data_7Q6W # _entry.id 7Q6W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7Q6W pdb_00007q6w 10.2210/pdb7q6w/pdb WWPDB D_1292119124 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-01-19 2 'Structure model' 1 1 2022-02-16 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7Q6W _pdbx_database_status.recvd_initial_deposition_date 2021-11-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email marianne.schimpl@astrazeneca.com _pdbx_contact_author.name_first Marianne _pdbx_contact_author.name_last Schimpl _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2284-5250 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Patel, S.J.' 1 ? 'Winter-Holt, J.J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 3306 _citation.page_last 3331 _citation.title 'Discovery of a Potent and Selective ATAD2 Bromodomain Inhibitor with Antiproliferative Activity in Breast Cancer Models.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.1c01871 _citation.pdbx_database_id_PubMed 35133824 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Winter-Holt, J.J.' 1 ? primary 'Bardelle, C.' 2 ? primary 'Chiarparin, E.' 3 ? primary 'Dale, I.L.' 4 ? primary 'Davey, P.R.J.' 5 ? primary 'Davies, N.L.' 6 ? primary 'Denz, C.' 7 ? primary 'Fillery, S.M.' 8 ? primary 'Guerot, C.M.' 9 ? primary 'Han, F.' 10 ? primary 'Hughes, S.J.' 11 ? primary 'Kulkarni, M.' 12 ? primary 'Liu, Z.' 13 ? primary 'Milbradt, A.' 14 ? primary 'Moss, T.A.' 15 ? primary 'Niu, H.' 16 ? primary 'Patel, J.' 17 ? primary 'Rabow, A.A.' 18 ? primary 'Schimpl, M.' 19 ? primary 'Shi, J.' 20 ? primary 'Sun, D.' 21 ? primary 'Yang, D.' 22 ? primary 'Guichard, S.' 23 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ATPase family AAA domain-containing protein 2' 15453.514 1 3.6.1.3 ? bromodomain ? 2 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 3 non-polymer syn ;(1R,9S)-13-[[3-methyl-8-[(1-methylpiperidin-4-yl)amino]-[1,2,4]triazolo[4,3-b]pyridazin-6-yl]carbonyl]-11,13-diazatricyclo[7.3.1.0^{2,7}]trideca-2,4,6-trien-10-one ; 460.532 1 ? ? ? ? 4 water nat water 18.015 167 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AAA nuclear coregulator cancer-associated protein,ANCCA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _entity_poly.pdbx_seq_one_letter_code_can ;SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 ;(1R,9S)-13-[[3-methyl-8-[(1-methylpiperidin-4-yl)amino]-[1,2,4]triazolo[4,3-b]pyridazin-6-yl]carbonyl]-11,13-diazatricyclo[7.3.1.0^{2,7}]trideca-2,4,6-trien-10-one ; 93L 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 GLN n 1 4 GLU n 1 5 GLU n 1 6 ASP n 1 7 THR n 1 8 PHE n 1 9 ARG n 1 10 GLU n 1 11 LEU n 1 12 ARG n 1 13 ILE n 1 14 PHE n 1 15 LEU n 1 16 ARG n 1 17 ASN n 1 18 VAL n 1 19 THR n 1 20 HIS n 1 21 ARG n 1 22 LEU n 1 23 ALA n 1 24 ILE n 1 25 ASP n 1 26 LYS n 1 27 ARG n 1 28 PHE n 1 29 ARG n 1 30 VAL n 1 31 PHE n 1 32 THR n 1 33 LYS n 1 34 PRO n 1 35 VAL n 1 36 ASP n 1 37 PRO n 1 38 ASP n 1 39 GLU n 1 40 VAL n 1 41 PRO n 1 42 ASP n 1 43 TYR n 1 44 VAL n 1 45 THR n 1 46 VAL n 1 47 ILE n 1 48 LYS n 1 49 GLN n 1 50 PRO n 1 51 MET n 1 52 ASP n 1 53 LEU n 1 54 SER n 1 55 SER n 1 56 VAL n 1 57 ILE n 1 58 SER n 1 59 LYS n 1 60 ILE n 1 61 ASP n 1 62 LEU n 1 63 HIS n 1 64 LYS n 1 65 TYR n 1 66 LEU n 1 67 THR n 1 68 VAL n 1 69 LYS n 1 70 ASP n 1 71 TYR n 1 72 LEU n 1 73 ARG n 1 74 ASP n 1 75 ILE n 1 76 ASP n 1 77 LEU n 1 78 ILE n 1 79 CYS n 1 80 SER n 1 81 ASN n 1 82 ALA n 1 83 LEU n 1 84 GLU n 1 85 TYR n 1 86 ASN n 1 87 PRO n 1 88 ASP n 1 89 ARG n 1 90 ASP n 1 91 PRO n 1 92 GLY n 1 93 ASP n 1 94 ARG n 1 95 LEU n 1 96 ILE n 1 97 ARG n 1 98 HIS n 1 99 ARG n 1 100 ALA n 1 101 CYS n 1 102 ALA n 1 103 LEU n 1 104 ARG n 1 105 ASP n 1 106 THR n 1 107 ALA n 1 108 TYR n 1 109 ALA n 1 110 ILE n 1 111 ILE n 1 112 LYS n 1 113 GLU n 1 114 GLU n 1 115 LEU n 1 116 ASP n 1 117 GLU n 1 118 ASP n 1 119 PHE n 1 120 GLU n 1 121 GLN n 1 122 LEU n 1 123 CYS n 1 124 GLU n 1 125 GLU n 1 126 ILE n 1 127 GLN n 1 128 GLU n 1 129 SER n 1 130 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 130 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ATAD2, L16, PRO2000' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Gold _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 93L non-polymer . ;(1R,9S)-13-[[3-methyl-8-[(1-methylpiperidin-4-yl)amino]-[1,2,4]triazolo[4,3-b]pyridazin-6-yl]carbonyl]-11,13-diazatricyclo[7.3.1.0^{2,7}]trideca-2,4,6-trien-10-one ; ? 'C24 H28 N8 O2' 460.532 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 979 979 SER SER A . n A 1 2 MET 2 980 980 MET MET A . n A 1 3 GLN 3 981 981 GLN GLN A . n A 1 4 GLU 4 982 982 GLU GLU A . n A 1 5 GLU 5 983 983 GLU GLU A . n A 1 6 ASP 6 984 984 ASP ASP A . n A 1 7 THR 7 985 985 THR THR A . n A 1 8 PHE 8 986 986 PHE PHE A . n A 1 9 ARG 9 987 987 ARG ARG A . n A 1 10 GLU 10 988 988 GLU GLU A . n A 1 11 LEU 11 989 989 LEU LEU A . n A 1 12 ARG 12 990 990 ARG ARG A . n A 1 13 ILE 13 991 991 ILE ILE A . n A 1 14 PHE 14 992 992 PHE PHE A . n A 1 15 LEU 15 993 993 LEU LEU A . n A 1 16 ARG 16 994 994 ARG ARG A . n A 1 17 ASN 17 995 995 ASN ASN A . n A 1 18 VAL 18 996 996 VAL VAL A . n A 1 19 THR 19 997 997 THR THR A . n A 1 20 HIS 20 998 998 HIS HIS A . n A 1 21 ARG 21 999 999 ARG ARG A . n A 1 22 LEU 22 1000 1000 LEU LEU A . n A 1 23 ALA 23 1001 1001 ALA ALA A . n A 1 24 ILE 24 1002 1002 ILE ILE A . n A 1 25 ASP 25 1003 1003 ASP ASP A . n A 1 26 LYS 26 1004 1004 LYS LYS A . n A 1 27 ARG 27 1005 1005 ARG ARG A . n A 1 28 PHE 28 1006 1006 PHE PHE A . n A 1 29 ARG 29 1007 1007 ARG ARG A . n A 1 30 VAL 30 1008 1008 VAL VAL A . n A 1 31 PHE 31 1009 1009 PHE PHE A . n A 1 32 THR 32 1010 1010 THR THR A . n A 1 33 LYS 33 1011 1011 LYS LYS A . n A 1 34 PRO 34 1012 1012 PRO PRO A . n A 1 35 VAL 35 1013 1013 VAL VAL A . n A 1 36 ASP 36 1014 1014 ASP ASP A . n A 1 37 PRO 37 1015 1015 PRO PRO A . n A 1 38 ASP 38 1016 1016 ASP ASP A . n A 1 39 GLU 39 1017 1017 GLU GLU A . n A 1 40 VAL 40 1018 1018 VAL VAL A . n A 1 41 PRO 41 1019 1019 PRO PRO A . n A 1 42 ASP 42 1020 1020 ASP ASP A . n A 1 43 TYR 43 1021 1021 TYR TYR A . n A 1 44 VAL 44 1022 1022 VAL VAL A . n A 1 45 THR 45 1023 1023 THR THR A . n A 1 46 VAL 46 1024 1024 VAL VAL A . n A 1 47 ILE 47 1025 1025 ILE ILE A . n A 1 48 LYS 48 1026 1026 LYS LYS A . n A 1 49 GLN 49 1027 1027 GLN GLN A . n A 1 50 PRO 50 1028 1028 PRO PRO A . n A 1 51 MET 51 1029 1029 MET MET A . n A 1 52 ASP 52 1030 1030 ASP ASP A . n A 1 53 LEU 53 1031 1031 LEU LEU A . n A 1 54 SER 54 1032 1032 SER SER A . n A 1 55 SER 55 1033 1033 SER SER A . n A 1 56 VAL 56 1034 1034 VAL VAL A . n A 1 57 ILE 57 1035 1035 ILE ILE A . n A 1 58 SER 58 1036 1036 SER SER A . n A 1 59 LYS 59 1037 1037 LYS LYS A . n A 1 60 ILE 60 1038 1038 ILE ILE A . n A 1 61 ASP 61 1039 1039 ASP ASP A . n A 1 62 LEU 62 1040 1040 LEU LEU A . n A 1 63 HIS 63 1041 1041 HIS HIS A . n A 1 64 LYS 64 1042 1042 LYS LYS A . n A 1 65 TYR 65 1043 1043 TYR TYR A . n A 1 66 LEU 66 1044 1044 LEU LEU A . n A 1 67 THR 67 1045 1045 THR THR A . n A 1 68 VAL 68 1046 1046 VAL VAL A . n A 1 69 LYS 69 1047 1047 LYS LYS A . n A 1 70 ASP 70 1048 1048 ASP ASP A . n A 1 71 TYR 71 1049 1049 TYR TYR A . n A 1 72 LEU 72 1050 1050 LEU LEU A . n A 1 73 ARG 73 1051 1051 ARG ARG A . n A 1 74 ASP 74 1052 1052 ASP ASP A . n A 1 75 ILE 75 1053 1053 ILE ILE A . n A 1 76 ASP 76 1054 1054 ASP ASP A . n A 1 77 LEU 77 1055 1055 LEU LEU A . n A 1 78 ILE 78 1056 1056 ILE ILE A . n A 1 79 CYS 79 1057 1057 CYS CYS A . n A 1 80 SER 80 1058 1058 SER SER A . n A 1 81 ASN 81 1059 1059 ASN ASN A . n A 1 82 ALA 82 1060 1060 ALA ALA A . n A 1 83 LEU 83 1061 1061 LEU LEU A . n A 1 84 GLU 84 1062 1062 GLU GLU A . n A 1 85 TYR 85 1063 1063 TYR TYR A . n A 1 86 ASN 86 1064 1064 ASN ASN A . n A 1 87 PRO 87 1065 1065 PRO PRO A . n A 1 88 ASP 88 1066 1066 ASP ASP A . n A 1 89 ARG 89 1067 1067 ARG ARG A . n A 1 90 ASP 90 1068 1068 ASP ASP A . n A 1 91 PRO 91 1069 1069 PRO PRO A . n A 1 92 GLY 92 1070 1070 GLY GLY A . n A 1 93 ASP 93 1071 1071 ASP ASP A . n A 1 94 ARG 94 1072 1072 ARG ARG A . n A 1 95 LEU 95 1073 1073 LEU LEU A . n A 1 96 ILE 96 1074 1074 ILE ILE A . n A 1 97 ARG 97 1075 1075 ARG ARG A . n A 1 98 HIS 98 1076 1076 HIS HIS A . n A 1 99 ARG 99 1077 1077 ARG ARG A . n A 1 100 ALA 100 1078 1078 ALA ALA A . n A 1 101 CYS 101 1079 1079 CYS CYS A . n A 1 102 ALA 102 1080 1080 ALA ALA A . n A 1 103 LEU 103 1081 1081 LEU LEU A . n A 1 104 ARG 104 1082 1082 ARG ARG A . n A 1 105 ASP 105 1083 1083 ASP ASP A . n A 1 106 THR 106 1084 1084 THR THR A . n A 1 107 ALA 107 1085 1085 ALA ALA A . n A 1 108 TYR 108 1086 1086 TYR TYR A . n A 1 109 ALA 109 1087 1087 ALA ALA A . n A 1 110 ILE 110 1088 1088 ILE ILE A . n A 1 111 ILE 111 1089 1089 ILE ILE A . n A 1 112 LYS 112 1090 1090 LYS LYS A . n A 1 113 GLU 113 1091 1091 GLU GLU A . n A 1 114 GLU 114 1092 1092 GLU GLU A . n A 1 115 LEU 115 1093 1093 LEU LEU A . n A 1 116 ASP 116 1094 1094 ASP ASP A . n A 1 117 GLU 117 1095 1095 GLU GLU A . n A 1 118 ASP 118 1096 1096 ASP ASP A . n A 1 119 PHE 119 1097 1097 PHE PHE A . n A 1 120 GLU 120 1098 1098 GLU GLU A . n A 1 121 GLN 121 1099 1099 GLN GLN A . n A 1 122 LEU 122 1100 1100 LEU LEU A . n A 1 123 CYS 123 1101 1101 CYS CYS A . n A 1 124 GLU 124 1102 1102 GLU GLU A . n A 1 125 GLU 125 1103 1103 GLU GLU A . n A 1 126 ILE 126 1104 1104 ILE ILE A . n A 1 127 GLN 127 1105 1105 GLN GLN A . n A 1 128 GLU 128 1106 1106 GLU GLU A . n A 1 129 SER 129 1107 1107 SER SER A . n A 1 130 ARG 130 1108 1108 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 1201 1 SO4 SO4 A . C 2 SO4 1 1202 2 SO4 SO4 A . D 2 SO4 1 1203 3 SO4 SO4 A . E 3 93L 1 1204 1 93L INH A . F 4 HOH 1 1301 207 HOH HOH A . F 4 HOH 2 1302 213 HOH HOH A . F 4 HOH 3 1303 210 HOH HOH A . F 4 HOH 4 1304 138 HOH HOH A . F 4 HOH 5 1305 115 HOH HOH A . F 4 HOH 6 1306 116 HOH HOH A . F 4 HOH 7 1307 114 HOH HOH A . F 4 HOH 8 1308 10 HOH HOH A . F 4 HOH 9 1309 212 HOH HOH A . F 4 HOH 10 1310 90 HOH HOH A . F 4 HOH 11 1311 113 HOH HOH A . F 4 HOH 12 1312 21 HOH HOH A . F 4 HOH 13 1313 34 HOH HOH A . F 4 HOH 14 1314 13 HOH HOH A . F 4 HOH 15 1315 45 HOH HOH A . F 4 HOH 16 1316 54 HOH HOH A . F 4 HOH 17 1317 42 HOH HOH A . F 4 HOH 18 1318 20 HOH HOH A . F 4 HOH 19 1319 27 HOH HOH A . F 4 HOH 20 1320 176 HOH HOH A . F 4 HOH 21 1321 6 HOH HOH A . F 4 HOH 22 1322 58 HOH HOH A . F 4 HOH 23 1323 9 HOH HOH A . F 4 HOH 24 1324 134 HOH HOH A . F 4 HOH 25 1325 141 HOH HOH A . F 4 HOH 26 1326 4 HOH HOH A . F 4 HOH 27 1327 120 HOH HOH A . F 4 HOH 28 1328 117 HOH HOH A . F 4 HOH 29 1329 72 HOH HOH A . F 4 HOH 30 1330 118 HOH HOH A . F 4 HOH 31 1331 188 HOH HOH A . F 4 HOH 32 1332 60 HOH HOH A . F 4 HOH 33 1333 96 HOH HOH A . F 4 HOH 34 1334 64 HOH HOH A . F 4 HOH 35 1335 137 HOH HOH A . F 4 HOH 36 1336 22 HOH HOH A . F 4 HOH 37 1337 171 HOH HOH A . F 4 HOH 38 1338 33 HOH HOH A . F 4 HOH 39 1339 2 HOH HOH A . F 4 HOH 40 1340 140 HOH HOH A . F 4 HOH 41 1341 28 HOH HOH A . F 4 HOH 42 1342 8 HOH HOH A . F 4 HOH 43 1343 63 HOH HOH A . F 4 HOH 44 1344 209 HOH HOH A . F 4 HOH 45 1345 124 HOH HOH A . F 4 HOH 46 1346 39 HOH HOH A . F 4 HOH 47 1347 38 HOH HOH A . F 4 HOH 48 1348 16 HOH HOH A . F 4 HOH 49 1349 177 HOH HOH A . F 4 HOH 50 1350 100 HOH HOH A . F 4 HOH 51 1351 1 HOH HOH A . F 4 HOH 52 1352 12 HOH HOH A . F 4 HOH 53 1353 82 HOH HOH A . F 4 HOH 54 1354 65 HOH HOH A . F 4 HOH 55 1355 106 HOH HOH A . F 4 HOH 56 1356 35 HOH HOH A . F 4 HOH 57 1357 51 HOH HOH A . F 4 HOH 58 1358 121 HOH HOH A . F 4 HOH 59 1359 62 HOH HOH A . F 4 HOH 60 1360 3 HOH HOH A . F 4 HOH 61 1361 128 HOH HOH A . F 4 HOH 62 1362 17 HOH HOH A . F 4 HOH 63 1363 81 HOH HOH A . F 4 HOH 64 1364 59 HOH HOH A . F 4 HOH 65 1365 15 HOH HOH A . F 4 HOH 66 1366 197 HOH HOH A . F 4 HOH 67 1367 53 HOH HOH A . F 4 HOH 68 1368 125 HOH HOH A . F 4 HOH 69 1369 48 HOH HOH A . F 4 HOH 70 1370 70 HOH HOH A . F 4 HOH 71 1371 107 HOH HOH A . F 4 HOH 72 1372 216 HOH HOH A . F 4 HOH 73 1373 29 HOH HOH A . F 4 HOH 74 1374 71 HOH HOH A . F 4 HOH 75 1375 69 HOH HOH A . F 4 HOH 76 1376 214 HOH HOH A . F 4 HOH 77 1377 18 HOH HOH A . F 4 HOH 78 1378 41 HOH HOH A . F 4 HOH 79 1379 135 HOH HOH A . F 4 HOH 80 1380 133 HOH HOH A . F 4 HOH 81 1381 57 HOH HOH A . F 4 HOH 82 1382 93 HOH HOH A . F 4 HOH 83 1383 103 HOH HOH A . F 4 HOH 84 1384 108 HOH HOH A . F 4 HOH 85 1385 75 HOH HOH A . F 4 HOH 86 1386 55 HOH HOH A . F 4 HOH 87 1387 11 HOH HOH A . F 4 HOH 88 1388 104 HOH HOH A . F 4 HOH 89 1389 143 HOH HOH A . F 4 HOH 90 1390 147 HOH HOH A . F 4 HOH 91 1391 208 HOH HOH A . F 4 HOH 92 1392 86 HOH HOH A . F 4 HOH 93 1393 139 HOH HOH A . F 4 HOH 94 1394 85 HOH HOH A . F 4 HOH 95 1395 123 HOH HOH A . F 4 HOH 96 1396 131 HOH HOH A . F 4 HOH 97 1397 74 HOH HOH A . F 4 HOH 98 1398 126 HOH HOH A . F 4 HOH 99 1399 201 HOH HOH A . F 4 HOH 100 1400 150 HOH HOH A . F 4 HOH 101 1401 40 HOH HOH A . F 4 HOH 102 1402 160 HOH HOH A . F 4 HOH 103 1403 132 HOH HOH A . F 4 HOH 104 1404 83 HOH HOH A . F 4 HOH 105 1405 151 HOH HOH A . F 4 HOH 106 1406 68 HOH HOH A . F 4 HOH 107 1407 155 HOH HOH A . F 4 HOH 108 1408 162 HOH HOH A . F 4 HOH 109 1409 169 HOH HOH A . F 4 HOH 110 1410 211 HOH HOH A . F 4 HOH 111 1411 172 HOH HOH A . F 4 HOH 112 1412 95 HOH HOH A . F 4 HOH 113 1413 19 HOH HOH A . F 4 HOH 114 1414 76 HOH HOH A . F 4 HOH 115 1415 164 HOH HOH A . F 4 HOH 116 1416 52 HOH HOH A . F 4 HOH 117 1417 182 HOH HOH A . F 4 HOH 118 1418 43 HOH HOH A . F 4 HOH 119 1419 73 HOH HOH A . F 4 HOH 120 1420 109 HOH HOH A . F 4 HOH 121 1421 66 HOH HOH A . F 4 HOH 122 1422 98 HOH HOH A . F 4 HOH 123 1423 84 HOH HOH A . F 4 HOH 124 1424 163 HOH HOH A . F 4 HOH 125 1425 32 HOH HOH A . F 4 HOH 126 1426 158 HOH HOH A . F 4 HOH 127 1427 89 HOH HOH A . F 4 HOH 128 1428 99 HOH HOH A . F 4 HOH 129 1429 170 HOH HOH A . F 4 HOH 130 1430 206 HOH HOH A . F 4 HOH 131 1431 149 HOH HOH A . F 4 HOH 132 1432 215 HOH HOH A . F 4 HOH 133 1433 168 HOH HOH A . F 4 HOH 134 1434 190 HOH HOH A . F 4 HOH 135 1435 26 HOH HOH A . F 4 HOH 136 1436 144 HOH HOH A . F 4 HOH 137 1437 88 HOH HOH A . F 4 HOH 138 1438 217 HOH HOH A . F 4 HOH 139 1439 181 HOH HOH A . F 4 HOH 140 1440 119 HOH HOH A . F 4 HOH 141 1441 92 HOH HOH A . F 4 HOH 142 1442 94 HOH HOH A . F 4 HOH 143 1443 31 HOH HOH A . F 4 HOH 144 1444 156 HOH HOH A . F 4 HOH 145 1445 102 HOH HOH A . F 4 HOH 146 1446 78 HOH HOH A . F 4 HOH 147 1447 47 HOH HOH A . F 4 HOH 148 1448 97 HOH HOH A . F 4 HOH 149 1449 101 HOH HOH A . F 4 HOH 150 1450 142 HOH HOH A . F 4 HOH 151 1451 195 HOH HOH A . F 4 HOH 152 1452 110 HOH HOH A . F 4 HOH 153 1453 127 HOH HOH A . F 4 HOH 154 1454 148 HOH HOH A . F 4 HOH 155 1455 136 HOH HOH A . F 4 HOH 156 1456 50 HOH HOH A . F 4 HOH 157 1457 154 HOH HOH A . F 4 HOH 158 1458 79 HOH HOH A . F 4 HOH 159 1459 80 HOH HOH A . F 4 HOH 160 1460 87 HOH HOH A . F 4 HOH 161 1461 105 HOH HOH A . F 4 HOH 162 1462 153 HOH HOH A . F 4 HOH 163 1463 194 HOH HOH A . F 4 HOH 164 1464 145 HOH HOH A . F 4 HOH 165 1465 185 HOH HOH A . F 4 HOH 166 1466 205 HOH HOH A . F 4 HOH 167 1467 161 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.9 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.6 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AMoRE ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7Q6W _cell.details ? _cell.formula_units_Z ? _cell.length_a 79.291 _cell.length_a_esd ? _cell.length_b 79.291 _cell.length_b_esd ? _cell.length_c 138.014 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7Q6W _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7Q6W _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.05 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 69.65 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.25 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;ATAD2 (981-1108) at 12 mg/ml in 25 mM Tris pH 9.7, 300 mM NaCl, 0.5 mM TCEP crystallised from 20% PEG 3350, 0.2 M ammonium sulfate, 0.1 M Bis-Tris pH 6.25. Ligands were introduced by soaking, cryo-protection with 20 % glycerol. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU SATURN 944+' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-07-07 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5406 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-E+' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5406 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 27.690 _reflns.entry_id 7Q6W _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.960 _reflns.d_resolution_low 48.680 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17803 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.800 _reflns.pdbx_Rmerge_I_obs 0.053 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.060 _reflns.pdbx_Rpim_I_all 0.026 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 85891 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.960 2.060 ? ? 6404 ? ? ? 2586 95.400 ? ? ? ? 0.405 ? ? ? ? ? ? ? ? 2.500 ? ? ? 2.600 0.507 0.299 ? 1 1 0.751 ? ? ? ? ? ? ? ? ? ? 6.190 48.680 ? ? 3349 ? ? ? 713 99.400 ? ? ? ? 0.019 ? ? ? ? ? ? ? ? 4.700 ? ? ? 67.600 0.021 0.010 ? 2 1 0.999 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 1.2148 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 1.2148 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -2.4296 _refine.B_iso_max 95.770 _refine.B_iso_mean 32.6600 _refine.B_iso_min 13.070 _refine.correlation_coeff_Fo_to_Fc 0.9405 _refine.correlation_coeff_Fo_to_Fc_free 0.9324 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7Q6W _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9600 _refine.ls_d_res_low 48.6800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17671 _refine.ls_number_reflns_R_free 897 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.4300 _refine.ls_percent_reflns_R_free 5.0800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1914 _refine.ls_R_factor_R_free 0.2103 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1904 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'internal model' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.1150 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.1250 _refine.pdbx_overall_SU_R_Blow_DPI 0.1410 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.1240 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 7Q6W _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.241 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.9600 _refine_hist.d_res_low 48.6800 _refine_hist.number_atoms_solvent 167 _refine_hist.number_atoms_total 1300 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 130 _refine_hist.pdbx_B_iso_mean_ligand 39.62 _refine_hist.pdbx_B_iso_mean_solvent 44.74 _refine_hist.pdbx_number_atoms_protein 1084 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 49 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 439 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 36 ? t_trig_c_planes 2.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 165 ? t_gen_planes 5.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1166 ? t_it 20.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 151 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1499 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.010 ? 1166 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 0.890 ? 1588 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 2.690 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 15.780 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.9600 _refine_ls_shell.d_res_low 2.0800 _refine_ls_shell.number_reflns_all 2489 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 127 _refine_ls_shell.number_reflns_R_work 2362 _refine_ls_shell.percent_reflns_obs 82.4200 _refine_ls_shell.percent_reflns_R_free 5.1000 _refine_ls_shell.R_factor_all 0.2226 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2770 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2198 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 9 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7Q6W _struct.title 'Crystal structure of the bromodomain of ATAD2 with triazolopyridazine (cpd 22)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7Q6W _struct_keywords.text 'bromodomain, epigenetics, GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATAD2_HUMAN _struct_ref.pdbx_db_accession Q6PL18 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNA LEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _struct_ref.pdbx_align_begin 981 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7Q6W _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6PL18 _struct_ref_seq.db_align_beg 981 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 981 _struct_ref_seq.pdbx_auth_seq_align_end 1108 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7Q6W SER A 1 ? UNP Q6PL18 ? ? 'expression tag' 979 1 1 7Q6W MET A 2 ? UNP Q6PL18 ? ? 'expression tag' 980 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 480 ? 1 MORE -34 ? 1 'SSA (A^2)' 8040 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 1 ? ILE A 24 ? SER A 979 ILE A 1002 1 ? 24 HELX_P HELX_P2 AA2 ASP A 25 ? THR A 32 ? ASP A 1003 THR A 1010 5 ? 8 HELX_P HELX_P3 AA3 ASP A 52 ? LEU A 62 ? ASP A 1030 LEU A 1040 1 ? 11 HELX_P HELX_P4 AA4 THR A 67 ? ASN A 86 ? THR A 1045 ASN A 1064 1 ? 20 HELX_P HELX_P5 AA5 ASP A 90 ? LEU A 115 ? ASP A 1068 LEU A 1093 1 ? 26 HELX_P HELX_P6 AA6 ASP A 116 ? ARG A 130 ? ASP A 1094 ARG A 1108 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 1021 ? ? -93.20 -65.82 2 1 GLN A 1027 ? ? -119.29 79.79 3 1 ASN A 1064 ? ? -119.07 64.46 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A SO4 1203 ? D SO4 . 2 1 A HOH 1372 ? F HOH . # _pdbx_entry_details.entry_id 7Q6W _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 1464 ? 6.36 . 2 1 O ? A HOH 1465 ? 8.71 . 3 1 O ? A HOH 1466 ? 14.99 . 4 1 O ? A HOH 1467 ? 20.19 . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 93L C1 C Y N 1 93L C2 C Y N 2 93L C3 C Y N 3 93L N6 N N N 4 93L C7 C N N 5 93L C8 C N N 6 93L C9 C N N 7 93L C10 C N N 8 93L C11 C N N 9 93L C12 C N N 10 93L C13 C N S 11 93L C14 C N N 12 93L C15 C Y N 13 93L C16 C Y N 14 93L C19 C Y N 15 93L C20 C Y N 16 93L C21 C N R 17 93L C22 C N N 18 93L O1 O N N 19 93L C23 C N N 20 93L N7 N N N 21 93L C18 C Y N 22 93L C17 C Y N 23 93L O O N N 24 93L N3 N Y N 25 93L N2 N Y N 26 93L C C N N 27 93L C4 C Y N 28 93L C5 C Y N 29 93L N1 N Y N 30 93L N N Y N 31 93L N4 N N N 32 93L C6 C N N 33 93L N5 N N N 34 93L H1 H N N 35 93L H2 H N N 36 93L H3 H N N 37 93L H4 H N N 38 93L H5 H N N 39 93L H6 H N N 40 93L H7 H N N 41 93L H8 H N N 42 93L H9 H N N 43 93L H10 H N N 44 93L H11 H N N 45 93L H12 H N N 46 93L H13 H N N 47 93L H14 H N N 48 93L H15 H N N 49 93L H16 H N N 50 93L H17 H N N 51 93L H18 H N N 52 93L H19 H N N 53 93L H20 H N N 54 93L H21 H N N 55 93L H22 H N N 56 93L H23 H N N 57 93L H24 H N N 58 93L H25 H N N 59 93L H26 H N N 60 93L H27 H N N 61 93L H28 H N N 62 ALA N N N N 63 ALA CA C N S 64 ALA C C N N 65 ALA O O N N 66 ALA CB C N N 67 ALA OXT O N N 68 ALA H H N N 69 ALA H2 H N N 70 ALA HA H N N 71 ALA HB1 H N N 72 ALA HB2 H N N 73 ALA HB3 H N N 74 ALA HXT H N N 75 ARG N N N N 76 ARG CA C N S 77 ARG C C N N 78 ARG O O N N 79 ARG CB C N N 80 ARG CG C N N 81 ARG CD C N N 82 ARG NE N N N 83 ARG CZ C N N 84 ARG NH1 N N N 85 ARG NH2 N N N 86 ARG OXT O N N 87 ARG H H N N 88 ARG H2 H N N 89 ARG HA H N N 90 ARG HB2 H N N 91 ARG HB3 H N N 92 ARG HG2 H N N 93 ARG HG3 H N N 94 ARG HD2 H N N 95 ARG HD3 H N N 96 ARG HE H N N 97 ARG HH11 H N N 98 ARG HH12 H N N 99 ARG HH21 H N N 100 ARG HH22 H N N 101 ARG HXT H N N 102 ASN N N N N 103 ASN CA C N S 104 ASN C C N N 105 ASN O O N N 106 ASN CB C N N 107 ASN CG C N N 108 ASN OD1 O N N 109 ASN ND2 N N N 110 ASN OXT O N N 111 ASN H H N N 112 ASN H2 H N N 113 ASN HA H N N 114 ASN HB2 H N N 115 ASN HB3 H N N 116 ASN HD21 H N N 117 ASN HD22 H N N 118 ASN HXT H N N 119 ASP N N N N 120 ASP CA C N S 121 ASP C C N N 122 ASP O O N N 123 ASP CB C N N 124 ASP CG C N N 125 ASP OD1 O N N 126 ASP OD2 O N N 127 ASP OXT O N N 128 ASP H H N N 129 ASP H2 H N N 130 ASP HA H N N 131 ASP HB2 H N N 132 ASP HB3 H N N 133 ASP HD2 H N N 134 ASP HXT H N N 135 CYS N N N N 136 CYS CA C N R 137 CYS C C N N 138 CYS O O N N 139 CYS CB C N N 140 CYS SG S N N 141 CYS OXT O N N 142 CYS H H N N 143 CYS H2 H N N 144 CYS HA H N N 145 CYS HB2 H N N 146 CYS HB3 H N N 147 CYS HG H N N 148 CYS HXT H N N 149 GLN N N N N 150 GLN CA C N S 151 GLN C C N N 152 GLN O O N N 153 GLN CB C N N 154 GLN CG C N N 155 GLN CD C N N 156 GLN OE1 O N N 157 GLN NE2 N N N 158 GLN OXT O N N 159 GLN H H N N 160 GLN H2 H N N 161 GLN HA H N N 162 GLN HB2 H N N 163 GLN HB3 H N N 164 GLN HG2 H N N 165 GLN HG3 H N N 166 GLN HE21 H N N 167 GLN HE22 H N N 168 GLN HXT H N N 169 GLU N N N N 170 GLU CA C N S 171 GLU C C N N 172 GLU O O N N 173 GLU CB C N N 174 GLU CG C N N 175 GLU CD C N N 176 GLU OE1 O N N 177 GLU OE2 O N N 178 GLU OXT O N N 179 GLU H H N N 180 GLU H2 H N N 181 GLU HA H N N 182 GLU HB2 H N N 183 GLU HB3 H N N 184 GLU HG2 H N N 185 GLU HG3 H N N 186 GLU HE2 H N N 187 GLU HXT H N N 188 GLY N N N N 189 GLY CA C N N 190 GLY C C N N 191 GLY O O N N 192 GLY OXT O N N 193 GLY H H N N 194 GLY H2 H N N 195 GLY HA2 H N N 196 GLY HA3 H N N 197 GLY HXT H N N 198 HIS N N N N 199 HIS CA C N S 200 HIS C C N N 201 HIS O O N N 202 HIS CB C N N 203 HIS CG C Y N 204 HIS ND1 N Y N 205 HIS CD2 C Y N 206 HIS CE1 C Y N 207 HIS NE2 N Y N 208 HIS OXT O N N 209 HIS H H N N 210 HIS H2 H N N 211 HIS HA H N N 212 HIS HB2 H N N 213 HIS HB3 H N N 214 HIS HD1 H N N 215 HIS HD2 H N N 216 HIS HE1 H N N 217 HIS HE2 H N N 218 HIS HXT H N N 219 HOH O O N N 220 HOH H1 H N N 221 HOH H2 H N N 222 ILE N N N N 223 ILE CA C N S 224 ILE C C N N 225 ILE O O N N 226 ILE CB C N S 227 ILE CG1 C N N 228 ILE CG2 C N N 229 ILE CD1 C N N 230 ILE OXT O N N 231 ILE H H N N 232 ILE H2 H N N 233 ILE HA H N N 234 ILE HB H N N 235 ILE HG12 H N N 236 ILE HG13 H N N 237 ILE HG21 H N N 238 ILE HG22 H N N 239 ILE HG23 H N N 240 ILE HD11 H N N 241 ILE HD12 H N N 242 ILE HD13 H N N 243 ILE HXT H N N 244 LEU N N N N 245 LEU CA C N S 246 LEU C C N N 247 LEU O O N N 248 LEU CB C N N 249 LEU CG C N N 250 LEU CD1 C N N 251 LEU CD2 C N N 252 LEU OXT O N N 253 LEU H H N N 254 LEU H2 H N N 255 LEU HA H N N 256 LEU HB2 H N N 257 LEU HB3 H N N 258 LEU HG H N N 259 LEU HD11 H N N 260 LEU HD12 H N N 261 LEU HD13 H N N 262 LEU HD21 H N N 263 LEU HD22 H N N 264 LEU HD23 H N N 265 LEU HXT H N N 266 LYS N N N N 267 LYS CA C N S 268 LYS C C N N 269 LYS O O N N 270 LYS CB C N N 271 LYS CG C N N 272 LYS CD C N N 273 LYS CE C N N 274 LYS NZ N N N 275 LYS OXT O N N 276 LYS H H N N 277 LYS H2 H N N 278 LYS HA H N N 279 LYS HB2 H N N 280 LYS HB3 H N N 281 LYS HG2 H N N 282 LYS HG3 H N N 283 LYS HD2 H N N 284 LYS HD3 H N N 285 LYS HE2 H N N 286 LYS HE3 H N N 287 LYS HZ1 H N N 288 LYS HZ2 H N N 289 LYS HZ3 H N N 290 LYS HXT H N N 291 MET N N N N 292 MET CA C N S 293 MET C C N N 294 MET O O N N 295 MET CB C N N 296 MET CG C N N 297 MET SD S N N 298 MET CE C N N 299 MET OXT O N N 300 MET H H N N 301 MET H2 H N N 302 MET HA H N N 303 MET HB2 H N N 304 MET HB3 H N N 305 MET HG2 H N N 306 MET HG3 H N N 307 MET HE1 H N N 308 MET HE2 H N N 309 MET HE3 H N N 310 MET HXT H N N 311 PHE N N N N 312 PHE CA C N S 313 PHE C C N N 314 PHE O O N N 315 PHE CB C N N 316 PHE CG C Y N 317 PHE CD1 C Y N 318 PHE CD2 C Y N 319 PHE CE1 C Y N 320 PHE CE2 C Y N 321 PHE CZ C Y N 322 PHE OXT O N N 323 PHE H H N N 324 PHE H2 H N N 325 PHE HA H N N 326 PHE HB2 H N N 327 PHE HB3 H N N 328 PHE HD1 H N N 329 PHE HD2 H N N 330 PHE HE1 H N N 331 PHE HE2 H N N 332 PHE HZ H N N 333 PHE HXT H N N 334 PRO N N N N 335 PRO CA C N S 336 PRO C C N N 337 PRO O O N N 338 PRO CB C N N 339 PRO CG C N N 340 PRO CD C N N 341 PRO OXT O N N 342 PRO H H N N 343 PRO HA H N N 344 PRO HB2 H N N 345 PRO HB3 H N N 346 PRO HG2 H N N 347 PRO HG3 H N N 348 PRO HD2 H N N 349 PRO HD3 H N N 350 PRO HXT H N N 351 SER N N N N 352 SER CA C N S 353 SER C C N N 354 SER O O N N 355 SER CB C N N 356 SER OG O N N 357 SER OXT O N N 358 SER H H N N 359 SER H2 H N N 360 SER HA H N N 361 SER HB2 H N N 362 SER HB3 H N N 363 SER HG H N N 364 SER HXT H N N 365 SO4 S S N N 366 SO4 O1 O N N 367 SO4 O2 O N N 368 SO4 O3 O N N 369 SO4 O4 O N N 370 THR N N N N 371 THR CA C N S 372 THR C C N N 373 THR O O N N 374 THR CB C N R 375 THR OG1 O N N 376 THR CG2 C N N 377 THR OXT O N N 378 THR H H N N 379 THR H2 H N N 380 THR HA H N N 381 THR HB H N N 382 THR HG1 H N N 383 THR HG21 H N N 384 THR HG22 H N N 385 THR HG23 H N N 386 THR HXT H N N 387 TYR N N N N 388 TYR CA C N S 389 TYR C C N N 390 TYR O O N N 391 TYR CB C N N 392 TYR CG C Y N 393 TYR CD1 C Y N 394 TYR CD2 C Y N 395 TYR CE1 C Y N 396 TYR CE2 C Y N 397 TYR CZ C Y N 398 TYR OH O N N 399 TYR OXT O N N 400 TYR H H N N 401 TYR H2 H N N 402 TYR HA H N N 403 TYR HB2 H N N 404 TYR HB3 H N N 405 TYR HD1 H N N 406 TYR HD2 H N N 407 TYR HE1 H N N 408 TYR HE2 H N N 409 TYR HH H N N 410 TYR HXT H N N 411 VAL N N N N 412 VAL CA C N S 413 VAL C C N N 414 VAL O O N N 415 VAL CB C N N 416 VAL CG1 C N N 417 VAL CG2 C N N 418 VAL OXT O N N 419 VAL H H N N 420 VAL H2 H N N 421 VAL HA H N N 422 VAL HB H N N 423 VAL HG11 H N N 424 VAL HG12 H N N 425 VAL HG13 H N N 426 VAL HG21 H N N 427 VAL HG22 H N N 428 VAL HG23 H N N 429 VAL HXT H N N 430 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 93L C18 C17 doub Y N 1 93L C18 C19 sing Y N 2 93L C17 C16 sing Y N 3 93L C19 C20 doub Y N 4 93L C16 C15 doub Y N 5 93L C20 C15 sing Y N 6 93L C20 C21 sing N N 7 93L C15 C14 sing N N 8 93L C21 C22 sing N N 9 93L C21 N6 sing N N 10 93L C22 N7 sing N N 11 93L C14 C13 sing N N 12 93L N6 C12 sing N N 13 93L N6 C13 sing N N 14 93L O C12 doub N N 15 93L N7 C23 sing N N 16 93L C12 C3 sing N N 17 93L C13 C23 sing N N 18 93L C23 O1 doub N N 19 93L C C1 sing N N 20 93L N3 C3 doub Y N 21 93L N3 N2 sing Y N 22 93L C3 C4 sing Y N 23 93L N2 C1 sing Y N 24 93L N2 C2 sing Y N 25 93L C1 N doub Y N 26 93L C4 C5 doub Y N 27 93L N N1 sing Y N 28 93L C2 C5 sing Y N 29 93L C2 N1 doub Y N 30 93L C5 N4 sing N N 31 93L N4 C6 sing N N 32 93L C6 C7 sing N N 33 93L C6 C10 sing N N 34 93L C7 C8 sing N N 35 93L C8 N5 sing N N 36 93L C10 C9 sing N N 37 93L C9 N5 sing N N 38 93L N5 C11 sing N N 39 93L C7 H1 sing N N 40 93L C7 H2 sing N N 41 93L C8 H3 sing N N 42 93L C8 H4 sing N N 43 93L C9 H5 sing N N 44 93L C9 H6 sing N N 45 93L C10 H7 sing N N 46 93L C10 H8 sing N N 47 93L C11 H9 sing N N 48 93L C11 H10 sing N N 49 93L C11 H11 sing N N 50 93L C13 H12 sing N N 51 93L C14 H13 sing N N 52 93L C14 H14 sing N N 53 93L C16 H15 sing N N 54 93L C19 H16 sing N N 55 93L C21 H17 sing N N 56 93L C22 H18 sing N N 57 93L C22 H19 sing N N 58 93L N7 H20 sing N N 59 93L C18 H21 sing N N 60 93L C17 H22 sing N N 61 93L C H23 sing N N 62 93L C H24 sing N N 63 93L C H25 sing N N 64 93L C4 H26 sing N N 65 93L N4 H27 sing N N 66 93L C6 H28 sing N N 67 ALA N CA sing N N 68 ALA N H sing N N 69 ALA N H2 sing N N 70 ALA CA C sing N N 71 ALA CA CB sing N N 72 ALA CA HA sing N N 73 ALA C O doub N N 74 ALA C OXT sing N N 75 ALA CB HB1 sing N N 76 ALA CB HB2 sing N N 77 ALA CB HB3 sing N N 78 ALA OXT HXT sing N N 79 ARG N CA sing N N 80 ARG N H sing N N 81 ARG N H2 sing N N 82 ARG CA C sing N N 83 ARG CA CB sing N N 84 ARG CA HA sing N N 85 ARG C O doub N N 86 ARG C OXT sing N N 87 ARG CB CG sing N N 88 ARG CB HB2 sing N N 89 ARG CB HB3 sing N N 90 ARG CG CD sing N N 91 ARG CG HG2 sing N N 92 ARG CG HG3 sing N N 93 ARG CD NE sing N N 94 ARG CD HD2 sing N N 95 ARG CD HD3 sing N N 96 ARG NE CZ sing N N 97 ARG NE HE sing N N 98 ARG CZ NH1 sing N N 99 ARG CZ NH2 doub N N 100 ARG NH1 HH11 sing N N 101 ARG NH1 HH12 sing N N 102 ARG NH2 HH21 sing N N 103 ARG NH2 HH22 sing N N 104 ARG OXT HXT sing N N 105 ASN N CA sing N N 106 ASN N H sing N N 107 ASN N H2 sing N N 108 ASN CA C sing N N 109 ASN CA CB sing N N 110 ASN CA HA sing N N 111 ASN C O doub N N 112 ASN C OXT sing N N 113 ASN CB CG sing N N 114 ASN CB HB2 sing N N 115 ASN CB HB3 sing N N 116 ASN CG OD1 doub N N 117 ASN CG ND2 sing N N 118 ASN ND2 HD21 sing N N 119 ASN ND2 HD22 sing N N 120 ASN OXT HXT sing N N 121 ASP N CA sing N N 122 ASP N H sing N N 123 ASP N H2 sing N N 124 ASP CA C sing N N 125 ASP CA CB sing N N 126 ASP CA HA sing N N 127 ASP C O doub N N 128 ASP C OXT sing N N 129 ASP CB CG sing N N 130 ASP CB HB2 sing N N 131 ASP CB HB3 sing N N 132 ASP CG OD1 doub N N 133 ASP CG OD2 sing N N 134 ASP OD2 HD2 sing N N 135 ASP OXT HXT sing N N 136 CYS N CA sing N N 137 CYS N H sing N N 138 CYS N H2 sing N N 139 CYS CA C sing N N 140 CYS CA CB sing N N 141 CYS CA HA sing N N 142 CYS C O doub N N 143 CYS C OXT sing N N 144 CYS CB SG sing N N 145 CYS CB HB2 sing N N 146 CYS CB HB3 sing N N 147 CYS SG HG sing N N 148 CYS OXT HXT sing N N 149 GLN N CA sing N N 150 GLN N H sing N N 151 GLN N H2 sing N N 152 GLN CA C sing N N 153 GLN CA CB sing N N 154 GLN CA HA sing N N 155 GLN C O doub N N 156 GLN C OXT sing N N 157 GLN CB CG sing N N 158 GLN CB HB2 sing N N 159 GLN CB HB3 sing N N 160 GLN CG CD sing N N 161 GLN CG HG2 sing N N 162 GLN CG HG3 sing N N 163 GLN CD OE1 doub N N 164 GLN CD NE2 sing N N 165 GLN NE2 HE21 sing N N 166 GLN NE2 HE22 sing N N 167 GLN OXT HXT sing N N 168 GLU N CA sing N N 169 GLU N H sing N N 170 GLU N H2 sing N N 171 GLU CA C sing N N 172 GLU CA CB sing N N 173 GLU CA HA sing N N 174 GLU C O doub N N 175 GLU C OXT sing N N 176 GLU CB CG sing N N 177 GLU CB HB2 sing N N 178 GLU CB HB3 sing N N 179 GLU CG CD sing N N 180 GLU CG HG2 sing N N 181 GLU CG HG3 sing N N 182 GLU CD OE1 doub N N 183 GLU CD OE2 sing N N 184 GLU OE2 HE2 sing N N 185 GLU OXT HXT sing N N 186 GLY N CA sing N N 187 GLY N H sing N N 188 GLY N H2 sing N N 189 GLY CA C sing N N 190 GLY CA HA2 sing N N 191 GLY CA HA3 sing N N 192 GLY C O doub N N 193 GLY C OXT sing N N 194 GLY OXT HXT sing N N 195 HIS N CA sing N N 196 HIS N H sing N N 197 HIS N H2 sing N N 198 HIS CA C sing N N 199 HIS CA CB sing N N 200 HIS CA HA sing N N 201 HIS C O doub N N 202 HIS C OXT sing N N 203 HIS CB CG sing N N 204 HIS CB HB2 sing N N 205 HIS CB HB3 sing N N 206 HIS CG ND1 sing Y N 207 HIS CG CD2 doub Y N 208 HIS ND1 CE1 doub Y N 209 HIS ND1 HD1 sing N N 210 HIS CD2 NE2 sing Y N 211 HIS CD2 HD2 sing N N 212 HIS CE1 NE2 sing Y N 213 HIS CE1 HE1 sing N N 214 HIS NE2 HE2 sing N N 215 HIS OXT HXT sing N N 216 HOH O H1 sing N N 217 HOH O H2 sing N N 218 ILE N CA sing N N 219 ILE N H sing N N 220 ILE N H2 sing N N 221 ILE CA C sing N N 222 ILE CA CB sing N N 223 ILE CA HA sing N N 224 ILE C O doub N N 225 ILE C OXT sing N N 226 ILE CB CG1 sing N N 227 ILE CB CG2 sing N N 228 ILE CB HB sing N N 229 ILE CG1 CD1 sing N N 230 ILE CG1 HG12 sing N N 231 ILE CG1 HG13 sing N N 232 ILE CG2 HG21 sing N N 233 ILE CG2 HG22 sing N N 234 ILE CG2 HG23 sing N N 235 ILE CD1 HD11 sing N N 236 ILE CD1 HD12 sing N N 237 ILE CD1 HD13 sing N N 238 ILE OXT HXT sing N N 239 LEU N CA sing N N 240 LEU N H sing N N 241 LEU N H2 sing N N 242 LEU CA C sing N N 243 LEU CA CB sing N N 244 LEU CA HA sing N N 245 LEU C O doub N N 246 LEU C OXT sing N N 247 LEU CB CG sing N N 248 LEU CB HB2 sing N N 249 LEU CB HB3 sing N N 250 LEU CG CD1 sing N N 251 LEU CG CD2 sing N N 252 LEU CG HG sing N N 253 LEU CD1 HD11 sing N N 254 LEU CD1 HD12 sing N N 255 LEU CD1 HD13 sing N N 256 LEU CD2 HD21 sing N N 257 LEU CD2 HD22 sing N N 258 LEU CD2 HD23 sing N N 259 LEU OXT HXT sing N N 260 LYS N CA sing N N 261 LYS N H sing N N 262 LYS N H2 sing N N 263 LYS CA C sing N N 264 LYS CA CB sing N N 265 LYS CA HA sing N N 266 LYS C O doub N N 267 LYS C OXT sing N N 268 LYS CB CG sing N N 269 LYS CB HB2 sing N N 270 LYS CB HB3 sing N N 271 LYS CG CD sing N N 272 LYS CG HG2 sing N N 273 LYS CG HG3 sing N N 274 LYS CD CE sing N N 275 LYS CD HD2 sing N N 276 LYS CD HD3 sing N N 277 LYS CE NZ sing N N 278 LYS CE HE2 sing N N 279 LYS CE HE3 sing N N 280 LYS NZ HZ1 sing N N 281 LYS NZ HZ2 sing N N 282 LYS NZ HZ3 sing N N 283 LYS OXT HXT sing N N 284 MET N CA sing N N 285 MET N H sing N N 286 MET N H2 sing N N 287 MET CA C sing N N 288 MET CA CB sing N N 289 MET CA HA sing N N 290 MET C O doub N N 291 MET C OXT sing N N 292 MET CB CG sing N N 293 MET CB HB2 sing N N 294 MET CB HB3 sing N N 295 MET CG SD sing N N 296 MET CG HG2 sing N N 297 MET CG HG3 sing N N 298 MET SD CE sing N N 299 MET CE HE1 sing N N 300 MET CE HE2 sing N N 301 MET CE HE3 sing N N 302 MET OXT HXT sing N N 303 PHE N CA sing N N 304 PHE N H sing N N 305 PHE N H2 sing N N 306 PHE CA C sing N N 307 PHE CA CB sing N N 308 PHE CA HA sing N N 309 PHE C O doub N N 310 PHE C OXT sing N N 311 PHE CB CG sing N N 312 PHE CB HB2 sing N N 313 PHE CB HB3 sing N N 314 PHE CG CD1 doub Y N 315 PHE CG CD2 sing Y N 316 PHE CD1 CE1 sing Y N 317 PHE CD1 HD1 sing N N 318 PHE CD2 CE2 doub Y N 319 PHE CD2 HD2 sing N N 320 PHE CE1 CZ doub Y N 321 PHE CE1 HE1 sing N N 322 PHE CE2 CZ sing Y N 323 PHE CE2 HE2 sing N N 324 PHE CZ HZ sing N N 325 PHE OXT HXT sing N N 326 PRO N CA sing N N 327 PRO N CD sing N N 328 PRO N H sing N N 329 PRO CA C sing N N 330 PRO CA CB sing N N 331 PRO CA HA sing N N 332 PRO C O doub N N 333 PRO C OXT sing N N 334 PRO CB CG sing N N 335 PRO CB HB2 sing N N 336 PRO CB HB3 sing N N 337 PRO CG CD sing N N 338 PRO CG HG2 sing N N 339 PRO CG HG3 sing N N 340 PRO CD HD2 sing N N 341 PRO CD HD3 sing N N 342 PRO OXT HXT sing N N 343 SER N CA sing N N 344 SER N H sing N N 345 SER N H2 sing N N 346 SER CA C sing N N 347 SER CA CB sing N N 348 SER CA HA sing N N 349 SER C O doub N N 350 SER C OXT sing N N 351 SER CB OG sing N N 352 SER CB HB2 sing N N 353 SER CB HB3 sing N N 354 SER OG HG sing N N 355 SER OXT HXT sing N N 356 SO4 S O1 doub N N 357 SO4 S O2 doub N N 358 SO4 S O3 sing N N 359 SO4 S O4 sing N N 360 THR N CA sing N N 361 THR N H sing N N 362 THR N H2 sing N N 363 THR CA C sing N N 364 THR CA CB sing N N 365 THR CA HA sing N N 366 THR C O doub N N 367 THR C OXT sing N N 368 THR CB OG1 sing N N 369 THR CB CG2 sing N N 370 THR CB HB sing N N 371 THR OG1 HG1 sing N N 372 THR CG2 HG21 sing N N 373 THR CG2 HG22 sing N N 374 THR CG2 HG23 sing N N 375 THR OXT HXT sing N N 376 TYR N CA sing N N 377 TYR N H sing N N 378 TYR N H2 sing N N 379 TYR CA C sing N N 380 TYR CA CB sing N N 381 TYR CA HA sing N N 382 TYR C O doub N N 383 TYR C OXT sing N N 384 TYR CB CG sing N N 385 TYR CB HB2 sing N N 386 TYR CB HB3 sing N N 387 TYR CG CD1 doub Y N 388 TYR CG CD2 sing Y N 389 TYR CD1 CE1 sing Y N 390 TYR CD1 HD1 sing N N 391 TYR CD2 CE2 doub Y N 392 TYR CD2 HD2 sing N N 393 TYR CE1 CZ doub Y N 394 TYR CE1 HE1 sing N N 395 TYR CE2 CZ sing Y N 396 TYR CE2 HE2 sing N N 397 TYR CZ OH sing N N 398 TYR OH HH sing N N 399 TYR OXT HXT sing N N 400 VAL N CA sing N N 401 VAL N H sing N N 402 VAL N H2 sing N N 403 VAL CA C sing N N 404 VAL CA CB sing N N 405 VAL CA HA sing N N 406 VAL C O doub N N 407 VAL C OXT sing N N 408 VAL CB CG1 sing N N 409 VAL CB CG2 sing N N 410 VAL CB HB sing N N 411 VAL CG1 HG11 sing N N 412 VAL CG1 HG12 sing N N 413 VAL CG1 HG13 sing N N 414 VAL CG2 HG21 sing N N 415 VAL CG2 HG22 sing N N 416 VAL CG2 HG23 sing N N 417 VAL OXT HXT sing N N 418 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 93L _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 93L _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name ? _pdbx_initial_refinement_model.details 'internal model' # _atom_sites.entry_id 7Q6W _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012612 _atom_sites.fract_transf_matrix[1][2] 0.007281 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014563 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007246 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_