data_7Q6U # _entry.id 7Q6U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7Q6U pdb_00007q6u 10.2210/pdb7q6u/pdb WWPDB D_1292119118 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-01-19 2 'Structure model' 1 1 2022-02-16 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7Q6U _pdbx_database_status.recvd_initial_deposition_date 2021-11-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email marianne.schimpl@astrazeneca.com _pdbx_contact_author.name_first Marianne _pdbx_contact_author.name_last Schimpl _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2284-5250 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Patel, S.J.' 1 ? 'Winter-Holt, J.J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 3306 _citation.page_last 3331 _citation.title 'Discovery of a Potent and Selective ATAD2 Bromodomain Inhibitor with Antiproliferative Activity in Breast Cancer Models.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.1c01871 _citation.pdbx_database_id_PubMed 35133824 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Winter-Holt, J.J.' 1 ? primary 'Bardelle, C.' 2 ? primary 'Chiarparin, E.' 3 ? primary 'Dale, I.L.' 4 ? primary 'Davey, P.R.J.' 5 ? primary 'Davies, N.L.' 6 ? primary 'Denz, C.' 7 ? primary 'Fillery, S.M.' 8 ? primary 'Guerot, C.M.' 9 ? primary 'Han, F.' 10 ? primary 'Hughes, S.J.' 11 ? primary 'Kulkarni, M.' 12 ? primary 'Liu, Z.' 13 ? primary 'Milbradt, A.' 14 ? primary 'Moss, T.A.' 15 ? primary 'Niu, H.' 16 ? primary 'Patel, J.' 17 ? primary 'Rabow, A.A.' 18 ? primary 'Schimpl, M.' 19 ? primary 'Shi, J.' 20 ? primary 'Sun, D.' 21 ? primary 'Yang, D.' 22 ? primary 'Guichard, S.' 23 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ATPase family AAA domain-containing protein 2' 15453.514 1 3.6.1.3 ? bromodomain ? 2 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 3 non-polymer syn '(1R,9S)-13-(3,5-dimethoxy-4-oxidanyl-phenyl)carbonyl-11,13-diazatricyclo[7.3.1.0^{2,7}]trideca-2,4,6-trien-10-one' 368.383 1 ? ? ? ? 4 water nat water 18.015 192 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AAA nuclear coregulator cancer-associated protein,ANCCA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _entity_poly.pdbx_seq_one_letter_code_can ;SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 '(1R,9S)-13-(3,5-dimethoxy-4-oxidanyl-phenyl)carbonyl-11,13-diazatricyclo[7.3.1.0^{2,7}]trideca-2,4,6-trien-10-one' 963 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 GLN n 1 4 GLU n 1 5 GLU n 1 6 ASP n 1 7 THR n 1 8 PHE n 1 9 ARG n 1 10 GLU n 1 11 LEU n 1 12 ARG n 1 13 ILE n 1 14 PHE n 1 15 LEU n 1 16 ARG n 1 17 ASN n 1 18 VAL n 1 19 THR n 1 20 HIS n 1 21 ARG n 1 22 LEU n 1 23 ALA n 1 24 ILE n 1 25 ASP n 1 26 LYS n 1 27 ARG n 1 28 PHE n 1 29 ARG n 1 30 VAL n 1 31 PHE n 1 32 THR n 1 33 LYS n 1 34 PRO n 1 35 VAL n 1 36 ASP n 1 37 PRO n 1 38 ASP n 1 39 GLU n 1 40 VAL n 1 41 PRO n 1 42 ASP n 1 43 TYR n 1 44 VAL n 1 45 THR n 1 46 VAL n 1 47 ILE n 1 48 LYS n 1 49 GLN n 1 50 PRO n 1 51 MET n 1 52 ASP n 1 53 LEU n 1 54 SER n 1 55 SER n 1 56 VAL n 1 57 ILE n 1 58 SER n 1 59 LYS n 1 60 ILE n 1 61 ASP n 1 62 LEU n 1 63 HIS n 1 64 LYS n 1 65 TYR n 1 66 LEU n 1 67 THR n 1 68 VAL n 1 69 LYS n 1 70 ASP n 1 71 TYR n 1 72 LEU n 1 73 ARG n 1 74 ASP n 1 75 ILE n 1 76 ASP n 1 77 LEU n 1 78 ILE n 1 79 CYS n 1 80 SER n 1 81 ASN n 1 82 ALA n 1 83 LEU n 1 84 GLU n 1 85 TYR n 1 86 ASN n 1 87 PRO n 1 88 ASP n 1 89 ARG n 1 90 ASP n 1 91 PRO n 1 92 GLY n 1 93 ASP n 1 94 ARG n 1 95 LEU n 1 96 ILE n 1 97 ARG n 1 98 HIS n 1 99 ARG n 1 100 ALA n 1 101 CYS n 1 102 ALA n 1 103 LEU n 1 104 ARG n 1 105 ASP n 1 106 THR n 1 107 ALA n 1 108 TYR n 1 109 ALA n 1 110 ILE n 1 111 ILE n 1 112 LYS n 1 113 GLU n 1 114 GLU n 1 115 LEU n 1 116 ASP n 1 117 GLU n 1 118 ASP n 1 119 PHE n 1 120 GLU n 1 121 GLN n 1 122 LEU n 1 123 CYS n 1 124 GLU n 1 125 GLU n 1 126 ILE n 1 127 GLN n 1 128 GLU n 1 129 SER n 1 130 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 130 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ATAD2, L16, PRO2000' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Gold _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 963 non-polymer . '(1R,9S)-13-(3,5-dimethoxy-4-oxidanyl-phenyl)carbonyl-11,13-diazatricyclo[7.3.1.0^{2,7}]trideca-2,4,6-trien-10-one' ? 'C20 H20 N2 O5' 368.383 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 979 979 SER SER A . n A 1 2 MET 2 980 980 MET MET A . n A 1 3 GLN 3 981 981 GLN GLN A . n A 1 4 GLU 4 982 982 GLU GLU A . n A 1 5 GLU 5 983 983 GLU GLU A . n A 1 6 ASP 6 984 984 ASP ASP A . n A 1 7 THR 7 985 985 THR THR A . n A 1 8 PHE 8 986 986 PHE PHE A . n A 1 9 ARG 9 987 987 ARG ARG A . n A 1 10 GLU 10 988 988 GLU GLU A . n A 1 11 LEU 11 989 989 LEU LEU A . n A 1 12 ARG 12 990 990 ARG ARG A . n A 1 13 ILE 13 991 991 ILE ILE A . n A 1 14 PHE 14 992 992 PHE PHE A . n A 1 15 LEU 15 993 993 LEU LEU A . n A 1 16 ARG 16 994 994 ARG ARG A . n A 1 17 ASN 17 995 995 ASN ASN A . n A 1 18 VAL 18 996 996 VAL VAL A . n A 1 19 THR 19 997 997 THR THR A . n A 1 20 HIS 20 998 998 HIS HIS A . n A 1 21 ARG 21 999 999 ARG ARG A . n A 1 22 LEU 22 1000 1000 LEU LEU A . n A 1 23 ALA 23 1001 1001 ALA ALA A . n A 1 24 ILE 24 1002 1002 ILE ILE A . n A 1 25 ASP 25 1003 1003 ASP ASP A . n A 1 26 LYS 26 1004 1004 LYS LYS A . n A 1 27 ARG 27 1005 1005 ARG ARG A . n A 1 28 PHE 28 1006 1006 PHE PHE A . n A 1 29 ARG 29 1007 1007 ARG ARG A . n A 1 30 VAL 30 1008 1008 VAL VAL A . n A 1 31 PHE 31 1009 1009 PHE PHE A . n A 1 32 THR 32 1010 1010 THR THR A . n A 1 33 LYS 33 1011 1011 LYS LYS A . n A 1 34 PRO 34 1012 1012 PRO PRO A . n A 1 35 VAL 35 1013 1013 VAL VAL A . n A 1 36 ASP 36 1014 1014 ASP ASP A . n A 1 37 PRO 37 1015 1015 PRO PRO A . n A 1 38 ASP 38 1016 1016 ASP ASP A . n A 1 39 GLU 39 1017 1017 GLU GLU A . n A 1 40 VAL 40 1018 1018 VAL VAL A . n A 1 41 PRO 41 1019 1019 PRO PRO A . n A 1 42 ASP 42 1020 1020 ASP ASP A . n A 1 43 TYR 43 1021 1021 TYR TYR A . n A 1 44 VAL 44 1022 1022 VAL VAL A . n A 1 45 THR 45 1023 1023 THR THR A . n A 1 46 VAL 46 1024 1024 VAL VAL A . n A 1 47 ILE 47 1025 1025 ILE ILE A . n A 1 48 LYS 48 1026 1026 LYS LYS A . n A 1 49 GLN 49 1027 1027 GLN GLN A . n A 1 50 PRO 50 1028 1028 PRO PRO A . n A 1 51 MET 51 1029 1029 MET MET A . n A 1 52 ASP 52 1030 1030 ASP ASP A . n A 1 53 LEU 53 1031 1031 LEU LEU A . n A 1 54 SER 54 1032 1032 SER SER A . n A 1 55 SER 55 1033 1033 SER SER A . n A 1 56 VAL 56 1034 1034 VAL VAL A . n A 1 57 ILE 57 1035 1035 ILE ILE A . n A 1 58 SER 58 1036 1036 SER SER A . n A 1 59 LYS 59 1037 1037 LYS LYS A . n A 1 60 ILE 60 1038 1038 ILE ILE A . n A 1 61 ASP 61 1039 1039 ASP ASP A . n A 1 62 LEU 62 1040 1040 LEU LEU A . n A 1 63 HIS 63 1041 1041 HIS HIS A . n A 1 64 LYS 64 1042 1042 LYS LYS A . n A 1 65 TYR 65 1043 1043 TYR TYR A . n A 1 66 LEU 66 1044 1044 LEU LEU A . n A 1 67 THR 67 1045 1045 THR THR A . n A 1 68 VAL 68 1046 1046 VAL VAL A . n A 1 69 LYS 69 1047 1047 LYS LYS A . n A 1 70 ASP 70 1048 1048 ASP ASP A . n A 1 71 TYR 71 1049 1049 TYR TYR A . n A 1 72 LEU 72 1050 1050 LEU LEU A . n A 1 73 ARG 73 1051 1051 ARG ARG A . n A 1 74 ASP 74 1052 1052 ASP ASP A . n A 1 75 ILE 75 1053 1053 ILE ILE A . n A 1 76 ASP 76 1054 1054 ASP ASP A . n A 1 77 LEU 77 1055 1055 LEU LEU A . n A 1 78 ILE 78 1056 1056 ILE ILE A . n A 1 79 CYS 79 1057 1057 CYS CYS A . n A 1 80 SER 80 1058 1058 SER SER A . n A 1 81 ASN 81 1059 1059 ASN ASN A . n A 1 82 ALA 82 1060 1060 ALA ALA A . n A 1 83 LEU 83 1061 1061 LEU LEU A . n A 1 84 GLU 84 1062 1062 GLU GLU A . n A 1 85 TYR 85 1063 1063 TYR TYR A . n A 1 86 ASN 86 1064 1064 ASN ASN A . n A 1 87 PRO 87 1065 1065 PRO PRO A . n A 1 88 ASP 88 1066 1066 ASP ASP A . n A 1 89 ARG 89 1067 1067 ARG ARG A . n A 1 90 ASP 90 1068 1068 ASP ASP A . n A 1 91 PRO 91 1069 1069 PRO PRO A . n A 1 92 GLY 92 1070 1070 GLY GLY A . n A 1 93 ASP 93 1071 1071 ASP ASP A . n A 1 94 ARG 94 1072 1072 ARG ARG A . n A 1 95 LEU 95 1073 1073 LEU LEU A . n A 1 96 ILE 96 1074 1074 ILE ILE A . n A 1 97 ARG 97 1075 1075 ARG ARG A . n A 1 98 HIS 98 1076 1076 HIS HIS A . n A 1 99 ARG 99 1077 1077 ARG ARG A . n A 1 100 ALA 100 1078 1078 ALA ALA A . n A 1 101 CYS 101 1079 1079 CYS CYS A . n A 1 102 ALA 102 1080 1080 ALA ALA A . n A 1 103 LEU 103 1081 1081 LEU LEU A . n A 1 104 ARG 104 1082 1082 ARG ARG A . n A 1 105 ASP 105 1083 1083 ASP ASP A . n A 1 106 THR 106 1084 1084 THR THR A . n A 1 107 ALA 107 1085 1085 ALA ALA A . n A 1 108 TYR 108 1086 1086 TYR TYR A . n A 1 109 ALA 109 1087 1087 ALA ALA A . n A 1 110 ILE 110 1088 1088 ILE ILE A . n A 1 111 ILE 111 1089 1089 ILE ILE A . n A 1 112 LYS 112 1090 1090 LYS LYS A . n A 1 113 GLU 113 1091 1091 GLU GLU A . n A 1 114 GLU 114 1092 1092 GLU GLU A . n A 1 115 LEU 115 1093 1093 LEU LEU A . n A 1 116 ASP 116 1094 1094 ASP ASP A . n A 1 117 GLU 117 1095 1095 GLU GLU A . n A 1 118 ASP 118 1096 1096 ASP ASP A . n A 1 119 PHE 119 1097 1097 PHE PHE A . n A 1 120 GLU 120 1098 1098 GLU GLU A . n A 1 121 GLN 121 1099 1099 GLN GLN A . n A 1 122 LEU 122 1100 1100 LEU LEU A . n A 1 123 CYS 123 1101 1101 CYS CYS A . n A 1 124 GLU 124 1102 1102 GLU GLU A . n A 1 125 GLU 125 1103 1103 GLU GLU A . n A 1 126 ILE 126 1104 1104 ILE ILE A . n A 1 127 GLN 127 1105 1105 GLN GLN A . n A 1 128 GLU 128 1106 1106 GLU GLU A . n A 1 129 SER 129 1107 1107 SER SER A . n A 1 130 ARG 130 1108 1108 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 1201 1 SO4 SO4 A . C 2 SO4 1 1202 2 SO4 SO4 A . D 2 SO4 1 1203 3 SO4 SO4 A . E 3 963 1 1204 1 963 INL A . F 4 HOH 1 1301 164 HOH HOH A . F 4 HOH 2 1302 25 HOH HOH A . F 4 HOH 3 1303 186 HOH HOH A . F 4 HOH 4 1304 184 HOH HOH A . F 4 HOH 5 1305 19 HOH HOH A . F 4 HOH 6 1306 182 HOH HOH A . F 4 HOH 7 1307 52 HOH HOH A . F 4 HOH 8 1308 39 HOH HOH A . F 4 HOH 9 1309 125 HOH HOH A . F 4 HOH 10 1310 60 HOH HOH A . F 4 HOH 11 1311 17 HOH HOH A . F 4 HOH 12 1312 223 HOH HOH A . F 4 HOH 13 1313 13 HOH HOH A . F 4 HOH 14 1314 33 HOH HOH A . F 4 HOH 15 1315 234 HOH HOH A . F 4 HOH 16 1316 5 HOH HOH A . F 4 HOH 17 1317 26 HOH HOH A . F 4 HOH 18 1318 75 HOH HOH A . F 4 HOH 19 1319 124 HOH HOH A . F 4 HOH 20 1320 10 HOH HOH A . F 4 HOH 21 1321 7 HOH HOH A . F 4 HOH 22 1322 127 HOH HOH A . F 4 HOH 23 1323 137 HOH HOH A . F 4 HOH 24 1324 179 HOH HOH A . F 4 HOH 25 1325 45 HOH HOH A . F 4 HOH 26 1326 15 HOH HOH A . F 4 HOH 27 1327 183 HOH HOH A . F 4 HOH 28 1328 63 HOH HOH A . F 4 HOH 29 1329 44 HOH HOH A . F 4 HOH 30 1330 193 HOH HOH A . F 4 HOH 31 1331 188 HOH HOH A . F 4 HOH 32 1332 150 HOH HOH A . F 4 HOH 33 1333 2 HOH HOH A . F 4 HOH 34 1334 64 HOH HOH A . F 4 HOH 35 1335 128 HOH HOH A . F 4 HOH 36 1336 221 HOH HOH A . F 4 HOH 37 1337 8 HOH HOH A . F 4 HOH 38 1338 94 HOH HOH A . F 4 HOH 39 1339 20 HOH HOH A . F 4 HOH 40 1340 70 HOH HOH A . F 4 HOH 41 1341 100 HOH HOH A . F 4 HOH 42 1342 168 HOH HOH A . F 4 HOH 43 1343 144 HOH HOH A . F 4 HOH 44 1344 16 HOH HOH A . F 4 HOH 45 1345 80 HOH HOH A . F 4 HOH 46 1346 31 HOH HOH A . F 4 HOH 47 1347 126 HOH HOH A . F 4 HOH 48 1348 83 HOH HOH A . F 4 HOH 49 1349 214 HOH HOH A . F 4 HOH 50 1350 9 HOH HOH A . F 4 HOH 51 1351 40 HOH HOH A . F 4 HOH 52 1352 166 HOH HOH A . F 4 HOH 53 1353 27 HOH HOH A . F 4 HOH 54 1354 12 HOH HOH A . F 4 HOH 55 1355 132 HOH HOH A . F 4 HOH 56 1356 141 HOH HOH A . F 4 HOH 57 1357 96 HOH HOH A . F 4 HOH 58 1358 49 HOH HOH A . F 4 HOH 59 1359 41 HOH HOH A . F 4 HOH 60 1360 158 HOH HOH A . F 4 HOH 61 1361 92 HOH HOH A . F 4 HOH 62 1362 136 HOH HOH A . F 4 HOH 63 1363 47 HOH HOH A . F 4 HOH 64 1364 118 HOH HOH A . F 4 HOH 65 1365 215 HOH HOH A . F 4 HOH 66 1366 3 HOH HOH A . F 4 HOH 67 1367 4 HOH HOH A . F 4 HOH 68 1368 42 HOH HOH A . F 4 HOH 69 1369 46 HOH HOH A . F 4 HOH 70 1370 48 HOH HOH A . F 4 HOH 71 1371 50 HOH HOH A . F 4 HOH 72 1372 51 HOH HOH A . F 4 HOH 73 1373 81 HOH HOH A . F 4 HOH 74 1374 228 HOH HOH A . F 4 HOH 75 1375 6 HOH HOH A . F 4 HOH 76 1376 1 HOH HOH A . F 4 HOH 77 1377 65 HOH HOH A . F 4 HOH 78 1378 36 HOH HOH A . F 4 HOH 79 1379 59 HOH HOH A . F 4 HOH 80 1380 159 HOH HOH A . F 4 HOH 81 1381 231 HOH HOH A . F 4 HOH 82 1382 138 HOH HOH A . F 4 HOH 83 1383 107 HOH HOH A . F 4 HOH 84 1384 115 HOH HOH A . F 4 HOH 85 1385 149 HOH HOH A . F 4 HOH 86 1386 14 HOH HOH A . F 4 HOH 87 1387 22 HOH HOH A . F 4 HOH 88 1388 140 HOH HOH A . F 4 HOH 89 1389 187 HOH HOH A . F 4 HOH 90 1390 35 HOH HOH A . F 4 HOH 91 1391 58 HOH HOH A . F 4 HOH 92 1392 91 HOH HOH A . F 4 HOH 93 1393 195 HOH HOH A . F 4 HOH 94 1394 162 HOH HOH A . F 4 HOH 95 1395 109 HOH HOH A . F 4 HOH 96 1396 130 HOH HOH A . F 4 HOH 97 1397 71 HOH HOH A . F 4 HOH 98 1398 77 HOH HOH A . F 4 HOH 99 1399 133 HOH HOH A . F 4 HOH 100 1400 61 HOH HOH A . F 4 HOH 101 1401 97 HOH HOH A . F 4 HOH 102 1402 53 HOH HOH A . F 4 HOH 103 1403 163 HOH HOH A . F 4 HOH 104 1404 121 HOH HOH A . F 4 HOH 105 1405 38 HOH HOH A . F 4 HOH 106 1406 230 HOH HOH A . F 4 HOH 107 1407 66 HOH HOH A . F 4 HOH 108 1408 90 HOH HOH A . F 4 HOH 109 1409 219 HOH HOH A . F 4 HOH 110 1410 131 HOH HOH A . F 4 HOH 111 1411 224 HOH HOH A . F 4 HOH 112 1412 218 HOH HOH A . F 4 HOH 113 1413 87 HOH HOH A . F 4 HOH 114 1414 89 HOH HOH A . F 4 HOH 115 1415 167 HOH HOH A . F 4 HOH 116 1416 135 HOH HOH A . F 4 HOH 117 1417 21 HOH HOH A . F 4 HOH 118 1418 192 HOH HOH A . F 4 HOH 119 1419 74 HOH HOH A . F 4 HOH 120 1420 232 HOH HOH A . F 4 HOH 121 1421 62 HOH HOH A . F 4 HOH 122 1422 105 HOH HOH A . F 4 HOH 123 1423 11 HOH HOH A . F 4 HOH 124 1424 210 HOH HOH A . F 4 HOH 125 1425 139 HOH HOH A . F 4 HOH 126 1426 18 HOH HOH A . F 4 HOH 127 1427 85 HOH HOH A . F 4 HOH 128 1428 176 HOH HOH A . F 4 HOH 129 1429 170 HOH HOH A . F 4 HOH 130 1430 78 HOH HOH A . F 4 HOH 131 1431 160 HOH HOH A . F 4 HOH 132 1432 205 HOH HOH A . F 4 HOH 133 1433 175 HOH HOH A . F 4 HOH 134 1434 227 HOH HOH A . F 4 HOH 135 1435 84 HOH HOH A . F 4 HOH 136 1436 161 HOH HOH A . F 4 HOH 137 1437 146 HOH HOH A . F 4 HOH 138 1438 220 HOH HOH A . F 4 HOH 139 1439 95 HOH HOH A . F 4 HOH 140 1440 119 HOH HOH A . F 4 HOH 141 1441 32 HOH HOH A . F 4 HOH 142 1442 153 HOH HOH A . F 4 HOH 143 1443 98 HOH HOH A . F 4 HOH 144 1444 76 HOH HOH A . F 4 HOH 145 1445 37 HOH HOH A . F 4 HOH 146 1446 196 HOH HOH A . F 4 HOH 147 1447 79 HOH HOH A . F 4 HOH 148 1448 233 HOH HOH A . F 4 HOH 149 1449 225 HOH HOH A . F 4 HOH 150 1450 204 HOH HOH A . F 4 HOH 151 1451 29 HOH HOH A . F 4 HOH 152 1452 88 HOH HOH A . F 4 HOH 153 1453 217 HOH HOH A . F 4 HOH 154 1454 203 HOH HOH A . F 4 HOH 155 1455 191 HOH HOH A . F 4 HOH 156 1456 151 HOH HOH A . F 4 HOH 157 1457 229 HOH HOH A . F 4 HOH 158 1458 145 HOH HOH A . F 4 HOH 159 1459 23 HOH HOH A . F 4 HOH 160 1460 155 HOH HOH A . F 4 HOH 161 1461 72 HOH HOH A . F 4 HOH 162 1462 99 HOH HOH A . F 4 HOH 163 1463 106 HOH HOH A . F 4 HOH 164 1464 189 HOH HOH A . F 4 HOH 165 1465 82 HOH HOH A . F 4 HOH 166 1466 104 HOH HOH A . F 4 HOH 167 1467 174 HOH HOH A . F 4 HOH 168 1468 142 HOH HOH A . F 4 HOH 169 1469 226 HOH HOH A . F 4 HOH 170 1470 209 HOH HOH A . F 4 HOH 171 1471 169 HOH HOH A . F 4 HOH 172 1472 93 HOH HOH A . F 4 HOH 173 1473 86 HOH HOH A . F 4 HOH 174 1474 114 HOH HOH A . F 4 HOH 175 1475 216 HOH HOH A . F 4 HOH 176 1476 57 HOH HOH A . F 4 HOH 177 1477 147 HOH HOH A . F 4 HOH 178 1478 201 HOH HOH A . F 4 HOH 179 1479 185 HOH HOH A . F 4 HOH 180 1480 199 HOH HOH A . F 4 HOH 181 1481 154 HOH HOH A . F 4 HOH 182 1482 101 HOH HOH A . F 4 HOH 183 1483 171 HOH HOH A . F 4 HOH 184 1484 129 HOH HOH A . F 4 HOH 185 1485 103 HOH HOH A . F 4 HOH 186 1486 222 HOH HOH A . F 4 HOH 187 1487 235 HOH HOH A . F 4 HOH 188 1488 152 HOH HOH A . F 4 HOH 189 1489 177 HOH HOH A . F 4 HOH 190 1490 211 HOH HOH A . F 4 HOH 191 1491 117 HOH HOH A . F 4 HOH 192 1492 178 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.2.17 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.5 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AMoRE ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7Q6U _cell.details ? _cell.formula_units_Z ? _cell.length_a 79.039 _cell.length_a_esd ? _cell.length_b 79.039 _cell.length_b_esd ? _cell.length_c 137.850 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7Q6U _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7Q6U _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.02 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 69.42 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.25 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;ATAD2 (981-1108) at 12 mg/ml in 25 mM Tris pH 9.7, 300 mM NaCl, 0.5 mM TCEP crystallised from 20% PEG 3350, 0.2 M ammonium sulfate, 0.1 M Bis-Tris pH 6.25. Ligands were introduced by soaking, cryo-protection with 20 % glycerol. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU SATURN 944+' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-07-07 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5406 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-E+' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5406 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 26.760 _reflns.entry_id 7Q6U _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.950 _reflns.d_resolution_low 68.930 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19205 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.800 _reflns.pdbx_Rmerge_I_obs 0.095 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.104 _reflns.pdbx_Rpim_I_all 0.042 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 112343 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.950 2.110 ? ? 20292 ? ? ? 3832 99.100 ? ? ? ? 0.667 ? ? ? ? ? ? ? ? 5.300 ? ? ? 2.900 0.738 0.308 ? 1 1 0.747 ? ? ? ? ? ? ? ? ? ? 5.170 68.930 ? ? 6417 ? ? ? 1198 99.500 ? ? ? ? 0.026 ? ? ? ? ? ? ? ? 5.400 ? ? ? 50.500 0.029 0.012 ? 2 1 1.000 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 0.1181 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.1181 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -0.2361 _refine.B_iso_max 99.700 _refine.B_iso_mean 31.2500 _refine.B_iso_min 11.510 _refine.correlation_coeff_Fo_to_Fc 0.9431 _refine.correlation_coeff_Fo_to_Fc_free 0.9424 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7Q6U _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9500 _refine.ls_d_res_low 48.5700 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19140 _refine.ls_number_reflns_R_free 973 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.3200 _refine.ls_percent_reflns_R_free 5.0800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1865 _refine.ls_R_factor_R_free 0.1993 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1858 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'internal model' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.1020 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.1110 _refine.pdbx_overall_SU_R_Blow_DPI 0.1270 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.1120 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 7Q6U _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.204 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.9500 _refine_hist.d_res_low 48.5700 _refine_hist.number_atoms_solvent 192 _refine_hist.number_atoms_total 1318 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 130 _refine_hist.pdbx_B_iso_mean_ligand 45.37 _refine_hist.pdbx_B_iso_mean_solvent 44.36 _refine_hist.pdbx_number_atoms_protein 1084 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 42 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 439 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 36 ? t_trig_c_planes 2.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 167 ? t_gen_planes 5.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1163 ? t_it 20.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 153 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1528 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.010 ? 1163 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 0.880 ? 1584 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 2.610 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 16.620 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.9500 _refine_ls_shell.d_res_low 2.0600 _refine_ls_shell.number_reflns_all 2626 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 136 _refine_ls_shell.number_reflns_R_work 2490 _refine_ls_shell.percent_reflns_obs 99.3200 _refine_ls_shell.percent_reflns_R_free 5.1800 _refine_ls_shell.R_factor_all 0.2278 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2259 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2279 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7Q6U _struct.title 'Crystal structure of the bromodomain of ATAD2 with phenol HTS hit (cpd 6)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7Q6U _struct_keywords.text 'bromodomain, epigenetics, GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATAD2_HUMAN _struct_ref.pdbx_db_accession Q6PL18 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNA LEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _struct_ref.pdbx_align_begin 981 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7Q6U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6PL18 _struct_ref_seq.db_align_beg 981 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 981 _struct_ref_seq.pdbx_auth_seq_align_end 1108 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7Q6U SER A 1 ? UNP Q6PL18 ? ? 'expression tag' 979 1 1 7Q6U MET A 2 ? UNP Q6PL18 ? ? 'expression tag' 980 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 480 ? 1 MORE -33 ? 1 'SSA (A^2)' 7990 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 1 ? ILE A 24 ? SER A 979 ILE A 1002 1 ? 24 HELX_P HELX_P2 AA2 ASP A 25 ? THR A 32 ? ASP A 1003 THR A 1010 5 ? 8 HELX_P HELX_P3 AA3 ASP A 42 ? ILE A 47 ? ASP A 1020 ILE A 1025 1 ? 6 HELX_P HELX_P4 AA4 ASP A 52 ? LEU A 62 ? ASP A 1030 LEU A 1040 1 ? 11 HELX_P HELX_P5 AA5 THR A 67 ? ASN A 86 ? THR A 1045 ASN A 1064 1 ? 20 HELX_P HELX_P6 AA6 ASP A 90 ? LEU A 115 ? ASP A 1068 LEU A 1093 1 ? 26 HELX_P HELX_P7 AA7 ASP A 116 ? SER A 129 ? ASP A 1094 SER A 1107 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A SO4 1203 ? D SO4 . 2 1 A HOH 1406 ? F HOH . # _pdbx_entry_details.entry_id 7Q6U _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 1489 ? 6.11 . 2 1 O ? A HOH 1490 ? 6.45 . 3 1 O ? A HOH 1491 ? 8.19 . 4 1 O ? A HOH 1492 ? 13.79 . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 963 O2 O N N 1 963 O3 O N N 2 963 C5 C Y N 3 963 C6 C Y N 4 963 C7 C N N 5 963 C8 C N N 6 963 C10 C N N 7 963 C11 C Y N 8 963 C16 C Y N 9 963 C17 C N R 10 963 C18 C N N 11 963 O4 O N N 12 963 C19 C N N 13 963 C9 C N S 14 963 N1 N N N 15 963 C15 C Y N 16 963 C14 C Y N 17 963 C13 C Y N 18 963 C12 C Y N 19 963 N N N N 20 963 C3 C Y N 21 963 C2 C Y N 22 963 C4 C Y N 23 963 O1 O N N 24 963 C1 C Y N 25 963 O O N N 26 963 C C N N 27 963 H1 H N N 28 963 H2 H N N 29 963 H3 H N N 30 963 H4 H N N 31 963 H5 H N N 32 963 H6 H N N 33 963 H7 H N N 34 963 H8 H N N 35 963 H9 H N N 36 963 H10 H N N 37 963 H11 H N N 38 963 H12 H N N 39 963 H13 H N N 40 963 H14 H N N 41 963 H15 H N N 42 963 H16 H N N 43 963 H17 H N N 44 963 H18 H N N 45 963 H19 H N N 46 963 H20 H N N 47 ALA N N N N 48 ALA CA C N S 49 ALA C C N N 50 ALA O O N N 51 ALA CB C N N 52 ALA OXT O N N 53 ALA H H N N 54 ALA H2 H N N 55 ALA HA H N N 56 ALA HB1 H N N 57 ALA HB2 H N N 58 ALA HB3 H N N 59 ALA HXT H N N 60 ARG N N N N 61 ARG CA C N S 62 ARG C C N N 63 ARG O O N N 64 ARG CB C N N 65 ARG CG C N N 66 ARG CD C N N 67 ARG NE N N N 68 ARG CZ C N N 69 ARG NH1 N N N 70 ARG NH2 N N N 71 ARG OXT O N N 72 ARG H H N N 73 ARG H2 H N N 74 ARG HA H N N 75 ARG HB2 H N N 76 ARG HB3 H N N 77 ARG HG2 H N N 78 ARG HG3 H N N 79 ARG HD2 H N N 80 ARG HD3 H N N 81 ARG HE H N N 82 ARG HH11 H N N 83 ARG HH12 H N N 84 ARG HH21 H N N 85 ARG HH22 H N N 86 ARG HXT H N N 87 ASN N N N N 88 ASN CA C N S 89 ASN C C N N 90 ASN O O N N 91 ASN CB C N N 92 ASN CG C N N 93 ASN OD1 O N N 94 ASN ND2 N N N 95 ASN OXT O N N 96 ASN H H N N 97 ASN H2 H N N 98 ASN HA H N N 99 ASN HB2 H N N 100 ASN HB3 H N N 101 ASN HD21 H N N 102 ASN HD22 H N N 103 ASN HXT H N N 104 ASP N N N N 105 ASP CA C N S 106 ASP C C N N 107 ASP O O N N 108 ASP CB C N N 109 ASP CG C N N 110 ASP OD1 O N N 111 ASP OD2 O N N 112 ASP OXT O N N 113 ASP H H N N 114 ASP H2 H N N 115 ASP HA H N N 116 ASP HB2 H N N 117 ASP HB3 H N N 118 ASP HD2 H N N 119 ASP HXT H N N 120 CYS N N N N 121 CYS CA C N R 122 CYS C C N N 123 CYS O O N N 124 CYS CB C N N 125 CYS SG S N N 126 CYS OXT O N N 127 CYS H H N N 128 CYS H2 H N N 129 CYS HA H N N 130 CYS HB2 H N N 131 CYS HB3 H N N 132 CYS HG H N N 133 CYS HXT H N N 134 GLN N N N N 135 GLN CA C N S 136 GLN C C N N 137 GLN O O N N 138 GLN CB C N N 139 GLN CG C N N 140 GLN CD C N N 141 GLN OE1 O N N 142 GLN NE2 N N N 143 GLN OXT O N N 144 GLN H H N N 145 GLN H2 H N N 146 GLN HA H N N 147 GLN HB2 H N N 148 GLN HB3 H N N 149 GLN HG2 H N N 150 GLN HG3 H N N 151 GLN HE21 H N N 152 GLN HE22 H N N 153 GLN HXT H N N 154 GLU N N N N 155 GLU CA C N S 156 GLU C C N N 157 GLU O O N N 158 GLU CB C N N 159 GLU CG C N N 160 GLU CD C N N 161 GLU OE1 O N N 162 GLU OE2 O N N 163 GLU OXT O N N 164 GLU H H N N 165 GLU H2 H N N 166 GLU HA H N N 167 GLU HB2 H N N 168 GLU HB3 H N N 169 GLU HG2 H N N 170 GLU HG3 H N N 171 GLU HE2 H N N 172 GLU HXT H N N 173 GLY N N N N 174 GLY CA C N N 175 GLY C C N N 176 GLY O O N N 177 GLY OXT O N N 178 GLY H H N N 179 GLY H2 H N N 180 GLY HA2 H N N 181 GLY HA3 H N N 182 GLY HXT H N N 183 HIS N N N N 184 HIS CA C N S 185 HIS C C N N 186 HIS O O N N 187 HIS CB C N N 188 HIS CG C Y N 189 HIS ND1 N Y N 190 HIS CD2 C Y N 191 HIS CE1 C Y N 192 HIS NE2 N Y N 193 HIS OXT O N N 194 HIS H H N N 195 HIS H2 H N N 196 HIS HA H N N 197 HIS HB2 H N N 198 HIS HB3 H N N 199 HIS HD1 H N N 200 HIS HD2 H N N 201 HIS HE1 H N N 202 HIS HE2 H N N 203 HIS HXT H N N 204 HOH O O N N 205 HOH H1 H N N 206 HOH H2 H N N 207 ILE N N N N 208 ILE CA C N S 209 ILE C C N N 210 ILE O O N N 211 ILE CB C N S 212 ILE CG1 C N N 213 ILE CG2 C N N 214 ILE CD1 C N N 215 ILE OXT O N N 216 ILE H H N N 217 ILE H2 H N N 218 ILE HA H N N 219 ILE HB H N N 220 ILE HG12 H N N 221 ILE HG13 H N N 222 ILE HG21 H N N 223 ILE HG22 H N N 224 ILE HG23 H N N 225 ILE HD11 H N N 226 ILE HD12 H N N 227 ILE HD13 H N N 228 ILE HXT H N N 229 LEU N N N N 230 LEU CA C N S 231 LEU C C N N 232 LEU O O N N 233 LEU CB C N N 234 LEU CG C N N 235 LEU CD1 C N N 236 LEU CD2 C N N 237 LEU OXT O N N 238 LEU H H N N 239 LEU H2 H N N 240 LEU HA H N N 241 LEU HB2 H N N 242 LEU HB3 H N N 243 LEU HG H N N 244 LEU HD11 H N N 245 LEU HD12 H N N 246 LEU HD13 H N N 247 LEU HD21 H N N 248 LEU HD22 H N N 249 LEU HD23 H N N 250 LEU HXT H N N 251 LYS N N N N 252 LYS CA C N S 253 LYS C C N N 254 LYS O O N N 255 LYS CB C N N 256 LYS CG C N N 257 LYS CD C N N 258 LYS CE C N N 259 LYS NZ N N N 260 LYS OXT O N N 261 LYS H H N N 262 LYS H2 H N N 263 LYS HA H N N 264 LYS HB2 H N N 265 LYS HB3 H N N 266 LYS HG2 H N N 267 LYS HG3 H N N 268 LYS HD2 H N N 269 LYS HD3 H N N 270 LYS HE2 H N N 271 LYS HE3 H N N 272 LYS HZ1 H N N 273 LYS HZ2 H N N 274 LYS HZ3 H N N 275 LYS HXT H N N 276 MET N N N N 277 MET CA C N S 278 MET C C N N 279 MET O O N N 280 MET CB C N N 281 MET CG C N N 282 MET SD S N N 283 MET CE C N N 284 MET OXT O N N 285 MET H H N N 286 MET H2 H N N 287 MET HA H N N 288 MET HB2 H N N 289 MET HB3 H N N 290 MET HG2 H N N 291 MET HG3 H N N 292 MET HE1 H N N 293 MET HE2 H N N 294 MET HE3 H N N 295 MET HXT H N N 296 PHE N N N N 297 PHE CA C N S 298 PHE C C N N 299 PHE O O N N 300 PHE CB C N N 301 PHE CG C Y N 302 PHE CD1 C Y N 303 PHE CD2 C Y N 304 PHE CE1 C Y N 305 PHE CE2 C Y N 306 PHE CZ C Y N 307 PHE OXT O N N 308 PHE H H N N 309 PHE H2 H N N 310 PHE HA H N N 311 PHE HB2 H N N 312 PHE HB3 H N N 313 PHE HD1 H N N 314 PHE HD2 H N N 315 PHE HE1 H N N 316 PHE HE2 H N N 317 PHE HZ H N N 318 PHE HXT H N N 319 PRO N N N N 320 PRO CA C N S 321 PRO C C N N 322 PRO O O N N 323 PRO CB C N N 324 PRO CG C N N 325 PRO CD C N N 326 PRO OXT O N N 327 PRO H H N N 328 PRO HA H N N 329 PRO HB2 H N N 330 PRO HB3 H N N 331 PRO HG2 H N N 332 PRO HG3 H N N 333 PRO HD2 H N N 334 PRO HD3 H N N 335 PRO HXT H N N 336 SER N N N N 337 SER CA C N S 338 SER C C N N 339 SER O O N N 340 SER CB C N N 341 SER OG O N N 342 SER OXT O N N 343 SER H H N N 344 SER H2 H N N 345 SER HA H N N 346 SER HB2 H N N 347 SER HB3 H N N 348 SER HG H N N 349 SER HXT H N N 350 SO4 S S N N 351 SO4 O1 O N N 352 SO4 O2 O N N 353 SO4 O3 O N N 354 SO4 O4 O N N 355 THR N N N N 356 THR CA C N S 357 THR C C N N 358 THR O O N N 359 THR CB C N R 360 THR OG1 O N N 361 THR CG2 C N N 362 THR OXT O N N 363 THR H H N N 364 THR H2 H N N 365 THR HA H N N 366 THR HB H N N 367 THR HG1 H N N 368 THR HG21 H N N 369 THR HG22 H N N 370 THR HG23 H N N 371 THR HXT H N N 372 TYR N N N N 373 TYR CA C N S 374 TYR C C N N 375 TYR O O N N 376 TYR CB C N N 377 TYR CG C Y N 378 TYR CD1 C Y N 379 TYR CD2 C Y N 380 TYR CE1 C Y N 381 TYR CE2 C Y N 382 TYR CZ C Y N 383 TYR OH O N N 384 TYR OXT O N N 385 TYR H H N N 386 TYR H2 H N N 387 TYR HA H N N 388 TYR HB2 H N N 389 TYR HB3 H N N 390 TYR HD1 H N N 391 TYR HD2 H N N 392 TYR HE1 H N N 393 TYR HE2 H N N 394 TYR HH H N N 395 TYR HXT H N N 396 VAL N N N N 397 VAL CA C N S 398 VAL C C N N 399 VAL O O N N 400 VAL CB C N N 401 VAL CG1 C N N 402 VAL CG2 C N N 403 VAL OXT O N N 404 VAL H H N N 405 VAL H2 H N N 406 VAL HA H N N 407 VAL HB H N N 408 VAL HG11 H N N 409 VAL HG12 H N N 410 VAL HG13 H N N 411 VAL HG21 H N N 412 VAL HG22 H N N 413 VAL HG23 H N N 414 VAL HXT H N N 415 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 963 C14 C13 doub Y N 1 963 C14 C15 sing Y N 2 963 C13 C12 sing Y N 3 963 C15 C16 doub Y N 4 963 C12 C11 doub Y N 5 963 C16 C11 sing Y N 6 963 C16 C17 sing N N 7 963 C11 C10 sing N N 8 963 C17 C18 sing N N 9 963 C17 N sing N N 10 963 C18 N1 sing N N 11 963 C10 C9 sing N N 12 963 N C8 sing N N 13 963 N C9 sing N N 14 963 O3 C8 doub N N 15 963 N1 C19 sing N N 16 963 C8 C3 sing N N 17 963 C9 C19 sing N N 18 963 C7 O2 sing N N 19 963 C19 O4 doub N N 20 963 C4 C3 doub Y N 21 963 C4 C5 sing Y N 22 963 C3 C2 sing Y N 23 963 O2 C5 sing N N 24 963 C5 C6 doub Y N 25 963 C2 C1 doub Y N 26 963 C6 C1 sing Y N 27 963 C6 O1 sing N N 28 963 C1 O sing N N 29 963 O C sing N N 30 963 C7 H1 sing N N 31 963 C7 H2 sing N N 32 963 C7 H3 sing N N 33 963 C10 H4 sing N N 34 963 C10 H5 sing N N 35 963 C17 H6 sing N N 36 963 C18 H7 sing N N 37 963 C18 H8 sing N N 38 963 C9 H9 sing N N 39 963 N1 H10 sing N N 40 963 C15 H11 sing N N 41 963 C14 H12 sing N N 42 963 C13 H13 sing N N 43 963 C12 H14 sing N N 44 963 C2 H15 sing N N 45 963 C4 H16 sing N N 46 963 O1 H17 sing N N 47 963 C H18 sing N N 48 963 C H19 sing N N 49 963 C H20 sing N N 50 ALA N CA sing N N 51 ALA N H sing N N 52 ALA N H2 sing N N 53 ALA CA C sing N N 54 ALA CA CB sing N N 55 ALA CA HA sing N N 56 ALA C O doub N N 57 ALA C OXT sing N N 58 ALA CB HB1 sing N N 59 ALA CB HB2 sing N N 60 ALA CB HB3 sing N N 61 ALA OXT HXT sing N N 62 ARG N CA sing N N 63 ARG N H sing N N 64 ARG N H2 sing N N 65 ARG CA C sing N N 66 ARG CA CB sing N N 67 ARG CA HA sing N N 68 ARG C O doub N N 69 ARG C OXT sing N N 70 ARG CB CG sing N N 71 ARG CB HB2 sing N N 72 ARG CB HB3 sing N N 73 ARG CG CD sing N N 74 ARG CG HG2 sing N N 75 ARG CG HG3 sing N N 76 ARG CD NE sing N N 77 ARG CD HD2 sing N N 78 ARG CD HD3 sing N N 79 ARG NE CZ sing N N 80 ARG NE HE sing N N 81 ARG CZ NH1 sing N N 82 ARG CZ NH2 doub N N 83 ARG NH1 HH11 sing N N 84 ARG NH1 HH12 sing N N 85 ARG NH2 HH21 sing N N 86 ARG NH2 HH22 sing N N 87 ARG OXT HXT sing N N 88 ASN N CA sing N N 89 ASN N H sing N N 90 ASN N H2 sing N N 91 ASN CA C sing N N 92 ASN CA CB sing N N 93 ASN CA HA sing N N 94 ASN C O doub N N 95 ASN C OXT sing N N 96 ASN CB CG sing N N 97 ASN CB HB2 sing N N 98 ASN CB HB3 sing N N 99 ASN CG OD1 doub N N 100 ASN CG ND2 sing N N 101 ASN ND2 HD21 sing N N 102 ASN ND2 HD22 sing N N 103 ASN OXT HXT sing N N 104 ASP N CA sing N N 105 ASP N H sing N N 106 ASP N H2 sing N N 107 ASP CA C sing N N 108 ASP CA CB sing N N 109 ASP CA HA sing N N 110 ASP C O doub N N 111 ASP C OXT sing N N 112 ASP CB CG sing N N 113 ASP CB HB2 sing N N 114 ASP CB HB3 sing N N 115 ASP CG OD1 doub N N 116 ASP CG OD2 sing N N 117 ASP OD2 HD2 sing N N 118 ASP OXT HXT sing N N 119 CYS N CA sing N N 120 CYS N H sing N N 121 CYS N H2 sing N N 122 CYS CA C sing N N 123 CYS CA CB sing N N 124 CYS CA HA sing N N 125 CYS C O doub N N 126 CYS C OXT sing N N 127 CYS CB SG sing N N 128 CYS CB HB2 sing N N 129 CYS CB HB3 sing N N 130 CYS SG HG sing N N 131 CYS OXT HXT sing N N 132 GLN N CA sing N N 133 GLN N H sing N N 134 GLN N H2 sing N N 135 GLN CA C sing N N 136 GLN CA CB sing N N 137 GLN CA HA sing N N 138 GLN C O doub N N 139 GLN C OXT sing N N 140 GLN CB CG sing N N 141 GLN CB HB2 sing N N 142 GLN CB HB3 sing N N 143 GLN CG CD sing N N 144 GLN CG HG2 sing N N 145 GLN CG HG3 sing N N 146 GLN CD OE1 doub N N 147 GLN CD NE2 sing N N 148 GLN NE2 HE21 sing N N 149 GLN NE2 HE22 sing N N 150 GLN OXT HXT sing N N 151 GLU N CA sing N N 152 GLU N H sing N N 153 GLU N H2 sing N N 154 GLU CA C sing N N 155 GLU CA CB sing N N 156 GLU CA HA sing N N 157 GLU C O doub N N 158 GLU C OXT sing N N 159 GLU CB CG sing N N 160 GLU CB HB2 sing N N 161 GLU CB HB3 sing N N 162 GLU CG CD sing N N 163 GLU CG HG2 sing N N 164 GLU CG HG3 sing N N 165 GLU CD OE1 doub N N 166 GLU CD OE2 sing N N 167 GLU OE2 HE2 sing N N 168 GLU OXT HXT sing N N 169 GLY N CA sing N N 170 GLY N H sing N N 171 GLY N H2 sing N N 172 GLY CA C sing N N 173 GLY CA HA2 sing N N 174 GLY CA HA3 sing N N 175 GLY C O doub N N 176 GLY C OXT sing N N 177 GLY OXT HXT sing N N 178 HIS N CA sing N N 179 HIS N H sing N N 180 HIS N H2 sing N N 181 HIS CA C sing N N 182 HIS CA CB sing N N 183 HIS CA HA sing N N 184 HIS C O doub N N 185 HIS C OXT sing N N 186 HIS CB CG sing N N 187 HIS CB HB2 sing N N 188 HIS CB HB3 sing N N 189 HIS CG ND1 sing Y N 190 HIS CG CD2 doub Y N 191 HIS ND1 CE1 doub Y N 192 HIS ND1 HD1 sing N N 193 HIS CD2 NE2 sing Y N 194 HIS CD2 HD2 sing N N 195 HIS CE1 NE2 sing Y N 196 HIS CE1 HE1 sing N N 197 HIS NE2 HE2 sing N N 198 HIS OXT HXT sing N N 199 HOH O H1 sing N N 200 HOH O H2 sing N N 201 ILE N CA sing N N 202 ILE N H sing N N 203 ILE N H2 sing N N 204 ILE CA C sing N N 205 ILE CA CB sing N N 206 ILE CA HA sing N N 207 ILE C O doub N N 208 ILE C OXT sing N N 209 ILE CB CG1 sing N N 210 ILE CB CG2 sing N N 211 ILE CB HB sing N N 212 ILE CG1 CD1 sing N N 213 ILE CG1 HG12 sing N N 214 ILE CG1 HG13 sing N N 215 ILE CG2 HG21 sing N N 216 ILE CG2 HG22 sing N N 217 ILE CG2 HG23 sing N N 218 ILE CD1 HD11 sing N N 219 ILE CD1 HD12 sing N N 220 ILE CD1 HD13 sing N N 221 ILE OXT HXT sing N N 222 LEU N CA sing N N 223 LEU N H sing N N 224 LEU N H2 sing N N 225 LEU CA C sing N N 226 LEU CA CB sing N N 227 LEU CA HA sing N N 228 LEU C O doub N N 229 LEU C OXT sing N N 230 LEU CB CG sing N N 231 LEU CB HB2 sing N N 232 LEU CB HB3 sing N N 233 LEU CG CD1 sing N N 234 LEU CG CD2 sing N N 235 LEU CG HG sing N N 236 LEU CD1 HD11 sing N N 237 LEU CD1 HD12 sing N N 238 LEU CD1 HD13 sing N N 239 LEU CD2 HD21 sing N N 240 LEU CD2 HD22 sing N N 241 LEU CD2 HD23 sing N N 242 LEU OXT HXT sing N N 243 LYS N CA sing N N 244 LYS N H sing N N 245 LYS N H2 sing N N 246 LYS CA C sing N N 247 LYS CA CB sing N N 248 LYS CA HA sing N N 249 LYS C O doub N N 250 LYS C OXT sing N N 251 LYS CB CG sing N N 252 LYS CB HB2 sing N N 253 LYS CB HB3 sing N N 254 LYS CG CD sing N N 255 LYS CG HG2 sing N N 256 LYS CG HG3 sing N N 257 LYS CD CE sing N N 258 LYS CD HD2 sing N N 259 LYS CD HD3 sing N N 260 LYS CE NZ sing N N 261 LYS CE HE2 sing N N 262 LYS CE HE3 sing N N 263 LYS NZ HZ1 sing N N 264 LYS NZ HZ2 sing N N 265 LYS NZ HZ3 sing N N 266 LYS OXT HXT sing N N 267 MET N CA sing N N 268 MET N H sing N N 269 MET N H2 sing N N 270 MET CA C sing N N 271 MET CA CB sing N N 272 MET CA HA sing N N 273 MET C O doub N N 274 MET C OXT sing N N 275 MET CB CG sing N N 276 MET CB HB2 sing N N 277 MET CB HB3 sing N N 278 MET CG SD sing N N 279 MET CG HG2 sing N N 280 MET CG HG3 sing N N 281 MET SD CE sing N N 282 MET CE HE1 sing N N 283 MET CE HE2 sing N N 284 MET CE HE3 sing N N 285 MET OXT HXT sing N N 286 PHE N CA sing N N 287 PHE N H sing N N 288 PHE N H2 sing N N 289 PHE CA C sing N N 290 PHE CA CB sing N N 291 PHE CA HA sing N N 292 PHE C O doub N N 293 PHE C OXT sing N N 294 PHE CB CG sing N N 295 PHE CB HB2 sing N N 296 PHE CB HB3 sing N N 297 PHE CG CD1 doub Y N 298 PHE CG CD2 sing Y N 299 PHE CD1 CE1 sing Y N 300 PHE CD1 HD1 sing N N 301 PHE CD2 CE2 doub Y N 302 PHE CD2 HD2 sing N N 303 PHE CE1 CZ doub Y N 304 PHE CE1 HE1 sing N N 305 PHE CE2 CZ sing Y N 306 PHE CE2 HE2 sing N N 307 PHE CZ HZ sing N N 308 PHE OXT HXT sing N N 309 PRO N CA sing N N 310 PRO N CD sing N N 311 PRO N H sing N N 312 PRO CA C sing N N 313 PRO CA CB sing N N 314 PRO CA HA sing N N 315 PRO C O doub N N 316 PRO C OXT sing N N 317 PRO CB CG sing N N 318 PRO CB HB2 sing N N 319 PRO CB HB3 sing N N 320 PRO CG CD sing N N 321 PRO CG HG2 sing N N 322 PRO CG HG3 sing N N 323 PRO CD HD2 sing N N 324 PRO CD HD3 sing N N 325 PRO OXT HXT sing N N 326 SER N CA sing N N 327 SER N H sing N N 328 SER N H2 sing N N 329 SER CA C sing N N 330 SER CA CB sing N N 331 SER CA HA sing N N 332 SER C O doub N N 333 SER C OXT sing N N 334 SER CB OG sing N N 335 SER CB HB2 sing N N 336 SER CB HB3 sing N N 337 SER OG HG sing N N 338 SER OXT HXT sing N N 339 SO4 S O1 doub N N 340 SO4 S O2 doub N N 341 SO4 S O3 sing N N 342 SO4 S O4 sing N N 343 THR N CA sing N N 344 THR N H sing N N 345 THR N H2 sing N N 346 THR CA C sing N N 347 THR CA CB sing N N 348 THR CA HA sing N N 349 THR C O doub N N 350 THR C OXT sing N N 351 THR CB OG1 sing N N 352 THR CB CG2 sing N N 353 THR CB HB sing N N 354 THR OG1 HG1 sing N N 355 THR CG2 HG21 sing N N 356 THR CG2 HG22 sing N N 357 THR CG2 HG23 sing N N 358 THR OXT HXT sing N N 359 TYR N CA sing N N 360 TYR N H sing N N 361 TYR N H2 sing N N 362 TYR CA C sing N N 363 TYR CA CB sing N N 364 TYR CA HA sing N N 365 TYR C O doub N N 366 TYR C OXT sing N N 367 TYR CB CG sing N N 368 TYR CB HB2 sing N N 369 TYR CB HB3 sing N N 370 TYR CG CD1 doub Y N 371 TYR CG CD2 sing Y N 372 TYR CD1 CE1 sing Y N 373 TYR CD1 HD1 sing N N 374 TYR CD2 CE2 doub Y N 375 TYR CD2 HD2 sing N N 376 TYR CE1 CZ doub Y N 377 TYR CE1 HE1 sing N N 378 TYR CE2 CZ sing Y N 379 TYR CE2 HE2 sing N N 380 TYR CZ OH sing N N 381 TYR OH HH sing N N 382 TYR OXT HXT sing N N 383 VAL N CA sing N N 384 VAL N H sing N N 385 VAL N H2 sing N N 386 VAL CA C sing N N 387 VAL CA CB sing N N 388 VAL CA HA sing N N 389 VAL C O doub N N 390 VAL C OXT sing N N 391 VAL CB CG1 sing N N 392 VAL CB CG2 sing N N 393 VAL CB HB sing N N 394 VAL CG1 HG11 sing N N 395 VAL CG1 HG12 sing N N 396 VAL CG1 HG13 sing N N 397 VAL CG2 HG21 sing N N 398 VAL CG2 HG22 sing N N 399 VAL CG2 HG23 sing N N 400 VAL OXT HXT sing N N 401 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 963 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 963 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details 'internal model' # _atom_sites.entry_id 7Q6U _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012652 _atom_sites.fract_transf_matrix[1][2] 0.007305 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014609 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007254 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_