL CB  HB   sing N N 393 
VAL CG1 HG11 sing N N 394 
VAL CG1 HG12 sing N N 395 
VAL CG1 HG13 sing N N 396 
VAL CG2 HG21 sing N N 397 
VAL CG2 HG22 sing N N 398 
VAL CG2 HG23 sing N N 399 
VAL OXT HXT  sing N N 400 
# 
_pdbx_audit_support.funding_organization   'Montpellier University of Excellence (MUSE)' 
_pdbx_audit_support.country                France 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_instance_feature.ordinal 
_pdbx_entity_instance_feature.comp_id 
_pdbx_entity_instance_feature.asym_id 
_pdbx_entity_instance_feature.seq_num 
_pdbx_entity_instance_feature.auth_comp_id 
_pdbx_entity_instance_feature.auth_asym_id 
_pdbx_entity_instance_feature.auth_seq_num 
_pdbx_entity_instance_feature.feature_type 
_pdbx_entity_instance_feature.details 
1 GZ6 ? ? GZ6 ? ? 'SUBJECT OF INVESTIGATION' ? 
2 8R1 ? ? 8R1 ? ? 'SUBJECT OF INVESTIGATION' ? 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   4ZCT 
_pdbx_initial_refinement_model.details          ? 
# 
_atom_sites.entry_id                    7Q3W 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.019639 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014492 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008569 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_