data_7Q7E # _entry.id 7Q7E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7Q7E pdb_00007q7e 10.2210/pdb7q7e/pdb WWPDB D_1292118954 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-16 2 'Structure model' 1 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7Q7E _pdbx_database_status.recvd_initial_deposition_date 2021-11-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 7Q75 unspecified PDB . 7Q76 unspecified PDB . 7Q77 unspecified PDB . 7Q78 unspecified PDB . 7Q79 unspecified PDB . 7Q7A unspecified PDB . 7Q7B unspecified PDB . 7Q7C unspecified PDB . 7Q7D unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email alke.meents@desy.de _pdbx_contact_author.name_first Alke _pdbx_contact_author.name_last Meents _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6078-4095 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lieske, J.' 1 0000-0002-5439-5082 'Guenther, S.' 2 0000-0002-7329-6653 'Saouane, S.' 3 0000-0002-7260-9021 'Meents, A.' 4 0000-0001-6078-4095 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Fixed-target high-pressure macromolecular crystallography' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lieske, J.' 1 0000-0002-5439-5082 primary 'Saouane, S.' 2 0000-0002-7260-9021 primary 'Guenther, S.' 3 0000-0002-7329-6653 primary 'Meyer, J.' 4 ? primary 'Pakendorf, T.' 5 ? primary 'Reime, B.' 6 ? primary 'Burkhardt, A.' 7 ? primary 'Crosas, E.' 8 ? primary 'Hakanpaeae, J.' 9 ? primary 'Stachnik, K.' 10 ? primary 'Sieg, J.' 11 ? primary 'Rarey, M.' 12 ? primary 'Abdellatif, M.H.' 13 ? primary 'Gabdulkhakov, A.G.' 14 ? primary 'Selikhanov, G.K.' 15 ? primary 'Chapman, H.N.' 16 ? primary 'Meents, A.' 17 0000-0001-6078-4095 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase 17B' 37327.086 1 2.7.11.1 ? ? ? 2 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 11 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DAP kinase-related apoptosis-inducing protein kinase 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGVDLGTENLYFQSMENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIA VLELAKSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQ NILLSSIYPLGDIKIVDFGMSRKIGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQE TYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSE DKTSKSS ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGVDLGTENLYFQSMENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIA VLELAKSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQ NILLSSIYPLGDIKIVDFGMSRKIGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQE TYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSE DKTSKSS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "ADENOSINE-5'-TRIPHOSPHATE" ATP 3 'MAGNESIUM ION' MG 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 VAL n 1 12 ASP n 1 13 LEU n 1 14 GLY n 1 15 THR n 1 16 GLU n 1 17 ASN n 1 18 LEU n 1 19 TYR n 1 20 PHE n 1 21 GLN n 1 22 SER n 1 23 MET n 1 24 GLU n 1 25 ASN n 1 26 PHE n 1 27 ASN n 1 28 ASN n 1 29 PHE n 1 30 TYR n 1 31 ILE n 1 32 LEU n 1 33 THR n 1 34 SER n 1 35 LYS n 1 36 GLU n 1 37 LEU n 1 38 GLY n 1 39 ARG n 1 40 GLY n 1 41 LYS n 1 42 PHE n 1 43 ALA n 1 44 VAL n 1 45 VAL n 1 46 ARG n 1 47 GLN n 1 48 CYS n 1 49 ILE n 1 50 SER n 1 51 LYS n 1 52 SER n 1 53 THR n 1 54 GLY n 1 55 GLN n 1 56 GLU n 1 57 TYR n 1 58 ALA n 1 59 ALA n 1 60 LYS n 1 61 PHE n 1 62 LEU n 1 63 LYS n 1 64 LYS n 1 65 ARG n 1 66 ARG n 1 67 ARG n 1 68 GLY n 1 69 GLN n 1 70 ASP n 1 71 CYS n 1 72 ARG n 1 73 ALA n 1 74 GLU n 1 75 ILE n 1 76 LEU n 1 77 HIS n 1 78 GLU n 1 79 ILE n 1 80 ALA n 1 81 VAL n 1 82 LEU n 1 83 GLU n 1 84 LEU n 1 85 ALA n 1 86 LYS n 1 87 SER n 1 88 CYS n 1 89 PRO n 1 90 ARG n 1 91 VAL n 1 92 ILE n 1 93 ASN n 1 94 LEU n 1 95 HIS n 1 96 GLU n 1 97 VAL n 1 98 TYR n 1 99 GLU n 1 100 ASN n 1 101 THR n 1 102 SER n 1 103 GLU n 1 104 ILE n 1 105 ILE n 1 106 LEU n 1 107 ILE n 1 108 LEU n 1 109 GLU n 1 110 TYR n 1 111 ALA n 1 112 ALA n 1 113 GLY n 1 114 GLY n 1 115 GLU n 1 116 ILE n 1 117 PHE n 1 118 SER n 1 119 LEU n 1 120 CYS n 1 121 LEU n 1 122 PRO n 1 123 GLU n 1 124 LEU n 1 125 ALA n 1 126 GLU n 1 127 MET n 1 128 VAL n 1 129 SER n 1 130 GLU n 1 131 ASN n 1 132 ASP n 1 133 VAL n 1 134 ILE n 1 135 ARG n 1 136 LEU n 1 137 ILE n 1 138 LYS n 1 139 GLN n 1 140 ILE n 1 141 LEU n 1 142 GLU n 1 143 GLY n 1 144 VAL n 1 145 TYR n 1 146 TYR n 1 147 LEU n 1 148 HIS n 1 149 GLN n 1 150 ASN n 1 151 ASN n 1 152 ILE n 1 153 VAL n 1 154 HIS n 1 155 LEU n 1 156 ASP n 1 157 LEU n 1 158 LYS n 1 159 PRO n 1 160 GLN n 1 161 ASN n 1 162 ILE n 1 163 LEU n 1 164 LEU n 1 165 SER n 1 166 SER n 1 167 ILE n 1 168 TYR n 1 169 PRO n 1 170 LEU n 1 171 GLY n 1 172 ASP n 1 173 ILE n 1 174 LYS n 1 175 ILE n 1 176 VAL n 1 177 ASP n 1 178 PHE n 1 179 GLY n 1 180 MET n 1 181 SER n 1 182 ARG n 1 183 LYS n 1 184 ILE n 1 185 GLY n 1 186 HIS n 1 187 ALA n 1 188 CYS n 1 189 GLU n 1 190 LEU n 1 191 ARG n 1 192 GLU n 1 193 ILE n 1 194 MET n 1 195 GLY n 1 196 THR n 1 197 PRO n 1 198 GLU n 1 199 TYR n 1 200 LEU n 1 201 ALA n 1 202 PRO n 1 203 GLU n 1 204 ILE n 1 205 LEU n 1 206 ASN n 1 207 TYR n 1 208 ASP n 1 209 PRO n 1 210 ILE n 1 211 THR n 1 212 THR n 1 213 ALA n 1 214 THR n 1 215 ASP n 1 216 MET n 1 217 TRP n 1 218 ASN n 1 219 ILE n 1 220 GLY n 1 221 ILE n 1 222 ILE n 1 223 ALA n 1 224 TYR n 1 225 MET n 1 226 LEU n 1 227 LEU n 1 228 THR n 1 229 HIS n 1 230 THR n 1 231 SER n 1 232 PRO n 1 233 PHE n 1 234 VAL n 1 235 GLY n 1 236 GLU n 1 237 ASP n 1 238 ASN n 1 239 GLN n 1 240 GLU n 1 241 THR n 1 242 TYR n 1 243 LEU n 1 244 ASN n 1 245 ILE n 1 246 SER n 1 247 GLN n 1 248 VAL n 1 249 ASN n 1 250 VAL n 1 251 ASP n 1 252 TYR n 1 253 SER n 1 254 GLU n 1 255 GLU n 1 256 THR n 1 257 PHE n 1 258 SER n 1 259 SER n 1 260 VAL n 1 261 SER n 1 262 GLN n 1 263 LEU n 1 264 ALA n 1 265 THR n 1 266 ASP n 1 267 PHE n 1 268 ILE n 1 269 GLN n 1 270 SER n 1 271 LEU n 1 272 LEU n 1 273 VAL n 1 274 LYS n 1 275 ASN n 1 276 PRO n 1 277 GLU n 1 278 LYS n 1 279 ARG n 1 280 PRO n 1 281 THR n 1 282 ALA n 1 283 GLU n 1 284 ILE n 1 285 CYS n 1 286 LEU n 1 287 SER n 1 288 HIS n 1 289 SER n 1 290 TRP n 1 291 LEU n 1 292 GLN n 1 293 GLN n 1 294 TRP n 1 295 ASP n 1 296 PHE n 1 297 GLU n 1 298 ASN n 1 299 LEU n 1 300 PHE n 1 301 HIS n 1 302 PRO n 1 303 GLU n 1 304 GLU n 1 305 THR n 1 306 SER n 1 307 SER n 1 308 SER n 1 309 SER n 1 310 GLN n 1 311 THR n 1 312 GLN n 1 313 ASP n 1 314 HIS n 1 315 SER n 1 316 VAL n 1 317 ARG n 1 318 SER n 1 319 SER n 1 320 GLU n 1 321 ASP n 1 322 LYS n 1 323 THR n 1 324 SER n 1 325 LYS n 1 326 SER n 1 327 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 327 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'STK17B, DRAK2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 ATP non-polymer . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 3 ? ? ? A . n A 1 2 HIS 2 4 ? ? ? A . n A 1 3 HIS 3 5 ? ? ? A . n A 1 4 HIS 4 6 ? ? ? A . n A 1 5 HIS 5 7 ? ? ? A . n A 1 6 HIS 6 8 ? ? ? A . n A 1 7 HIS 7 9 ? ? ? A . n A 1 8 SER 8 10 ? ? ? A . n A 1 9 SER 9 11 ? ? ? A . n A 1 10 GLY 10 12 ? ? ? A . n A 1 11 VAL 11 13 ? ? ? A . n A 1 12 ASP 12 14 ? ? ? A . n A 1 13 LEU 13 15 ? ? ? A . n A 1 14 GLY 14 16 ? ? ? A . n A 1 15 THR 15 17 ? ? ? A . n A 1 16 GLU 16 18 18 GLU GLU A . n A 1 17 ASN 17 19 19 ASN ASN A . n A 1 18 LEU 18 20 20 LEU LEU A . n A 1 19 TYR 19 21 21 TYR TYR A . n A 1 20 PHE 20 22 22 PHE PHE A . n A 1 21 GLN 21 23 23 GLN GLN A . n A 1 22 SER 22 24 24 SER SER A . n A 1 23 MET 23 25 25 MET MET A . n A 1 24 GLU 24 26 26 GLU GLU A . n A 1 25 ASN 25 27 27 ASN ASN A . n A 1 26 PHE 26 28 28 PHE PHE A . n A 1 27 ASN 27 29 29 ASN ASN A . n A 1 28 ASN 28 30 30 ASN ASN A . n A 1 29 PHE 29 31 31 PHE PHE A . n A 1 30 TYR 30 32 32 TYR TYR A . n A 1 31 ILE 31 33 33 ILE ILE A . n A 1 32 LEU 32 34 34 LEU LEU A . n A 1 33 THR 33 35 35 THR THR A . n A 1 34 SER 34 36 36 SER SER A . n A 1 35 LYS 35 37 37 LYS LYS A . n A 1 36 GLU 36 38 38 GLU GLU A . n A 1 37 LEU 37 39 39 LEU LEU A . n A 1 38 GLY 38 40 40 GLY GLY A . n A 1 39 ARG 39 41 41 ARG ARG A . n A 1 40 GLY 40 42 42 GLY GLY A . n A 1 41 LYS 41 43 43 LYS LYS A . n A 1 42 PHE 42 44 44 PHE PHE A . n A 1 43 ALA 43 45 45 ALA ALA A . n A 1 44 VAL 44 46 46 VAL VAL A . n A 1 45 VAL 45 47 47 VAL VAL A . n A 1 46 ARG 46 48 48 ARG ARG A . n A 1 47 GLN 47 49 49 GLN GLN A . n A 1 48 CYS 48 50 50 CYS CYS A . n A 1 49 ILE 49 51 51 ILE ILE A . n A 1 50 SER 50 52 52 SER SER A . n A 1 51 LYS 51 53 53 LYS LYS A . n A 1 52 SER 52 54 54 SER SER A . n A 1 53 THR 53 55 55 THR THR A . n A 1 54 GLY 54 56 56 GLY GLY A . n A 1 55 GLN 55 57 57 GLN GLN A . n A 1 56 GLU 56 58 58 GLU GLU A . n A 1 57 TYR 57 59 59 TYR TYR A . n A 1 58 ALA 58 60 60 ALA ALA A . n A 1 59 ALA 59 61 61 ALA ALA A . n A 1 60 LYS 60 62 62 LYS LYS A . n A 1 61 PHE 61 63 63 PHE PHE A . n A 1 62 LEU 62 64 64 LEU LEU A . n A 1 63 LYS 63 65 65 LYS LYS A . n A 1 64 LYS 64 66 66 LYS LYS A . n A 1 65 ARG 65 67 67 ARG ARG A . n A 1 66 ARG 66 68 68 ARG ARG A . n A 1 67 ARG 67 69 69 ARG ARG A . n A 1 68 GLY 68 70 70 GLY GLY A . n A 1 69 GLN 69 71 71 GLN GLN A . n A 1 70 ASP 70 72 72 ASP ASP A . n A 1 71 CYS 71 73 73 CYS CYS A . n A 1 72 ARG 72 74 74 ARG ARG A . n A 1 73 ALA 73 75 75 ALA ALA A . n A 1 74 GLU 74 76 76 GLU GLU A . n A 1 75 ILE 75 77 77 ILE ILE A . n A 1 76 LEU 76 78 78 LEU LEU A . n A 1 77 HIS 77 79 79 HIS HIS A . n A 1 78 GLU 78 80 80 GLU GLU A . n A 1 79 ILE 79 81 81 ILE ILE A . n A 1 80 ALA 80 82 82 ALA ALA A . n A 1 81 VAL 81 83 83 VAL VAL A . n A 1 82 LEU 82 84 84 LEU LEU A . n A 1 83 GLU 83 85 85 GLU GLU A . n A 1 84 LEU 84 86 86 LEU LEU A . n A 1 85 ALA 85 87 87 ALA ALA A . n A 1 86 LYS 86 88 88 LYS LYS A . n A 1 87 SER 87 89 89 SER SER A . n A 1 88 CYS 88 90 90 CYS CYS A . n A 1 89 PRO 89 91 91 PRO PRO A . n A 1 90 ARG 90 92 92 ARG ARG A . n A 1 91 VAL 91 93 93 VAL VAL A . n A 1 92 ILE 92 94 94 ILE ILE A . n A 1 93 ASN 93 95 95 ASN ASN A . n A 1 94 LEU 94 96 96 LEU LEU A . n A 1 95 HIS 95 97 97 HIS HIS A . n A 1 96 GLU 96 98 98 GLU GLU A . n A 1 97 VAL 97 99 99 VAL VAL A . n A 1 98 TYR 98 100 100 TYR TYR A . n A 1 99 GLU 99 101 101 GLU GLU A . n A 1 100 ASN 100 102 102 ASN ASN A . n A 1 101 THR 101 103 103 THR THR A . n A 1 102 SER 102 104 104 SER SER A . n A 1 103 GLU 103 105 105 GLU GLU A . n A 1 104 ILE 104 106 106 ILE ILE A . n A 1 105 ILE 105 107 107 ILE ILE A . n A 1 106 LEU 106 108 108 LEU LEU A . n A 1 107 ILE 107 109 109 ILE ILE A . n A 1 108 LEU 108 110 110 LEU LEU A . n A 1 109 GLU 109 111 111 GLU GLU A . n A 1 110 TYR 110 112 112 TYR TYR A . n A 1 111 ALA 111 113 113 ALA ALA A . n A 1 112 ALA 112 114 114 ALA ALA A . n A 1 113 GLY 113 115 115 GLY GLY A . n A 1 114 GLY 114 116 116 GLY GLY A . n A 1 115 GLU 115 117 117 GLU GLU A . n A 1 116 ILE 116 118 118 ILE ILE A . n A 1 117 PHE 117 119 119 PHE PHE A . n A 1 118 SER 118 120 120 SER SER A . n A 1 119 LEU 119 121 121 LEU LEU A . n A 1 120 CYS 120 122 122 CYS CYS A . n A 1 121 LEU 121 123 123 LEU LEU A . n A 1 122 PRO 122 124 124 PRO PRO A . n A 1 123 GLU 123 125 125 GLU GLU A . n A 1 124 LEU 124 126 126 LEU LEU A . n A 1 125 ALA 125 127 127 ALA ALA A . n A 1 126 GLU 126 128 128 GLU GLU A . n A 1 127 MET 127 129 129 MET MET A . n A 1 128 VAL 128 130 130 VAL VAL A . n A 1 129 SER 129 131 131 SER SER A . n A 1 130 GLU 130 132 132 GLU GLU A . n A 1 131 ASN 131 133 133 ASN ASN A . n A 1 132 ASP 132 134 134 ASP ASP A . n A 1 133 VAL 133 135 135 VAL VAL A . n A 1 134 ILE 134 136 136 ILE ILE A . n A 1 135 ARG 135 137 137 ARG ARG A . n A 1 136 LEU 136 138 138 LEU LEU A . n A 1 137 ILE 137 139 139 ILE ILE A . n A 1 138 LYS 138 140 140 LYS LYS A . n A 1 139 GLN 139 141 141 GLN GLN A . n A 1 140 ILE 140 142 142 ILE ILE A . n A 1 141 LEU 141 143 143 LEU LEU A . n A 1 142 GLU 142 144 144 GLU GLU A . n A 1 143 GLY 143 145 145 GLY GLY A . n A 1 144 VAL 144 146 146 VAL VAL A . n A 1 145 TYR 145 147 147 TYR TYR A . n A 1 146 TYR 146 148 148 TYR TYR A . n A 1 147 LEU 147 149 149 LEU LEU A . n A 1 148 HIS 148 150 150 HIS HIS A . n A 1 149 GLN 149 151 151 GLN GLN A . n A 1 150 ASN 150 152 152 ASN ASN A . n A 1 151 ASN 151 153 153 ASN ASN A . n A 1 152 ILE 152 154 154 ILE ILE A . n A 1 153 VAL 153 155 155 VAL VAL A . n A 1 154 HIS 154 156 156 HIS HIS A . n A 1 155 LEU 155 157 157 LEU LEU A . n A 1 156 ASP 156 158 158 ASP ASP A . n A 1 157 LEU 157 159 159 LEU LEU A . n A 1 158 LYS 158 160 160 LYS LYS A . n A 1 159 PRO 159 161 161 PRO PRO A . n A 1 160 GLN 160 162 162 GLN GLN A . n A 1 161 ASN 161 163 163 ASN ASN A . n A 1 162 ILE 162 164 164 ILE ILE A . n A 1 163 LEU 163 165 165 LEU LEU A . n A 1 164 LEU 164 166 166 LEU LEU A . n A 1 165 SER 165 167 167 SER SER A . n A 1 166 SER 166 168 168 SER SER A . n A 1 167 ILE 167 169 169 ILE ILE A . n A 1 168 TYR 168 170 170 TYR TYR A . n A 1 169 PRO 169 171 171 PRO PRO A . n A 1 170 LEU 170 172 172 LEU LEU A . n A 1 171 GLY 171 173 173 GLY GLY A . n A 1 172 ASP 172 174 174 ASP ASP A . n A 1 173 ILE 173 175 175 ILE ILE A . n A 1 174 LYS 174 176 176 LYS LYS A . n A 1 175 ILE 175 177 177 ILE ILE A . n A 1 176 VAL 176 178 178 VAL VAL A . n A 1 177 ASP 177 179 179 ASP ASP A . n A 1 178 PHE 178 180 180 PHE PHE A . n A 1 179 GLY 179 181 181 GLY GLY A . n A 1 180 MET 180 182 182 MET MET A . n A 1 181 SER 181 183 183 SER SER A . n A 1 182 ARG 182 184 184 ARG ARG A . n A 1 183 LYS 183 185 185 LYS LYS A . n A 1 184 ILE 184 186 186 ILE ILE A . n A 1 185 GLY 185 187 187 GLY GLY A . n A 1 186 HIS 186 188 188 HIS HIS A . n A 1 187 ALA 187 189 189 ALA ALA A . n A 1 188 CYS 188 190 190 CYS CYS A . n A 1 189 GLU 189 191 191 GLU GLU A . n A 1 190 LEU 190 192 192 LEU LEU A . n A 1 191 ARG 191 193 193 ARG ARG A . n A 1 192 GLU 192 194 194 GLU GLU A . n A 1 193 ILE 193 195 195 ILE ILE A . n A 1 194 MET 194 196 196 MET MET A . n A 1 195 GLY 195 197 197 GLY GLY A . n A 1 196 THR 196 198 198 THR THR A . n A 1 197 PRO 197 199 199 PRO PRO A . n A 1 198 GLU 198 200 200 GLU GLU A . n A 1 199 TYR 199 201 201 TYR TYR A . n A 1 200 LEU 200 202 202 LEU LEU A . n A 1 201 ALA 201 203 203 ALA ALA A . n A 1 202 PRO 202 204 204 PRO PRO A . n A 1 203 GLU 203 205 205 GLU GLU A . n A 1 204 ILE 204 206 206 ILE ILE A . n A 1 205 LEU 205 207 207 LEU LEU A . n A 1 206 ASN 206 208 208 ASN ASN A . n A 1 207 TYR 207 209 209 TYR TYR A . n A 1 208 ASP 208 210 210 ASP ASP A . n A 1 209 PRO 209 211 211 PRO PRO A . n A 1 210 ILE 210 212 212 ILE ILE A . n A 1 211 THR 211 213 213 THR THR A . n A 1 212 THR 212 214 214 THR THR A . n A 1 213 ALA 213 215 215 ALA ALA A . n A 1 214 THR 214 216 216 THR THR A . n A 1 215 ASP 215 217 217 ASP ASP A . n A 1 216 MET 216 218 218 MET MET A . n A 1 217 TRP 217 219 219 TRP TRP A . n A 1 218 ASN 218 220 220 ASN ASN A . n A 1 219 ILE 219 221 221 ILE ILE A . n A 1 220 GLY 220 222 222 GLY GLY A . n A 1 221 ILE 221 223 223 ILE ILE A . n A 1 222 ILE 222 224 224 ILE ILE A . n A 1 223 ALA 223 225 225 ALA ALA A . n A 1 224 TYR 224 226 226 TYR TYR A . n A 1 225 MET 225 227 227 MET MET A . n A 1 226 LEU 226 228 228 LEU LEU A . n A 1 227 LEU 227 229 229 LEU LEU A . n A 1 228 THR 228 230 230 THR THR A . n A 1 229 HIS 229 231 231 HIS HIS A . n A 1 230 THR 230 232 232 THR THR A . n A 1 231 SER 231 233 233 SER SER A . n A 1 232 PRO 232 234 234 PRO PRO A . n A 1 233 PHE 233 235 235 PHE PHE A . n A 1 234 VAL 234 236 236 VAL VAL A . n A 1 235 GLY 235 237 237 GLY GLY A . n A 1 236 GLU 236 238 238 GLU GLU A . n A 1 237 ASP 237 239 239 ASP ASP A . n A 1 238 ASN 238 240 240 ASN ASN A . n A 1 239 GLN 239 241 241 GLN GLN A . n A 1 240 GLU 240 242 242 GLU GLU A . n A 1 241 THR 241 243 243 THR THR A . n A 1 242 TYR 242 244 244 TYR TYR A . n A 1 243 LEU 243 245 245 LEU LEU A . n A 1 244 ASN 244 246 246 ASN ASN A . n A 1 245 ILE 245 247 247 ILE ILE A . n A 1 246 SER 246 248 248 SER SER A . n A 1 247 GLN 247 249 249 GLN GLN A . n A 1 248 VAL 248 250 250 VAL VAL A . n A 1 249 ASN 249 251 251 ASN ASN A . n A 1 250 VAL 250 252 252 VAL VAL A . n A 1 251 ASP 251 253 253 ASP ASP A . n A 1 252 TYR 252 254 254 TYR TYR A . n A 1 253 SER 253 255 255 SER SER A . n A 1 254 GLU 254 256 256 GLU GLU A . n A 1 255 GLU 255 257 257 GLU GLU A . n A 1 256 THR 256 258 258 THR THR A . n A 1 257 PHE 257 259 259 PHE PHE A . n A 1 258 SER 258 260 260 SER SER A . n A 1 259 SER 259 261 261 SER SER A . n A 1 260 VAL 260 262 262 VAL VAL A . n A 1 261 SER 261 263 263 SER SER A . n A 1 262 GLN 262 264 264 GLN GLN A . n A 1 263 LEU 263 265 265 LEU LEU A . n A 1 264 ALA 264 266 266 ALA ALA A . n A 1 265 THR 265 267 267 THR THR A . n A 1 266 ASP 266 268 268 ASP ASP A . n A 1 267 PHE 267 269 269 PHE PHE A . n A 1 268 ILE 268 270 270 ILE ILE A . n A 1 269 GLN 269 271 271 GLN GLN A . n A 1 270 SER 270 272 272 SER SER A . n A 1 271 LEU 271 273 273 LEU LEU A . n A 1 272 LEU 272 274 274 LEU LEU A . n A 1 273 VAL 273 275 275 VAL VAL A . n A 1 274 LYS 274 276 276 LYS LYS A . n A 1 275 ASN 275 277 277 ASN ASN A . n A 1 276 PRO 276 278 278 PRO PRO A . n A 1 277 GLU 277 279 279 GLU GLU A . n A 1 278 LYS 278 280 280 LYS LYS A . n A 1 279 ARG 279 281 281 ARG ARG A . n A 1 280 PRO 280 282 282 PRO PRO A . n A 1 281 THR 281 283 283 THR THR A . n A 1 282 ALA 282 284 284 ALA ALA A . n A 1 283 GLU 283 285 285 GLU GLU A . n A 1 284 ILE 284 286 286 ILE ILE A . n A 1 285 CYS 285 287 287 CYS CYS A . n A 1 286 LEU 286 288 288 LEU LEU A . n A 1 287 SER 287 289 289 SER SER A . n A 1 288 HIS 288 290 290 HIS HIS A . n A 1 289 SER 289 291 291 SER SER A . n A 1 290 TRP 290 292 292 TRP TRP A . n A 1 291 LEU 291 293 293 LEU LEU A . n A 1 292 GLN 292 294 294 GLN GLN A . n A 1 293 GLN 293 295 295 GLN GLN A . n A 1 294 TRP 294 296 296 TRP TRP A . n A 1 295 ASP 295 297 297 ASP ASP A . n A 1 296 PHE 296 298 ? ? ? A . n A 1 297 GLU 297 299 ? ? ? A . n A 1 298 ASN 298 300 ? ? ? A . n A 1 299 LEU 299 301 ? ? ? A . n A 1 300 PHE 300 302 ? ? ? A . n A 1 301 HIS 301 303 ? ? ? A . n A 1 302 PRO 302 304 ? ? ? A . n A 1 303 GLU 303 305 ? ? ? A . n A 1 304 GLU 304 306 ? ? ? A . n A 1 305 THR 305 307 ? ? ? A . n A 1 306 SER 306 308 ? ? ? A . n A 1 307 SER 307 309 ? ? ? A . n A 1 308 SER 308 310 ? ? ? A . n A 1 309 SER 309 311 ? ? ? A . n A 1 310 GLN 310 312 ? ? ? A . n A 1 311 THR 311 313 ? ? ? A . n A 1 312 GLN 312 314 ? ? ? A . n A 1 313 ASP 313 315 ? ? ? A . n A 1 314 HIS 314 316 ? ? ? A . n A 1 315 SER 315 317 ? ? ? A . n A 1 316 VAL 316 318 ? ? ? A . n A 1 317 ARG 317 319 ? ? ? A . n A 1 318 SER 318 320 ? ? ? A . n A 1 319 SER 319 321 ? ? ? A . n A 1 320 GLU 320 322 ? ? ? A . n A 1 321 ASP 321 323 ? ? ? A . n A 1 322 LYS 322 324 ? ? ? A . n A 1 323 THR 323 325 ? ? ? A . n A 1 324 SER 324 326 ? ? ? A . n A 1 325 LYS 325 327 ? ? ? A . n A 1 326 SER 326 328 ? ? ? A . n A 1 327 SER 327 329 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ATP 1 401 1 ATP ATP A . C 3 MG 1 402 1 MG MG A . D 4 HOH 1 501 1 HOH HOH A . D 4 HOH 2 502 2 HOH HOH A . D 4 HOH 3 503 10 HOH HOH A . D 4 HOH 4 504 12 HOH HOH A . D 4 HOH 5 505 8 HOH HOH A . D 4 HOH 6 506 13 HOH HOH A . D 4 HOH 7 507 6 HOH HOH A . D 4 HOH 8 508 11 HOH HOH A . D 4 HOH 9 509 4 HOH HOH A . D 4 HOH 10 510 3 HOH HOH A . D 4 HOH 11 511 7 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13-2998_9999 1 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7Q7E _cell.details ? _cell.formula_units_Z ? _cell.length_a 84.240 _cell.length_a_esd ? _cell.length_b 84.240 _cell.length_b_esd ? _cell.length_c 117.260 _cell.length_c_esd ? _cell.volume 832121.237 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7Q7E _symmetry.cell_setting ? _symmetry.Int_Tables_number 91 _symmetry.space_group_name_Hall 'P 4w 2c' _symmetry.space_group_name_H-M 'P 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7Q7E _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.79 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.86 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'BATCH MODE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure 101.325 _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;20 mg/ml protein in 25 mM HEPES pH 7.5, 500 mM NaCl, 0.5 mM TCEP was mixed 1:1.5 with precipitant solution (0.1 M HEPES 6.5, 0.2M ammonium acetate, 20% PEG 3350, 50mM sodium/potassium tartrate, 0.8mM quercetin). Batch grown crystals were subsequently mixed 1:1 with 100 mM ATP/50 mM magnesium chloride in DRAK2 crystallization buffer and incubated for half an hour. ; _exptl_crystal_grow.pdbx_pH_range 6.5-7.5 # _diffrn.ambient_environment 'gaseous He' _diffrn.ambient_temp 295 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure 101.325 _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 X CdTe 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-09-30 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.477 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, DESY BEAMLINE P11' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.477 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline P11 _diffrn_source.pdbx_synchrotron_site 'PETRA III, DESY' # _reflns.B_iso_Wilson_estimate 69.36 _reflns.entry_id 7Q7E _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.85 _reflns.d_resolution_low 48.12 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9542 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 91.75 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.8 _reflns.pdbx_Rmerge_I_obs 0.350 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.44 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.359 _reflns.pdbx_Rpim_I_all 0.076 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.994 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.85 _reflns_shell.d_res_low 2.952 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.10 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 930 _reflns_shell.percent_possible_all 92.90 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 3.753 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 21.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 3.845 _reflns_shell.pdbx_Rpim_I_all 0.812 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.336 _reflns_shell.pdbx_CC_star 0.709 _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 73.23 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7Q7E _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.85 _refine.ls_d_res_low 48.12 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9534 _refine.ls_number_reflns_R_free 955 _refine.ls_number_reflns_R_work 8579 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.80 _refine.ls_percent_reflns_R_free 10.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1910 _refine.ls_R_factor_R_free 0.2392 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1856 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6QF4 _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.5237 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3854 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.85 _refine_hist.d_res_low 48.12 _refine_hist.number_atoms_solvent 11 _refine_hist.number_atoms_total 2295 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2252 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0027 ? 2359 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5658 ? 3211 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0427 ? 362 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0027 ? 401 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.6881 ? 1395 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.85 3.00 . . 135 1207 92.87 . . . 0.3341 . 0.2994 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.00 3.19 . . 132 1193 92.92 . . . 0.3473 . 0.2790 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.19 3.43 . . 134 1214 92.58 . . . 0.3418 . 0.2529 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.43 3.78 . . 136 1220 92.18 . . . 0.2594 . 0.1917 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.78 4.33 . . 136 1215 91.90 . . . 0.2095 . 0.1531 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.33 5.45 . . 136 1231 91.01 . . . 0.1793 . 0.1463 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.45 48.12 . . 146 1299 89.42 . . . 0.2205 . 0.1698 . . . . . . . . . . . # _struct.entry_id 7Q7E _struct.title ;Room temperature structure of the human Serine/Threonine Kinase 17B (STK17B/DRAK2) in complex with ATP/ADP at atmospheric pressure in a sapphire capillary after high helium gas pressure release ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7Q7E _struct_keywords.text 'HPMX, high-pressure macromolecular crystallography, sapphire capillary, room temperature, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ST17B_HUMAN _struct_ref.pdbx_db_accession O94768 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLELAKSCPRVINLHEVYENTS EIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSR KIGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQ LATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKSS ; _struct_ref.pdbx_align_begin 25 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7Q7E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 23 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 327 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O94768 _struct_ref_seq.db_align_beg 25 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 329 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 25 _struct_ref_seq.pdbx_auth_seq_align_end 329 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7Q7E MET A 1 ? UNP O94768 ? ? 'initiating methionine' 3 1 1 7Q7E HIS A 2 ? UNP O94768 ? ? 'expression tag' 4 2 1 7Q7E HIS A 3 ? UNP O94768 ? ? 'expression tag' 5 3 1 7Q7E HIS A 4 ? UNP O94768 ? ? 'expression tag' 6 4 1 7Q7E HIS A 5 ? UNP O94768 ? ? 'expression tag' 7 5 1 7Q7E HIS A 6 ? UNP O94768 ? ? 'expression tag' 8 6 1 7Q7E HIS A 7 ? UNP O94768 ? ? 'expression tag' 9 7 1 7Q7E SER A 8 ? UNP O94768 ? ? 'expression tag' 10 8 1 7Q7E SER A 9 ? UNP O94768 ? ? 'expression tag' 11 9 1 7Q7E GLY A 10 ? UNP O94768 ? ? 'expression tag' 12 10 1 7Q7E VAL A 11 ? UNP O94768 ? ? 'expression tag' 13 11 1 7Q7E ASP A 12 ? UNP O94768 ? ? 'expression tag' 14 12 1 7Q7E LEU A 13 ? UNP O94768 ? ? 'expression tag' 15 13 1 7Q7E GLY A 14 ? UNP O94768 ? ? 'expression tag' 16 14 1 7Q7E THR A 15 ? UNP O94768 ? ? 'expression tag' 17 15 1 7Q7E GLU A 16 ? UNP O94768 ? ? 'expression tag' 18 16 1 7Q7E ASN A 17 ? UNP O94768 ? ? 'expression tag' 19 17 1 7Q7E LEU A 18 ? UNP O94768 ? ? 'expression tag' 20 18 1 7Q7E TYR A 19 ? UNP O94768 ? ? 'expression tag' 21 19 1 7Q7E PHE A 20 ? UNP O94768 ? ? 'expression tag' 22 20 1 7Q7E GLN A 21 ? UNP O94768 ? ? 'expression tag' 23 21 1 7Q7E SER A 22 ? UNP O94768 ? ? 'expression tag' 24 22 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1000 ? 1 MORE -14 ? 1 'SSA (A^2)' 13380 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 22 ? PHE A 29 ? SER A 24 PHE A 31 1 ? 8 HELX_P HELX_P2 AA2 CYS A 71 ? ALA A 85 ? CYS A 73 ALA A 87 1 ? 15 HELX_P HELX_P3 AA3 LEU A 121 ? VAL A 128 ? LEU A 123 VAL A 130 5 ? 8 HELX_P HELX_P4 AA4 SER A 129 ? ASN A 150 ? SER A 131 ASN A 152 1 ? 22 HELX_P HELX_P5 AA5 LYS A 158 ? GLN A 160 ? LYS A 160 GLN A 162 5 ? 3 HELX_P HELX_P6 AA6 ARG A 191 ? GLY A 195 ? ARG A 193 GLY A 197 5 ? 5 HELX_P HELX_P7 AA7 THR A 196 ? LEU A 200 ? THR A 198 LEU A 202 5 ? 5 HELX_P HELX_P8 AA8 ALA A 201 ? ASN A 206 ? ALA A 203 ASN A 208 1 ? 6 HELX_P HELX_P9 AA9 THR A 212 ? HIS A 229 ? THR A 214 HIS A 231 1 ? 18 HELX_P HELX_P10 AB1 ASP A 237 ? VAL A 248 ? ASP A 239 VAL A 250 1 ? 12 HELX_P HELX_P11 AB2 SER A 253 ? SER A 258 ? SER A 255 SER A 260 1 ? 6 HELX_P HELX_P12 AB3 SER A 261 ? LEU A 272 ? SER A 263 LEU A 274 1 ? 12 HELX_P HELX_P13 AB4 ASN A 275 ? ARG A 279 ? ASN A 277 ARG A 281 5 ? 5 HELX_P HELX_P14 AB5 THR A 281 ? LEU A 286 ? THR A 283 LEU A 288 1 ? 6 HELX_P HELX_P15 AB6 SER A 287 ? GLN A 292 ? SER A 289 GLN A 294 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASN 161 OD1 ? ? ? 1_555 C MG . MG ? ? A ASN 163 A MG 402 1_555 ? ? ? ? ? ? ? 2.111 ? ? metalc2 metalc ? ? A ASP 177 OD2 ? ? ? 1_555 C MG . MG ? ? A ASP 179 A MG 402 1_555 ? ? ? ? ? ? ? 2.416 ? ? metalc3 metalc ? ? B ATP . O1B A ? ? 1_555 C MG . MG ? ? A ATP 401 A MG 402 1_555 ? ? ? ? ? ? ? 2.372 ? ? metalc4 metalc ? ? B ATP . O1B B ? ? 1_555 C MG . MG ? ? A ATP 401 A MG 402 1_555 ? ? ? ? ? ? ? 2.479 ? ? metalc5 metalc ? ? B ATP . O1A A ? ? 1_555 C MG . MG ? ? A ATP 401 A MG 402 1_555 ? ? ? ? ? ? ? 2.556 ? ? metalc6 metalc ? ? B ATP . O1A B ? ? 1_555 C MG . MG ? ? A ATP 401 A MG 402 1_555 ? ? ? ? ? ? ? 2.450 ? ? metalc7 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 402 A HOH 502 1_555 ? ? ? ? ? ? ? 2.935 ? ? metalc8 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 402 A HOH 510 1_555 ? ? ? ? ? ? ? 2.498 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASN 161 ? A ASN 163 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OD2 ? A ASP 177 ? A ASP 179 ? 1_555 84.3 ? 2 OD1 ? A ASN 161 ? A ASN 163 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1B A B ATP . ? A ATP 401 ? 1_555 156.7 ? 3 OD2 ? A ASP 177 ? A ASP 179 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1B A B ATP . ? A ATP 401 ? 1_555 74.2 ? 4 OD1 ? A ASN 161 ? A ASN 163 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1B B B ATP . ? A ATP 401 ? 1_555 152.3 ? 5 OD2 ? A ASP 177 ? A ASP 179 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1B B B ATP . ? A ATP 401 ? 1_555 70.1 ? 6 O1B A B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1B B B ATP . ? A ATP 401 ? 1_555 4.4 ? 7 OD1 ? A ASN 161 ? A ASN 163 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1A A B ATP . ? A ATP 401 ? 1_555 83.5 ? 8 OD2 ? A ASP 177 ? A ASP 179 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1A A B ATP . ? A ATP 401 ? 1_555 78.2 ? 9 O1B A B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1A A B ATP . ? A ATP 401 ? 1_555 83.4 ? 10 O1B B B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1A A B ATP . ? A ATP 401 ? 1_555 80.9 ? 11 OD1 ? A ASN 161 ? A ASN 163 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1A B B ATP . ? A ATP 401 ? 1_555 84.5 ? 12 OD2 ? A ASP 177 ? A ASP 179 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1A B B ATP . ? A ATP 401 ? 1_555 78.4 ? 13 O1B A B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1A B B ATP . ? A ATP 401 ? 1_555 82.5 ? 14 O1B B B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1A B B ATP . ? A ATP 401 ? 1_555 80.0 ? 15 O1A A B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O1A B B ATP . ? A ATP 401 ? 1_555 1.1 ? 16 OD1 ? A ASN 161 ? A ASN 163 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 502 ? 1_555 124.7 ? 17 OD2 ? A ASP 177 ? A ASP 179 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 502 ? 1_555 71.4 ? 18 O1B A B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 502 ? 1_555 56.6 ? 19 O1B B B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 502 ? 1_555 57.6 ? 20 O1A A B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 502 ? 1_555 134.6 ? 21 O1A B B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 502 ? 1_555 134.0 ? 22 OD1 ? A ASN 161 ? A ASN 163 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 510 ? 1_555 99.0 ? 23 OD2 ? A ASP 177 ? A ASP 179 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 510 ? 1_555 130.3 ? 24 O1B A B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 510 ? 1_555 101.7 ? 25 O1B B B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 510 ? 1_555 105.6 ? 26 O1A A B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 510 ? 1_555 151.5 ? 27 O1A B B ATP . ? A ATP 401 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 510 ? 1_555 151.2 ? 28 O ? D HOH . ? A HOH 502 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 510 ? 1_555 66.3 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 168 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 170 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 169 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 171 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.02 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 30 ? ARG A 39 ? TYR A 32 ARG A 41 AA1 2 ALA A 43 ? SER A 50 ? ALA A 45 SER A 52 AA1 3 GLU A 56 ? LYS A 63 ? GLU A 58 LYS A 65 AA1 4 GLU A 103 ? GLU A 109 ? GLU A 105 GLU A 111 AA1 5 LEU A 94 ? GLU A 99 ? LEU A 96 GLU A 101 AA2 1 ARG A 65 ? ARG A 66 ? ARG A 67 ARG A 68 AA2 2 GLN A 69 ? ASP A 70 ? GLN A 71 ASP A 72 AA3 1 GLY A 114 ? GLU A 115 ? GLY A 116 GLU A 117 AA3 2 ILE A 162 ? LEU A 164 ? ILE A 164 LEU A 166 AA3 3 ILE A 173 ? ILE A 175 ? ILE A 175 ILE A 177 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 38 ? N GLY A 40 O VAL A 45 ? O VAL A 47 AA1 2 3 N VAL A 44 ? N VAL A 46 O PHE A 61 ? O PHE A 63 AA1 3 4 N ALA A 58 ? N ALA A 60 O LEU A 108 ? O LEU A 110 AA1 4 5 O ILE A 107 ? O ILE A 109 N HIS A 95 ? N HIS A 97 AA2 1 2 N ARG A 66 ? N ARG A 68 O GLN A 69 ? O GLN A 71 AA3 1 2 N GLY A 114 ? N GLY A 116 O LEU A 164 ? O LEU A 166 AA3 2 3 N LEU A 163 ? N LEU A 165 O LYS A 174 ? O LYS A 176 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 87 ? ? -101.23 40.42 2 1 ASN A 102 ? ? -128.29 -156.27 3 1 ASP A 158 ? ? -156.25 45.06 4 1 LEU A 159 ? ? -87.00 49.32 5 1 ASP A 179 ? ? 63.28 89.42 6 1 ARG A 184 ? ? -127.03 -167.32 7 1 ILE A 195 ? ? -72.83 23.76 8 1 GLN A 294 ? ? -99.72 32.35 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x,z+1/4 3 y,-x,z+3/4 4 x,-y,-z+1/2 5 -x,y,-z 6 -x,-y,z+1/2 7 y,x,-z+3/4 8 -y,-x,-z+1/4 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 31.3373035335 80.8884609083 -0.600904199571 0.466091709751 ? -0.0112236849253 ? -0.0705716756694 ? 0.47010801046 ? -0.00510953584546 ? 0.526689815283 ? 4.03005840803 ? -0.170214896628 ? 0.0915067913245 ? 5.45768549952 ? 2.03945205114 ? 4.83576670174 ? -0.20575019213 ? 0.159825714833 ? -0.16242260457 ? 0.147416867666 ? 0.133818814327 ? 0.0569462777267 ? 0.256842408459 ? -0.227512102988 ? 9.43595863596e-05 ? 2 'X-RAY DIFFRACTION' ? refined 10.0197509482 92.5827849375 8.36144197316 0.535180070509 ? -0.0207272708711 ? -0.0105938817756 ? 0.999851383125 ? -0.12537611009 ? 0.910683760245 ? 0.242483767195 ? 0.284798176428 ? -0.194076970364 ? 0.455938819055 ? -0.0281957817457 ? 0.472960689051 ? -0.0952289554582 ? -0.206423079895 ? -0.518641372693 ? -0.2478203967 ? -0.136302940797 ? 1.63991865053 ? -0.158856004627 ? -1.05476428578 ? -0.00111880299993 ? 3 'X-RAY DIFFRACTION' ? refined 25.3632003926 100.039140086 4.75089966229 0.581955399333 ? 0.00455510942021 ? -0.00209572701208 ? 0.616964824107 ? -0.089107563599 ? 0.611778562856 ? 4.00305525428 ? -0.498341174265 ? 2.30052156226 ? 4.94153967244 ? 1.42065124554 ? 2.94436967246 ? 0.054343977434 ? 0.578376859916 ? -0.0372955505127 ? -0.375270988239 ? -0.0553519961641 ? -0.0982885133248 ? -0.190791725088 ? 0.463327056491 ? -0.00012415612869 ? 4 'X-RAY DIFFRACTION' ? refined 16.1166291349 109.938694484 7.41176775783 0.561106284697 ? 0.0914665113911 ? 0.0325235826261 ? 0.686252393763 ? -0.0111311533542 ? 0.618582751992 ? 4.44709426365 ? 0.68257735029 ? -1.84207919183 ? 3.46168370394 ? 1.22667864848 ? 2.19178611735 ? -0.0793333446892 ? 0.613238862885 ? 0.448818056626 ? -0.263115599978 ? 0.118416655005 ? -0.0948109653381 ? -0.515689620916 ? -0.308898648095 ? 5.16004037755e-05 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 18 through 111 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 112 through 131 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 132 through 213 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 214 through 301 ) ; # _pdbx_entry_details.entry_id 7Q7E _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 3 ? A MET 1 2 1 Y 1 A HIS 4 ? A HIS 2 3 1 Y 1 A HIS 5 ? A HIS 3 4 1 Y 1 A HIS 6 ? A HIS 4 5 1 Y 1 A HIS 7 ? A HIS 5 6 1 Y 1 A HIS 8 ? A HIS 6 7 1 Y 1 A HIS 9 ? A HIS 7 8 1 Y 1 A SER 10 ? A SER 8 9 1 Y 1 A SER 11 ? A SER 9 10 1 Y 1 A GLY 12 ? A GLY 10 11 1 Y 1 A VAL 13 ? A VAL 11 12 1 Y 1 A ASP 14 ? A ASP 12 13 1 Y 1 A LEU 15 ? A LEU 13 14 1 Y 1 A GLY 16 ? A GLY 14 15 1 Y 1 A THR 17 ? A THR 15 16 1 Y 1 A PHE 298 ? A PHE 296 17 1 Y 1 A GLU 299 ? A GLU 297 18 1 Y 1 A ASN 300 ? A ASN 298 19 1 Y 1 A LEU 301 ? A LEU 299 20 1 Y 1 A PHE 302 ? A PHE 300 21 1 Y 1 A HIS 303 ? A HIS 301 22 1 Y 1 A PRO 304 ? A PRO 302 23 1 Y 1 A GLU 305 ? A GLU 303 24 1 Y 1 A GLU 306 ? A GLU 304 25 1 Y 1 A THR 307 ? A THR 305 26 1 Y 1 A SER 308 ? A SER 306 27 1 Y 1 A SER 309 ? A SER 307 28 1 Y 1 A SER 310 ? A SER 308 29 1 Y 1 A SER 311 ? A SER 309 30 1 Y 1 A GLN 312 ? A GLN 310 31 1 Y 1 A THR 313 ? A THR 311 32 1 Y 1 A GLN 314 ? A GLN 312 33 1 Y 1 A ASP 315 ? A ASP 313 34 1 Y 1 A HIS 316 ? A HIS 314 35 1 Y 1 A SER 317 ? A SER 315 36 1 Y 1 A VAL 318 ? A VAL 316 37 1 Y 1 A ARG 319 ? A ARG 317 38 1 Y 1 A SER 320 ? A SER 318 39 1 Y 1 A SER 321 ? A SER 319 40 1 Y 1 A GLU 322 ? A GLU 320 41 1 Y 1 A ASP 323 ? A ASP 321 42 1 Y 1 A LYS 324 ? A LYS 322 43 1 Y 1 A THR 325 ? A THR 323 44 1 Y 1 A SER 326 ? A SER 324 45 1 Y 1 A LYS 327 ? A LYS 325 46 1 Y 1 A SER 328 ? A SER 326 47 1 Y 1 A SER 329 ? A SER 327 # _cell_measurement.pressure 101.325 _cell_measurement.entry_id 7Q7E _cell_measurement.pressure_esd ? _cell_measurement.radiation ? _cell_measurement.reflns_used ? _cell_measurement.temp ? _cell_measurement.temp_esd ? _cell_measurement.theta_max ? _cell_measurement.theta_min ? _cell_measurement.wavelength ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 ATP PG P N N 74 ATP O1G O N N 75 ATP O2G O N N 76 ATP O3G O N N 77 ATP PB P N R 78 ATP O1B O N N 79 ATP O2B O N N 80 ATP O3B O N N 81 ATP PA P N R 82 ATP O1A O N N 83 ATP O2A O N N 84 ATP O3A O N N 85 ATP "O5'" O N N 86 ATP "C5'" C N N 87 ATP "C4'" C N R 88 ATP "O4'" O N N 89 ATP "C3'" C N S 90 ATP "O3'" O N N 91 ATP "C2'" C N R 92 ATP "O2'" O N N 93 ATP "C1'" C N R 94 ATP N9 N Y N 95 ATP C8 C Y N 96 ATP N7 N Y N 97 ATP C5 C Y N 98 ATP C6 C Y N 99 ATP N6 N N N 100 ATP N1 N Y N 101 ATP C2 C Y N 102 ATP N3 N Y N 103 ATP C4 C Y N 104 ATP HOG2 H N N 105 ATP HOG3 H N N 106 ATP HOB2 H N N 107 ATP HOA2 H N N 108 ATP "H5'1" H N N 109 ATP "H5'2" H N N 110 ATP "H4'" H N N 111 ATP "H3'" H N N 112 ATP "HO3'" H N N 113 ATP "H2'" H N N 114 ATP "HO2'" H N N 115 ATP "H1'" H N N 116 ATP H8 H N N 117 ATP HN61 H N N 118 ATP HN62 H N N 119 ATP H2 H N N 120 CYS N N N N 121 CYS CA C N R 122 CYS C C N N 123 CYS O O N N 124 CYS CB C N N 125 CYS SG S N N 126 CYS OXT O N N 127 CYS H H N N 128 CYS H2 H N N 129 CYS HA H N N 130 CYS HB2 H N N 131 CYS HB3 H N N 132 CYS HG H N N 133 CYS HXT H N N 134 GLN N N N N 135 GLN CA C N S 136 GLN C C N N 137 GLN O O N N 138 GLN CB C N N 139 GLN CG C N N 140 GLN CD C N N 141 GLN OE1 O N N 142 GLN NE2 N N N 143 GLN OXT O N N 144 GLN H H N N 145 GLN H2 H N N 146 GLN HA H N N 147 GLN HB2 H N N 148 GLN HB3 H N N 149 GLN HG2 H N N 150 GLN HG3 H N N 151 GLN HE21 H N N 152 GLN HE22 H N N 153 GLN HXT H N N 154 GLU N N N N 155 GLU CA C N S 156 GLU C C N N 157 GLU O O N N 158 GLU CB C N N 159 GLU CG C N N 160 GLU CD C N N 161 GLU OE1 O N N 162 GLU OE2 O N N 163 GLU OXT O N N 164 GLU H H N N 165 GLU H2 H N N 166 GLU HA H N N 167 GLU HB2 H N N 168 GLU HB3 H N N 169 GLU HG2 H N N 170 GLU HG3 H N N 171 GLU HE2 H N N 172 GLU HXT H N N 173 GLY N N N N 174 GLY CA C N N 175 GLY C C N N 176 GLY O O N N 177 GLY OXT O N N 178 GLY H H N N 179 GLY H2 H N N 180 GLY HA2 H N N 181 GLY HA3 H N N 182 GLY HXT H N N 183 HIS N N N N 184 HIS CA C N S 185 HIS C C N N 186 HIS O O N N 187 HIS CB C N N 188 HIS CG C Y N 189 HIS ND1 N Y N 190 HIS CD2 C Y N 191 HIS CE1 C Y N 192 HIS NE2 N Y N 193 HIS OXT O N N 194 HIS H H N N 195 HIS H2 H N N 196 HIS HA H N N 197 HIS HB2 H N N 198 HIS HB3 H N N 199 HIS HD1 H N N 200 HIS HD2 H N N 201 HIS HE1 H N N 202 HIS HE2 H N N 203 HIS HXT H N N 204 HOH O O N N 205 HOH H1 H N N 206 HOH H2 H N N 207 ILE N N N N 208 ILE CA C N S 209 ILE C C N N 210 ILE O O N N 211 ILE CB C N S 212 ILE CG1 C N N 213 ILE CG2 C N N 214 ILE CD1 C N N 215 ILE OXT O N N 216 ILE H H N N 217 ILE H2 H N N 218 ILE HA H N N 219 ILE HB H N N 220 ILE HG12 H N N 221 ILE HG13 H N N 222 ILE HG21 H N N 223 ILE HG22 H N N 224 ILE HG23 H N N 225 ILE HD11 H N N 226 ILE HD12 H N N 227 ILE HD13 H N N 228 ILE HXT H N N 229 LEU N N N N 230 LEU CA C N S 231 LEU C C N N 232 LEU O O N N 233 LEU CB C N N 234 LEU CG C N N 235 LEU CD1 C N N 236 LEU CD2 C N N 237 LEU OXT O N N 238 LEU H H N N 239 LEU H2 H N N 240 LEU HA H N N 241 LEU HB2 H N N 242 LEU HB3 H N N 243 LEU HG H N N 244 LEU HD11 H N N 245 LEU HD12 H N N 246 LEU HD13 H N N 247 LEU HD21 H N N 248 LEU HD22 H N N 249 LEU HD23 H N N 250 LEU HXT H N N 251 LYS N N N N 252 LYS CA C N S 253 LYS C C N N 254 LYS O O N N 255 LYS CB C N N 256 LYS CG C N N 257 LYS CD C N N 258 LYS CE C N N 259 LYS NZ N N N 260 LYS OXT O N N 261 LYS H H N N 262 LYS H2 H N N 263 LYS HA H N N 264 LYS HB2 H N N 265 LYS HB3 H N N 266 LYS HG2 H N N 267 LYS HG3 H N N 268 LYS HD2 H N N 269 LYS HD3 H N N 270 LYS HE2 H N N 271 LYS HE3 H N N 272 LYS HZ1 H N N 273 LYS HZ2 H N N 274 LYS HZ3 H N N 275 LYS HXT H N N 276 MET N N N N 277 MET CA C N S 278 MET C C N N 279 MET O O N N 280 MET CB C N N 281 MET CG C N N 282 MET SD S N N 283 MET CE C N N 284 MET OXT O N N 285 MET H H N N 286 MET H2 H N N 287 MET HA H N N 288 MET HB2 H N N 289 MET HB3 H N N 290 MET HG2 H N N 291 MET HG3 H N N 292 MET HE1 H N N 293 MET HE2 H N N 294 MET HE3 H N N 295 MET HXT H N N 296 MG MG MG N N 297 PHE N N N N 298 PHE CA C N S 299 PHE C C N N 300 PHE O O N N 301 PHE CB C N N 302 PHE CG C Y N 303 PHE CD1 C Y N 304 PHE CD2 C Y N 305 PHE CE1 C Y N 306 PHE CE2 C Y N 307 PHE CZ C Y N 308 PHE OXT O N N 309 PHE H H N N 310 PHE H2 H N N 311 PHE HA H N N 312 PHE HB2 H N N 313 PHE HB3 H N N 314 PHE HD1 H N N 315 PHE HD2 H N N 316 PHE HE1 H N N 317 PHE HE2 H N N 318 PHE HZ H N N 319 PHE HXT H N N 320 PRO N N N N 321 PRO CA C N S 322 PRO C C N N 323 PRO O O N N 324 PRO CB C N N 325 PRO CG C N N 326 PRO CD C N N 327 PRO OXT O N N 328 PRO H H N N 329 PRO HA H N N 330 PRO HB2 H N N 331 PRO HB3 H N N 332 PRO HG2 H N N 333 PRO HG3 H N N 334 PRO HD2 H N N 335 PRO HD3 H N N 336 PRO HXT H N N 337 SER N N N N 338 SER CA C N S 339 SER C C N N 340 SER O O N N 341 SER CB C N N 342 SER OG O N N 343 SER OXT O N N 344 SER H H N N 345 SER H2 H N N 346 SER HA H N N 347 SER HB2 H N N 348 SER HB3 H N N 349 SER HG H N N 350 SER HXT H N N 351 THR N N N N 352 THR CA C N S 353 THR C C N N 354 THR O O N N 355 THR CB C N R 356 THR OG1 O N N 357 THR CG2 C N N 358 THR OXT O N N 359 THR H H N N 360 THR H2 H N N 361 THR HA H N N 362 THR HB H N N 363 THR HG1 H N N 364 THR HG21 H N N 365 THR HG22 H N N 366 THR HG23 H N N 367 THR HXT H N N 368 TRP N N N N 369 TRP CA C N S 370 TRP C C N N 371 TRP O O N N 372 TRP CB C N N 373 TRP CG C Y N 374 TRP CD1 C Y N 375 TRP CD2 C Y N 376 TRP NE1 N Y N 377 TRP CE2 C Y N 378 TRP CE3 C Y N 379 TRP CZ2 C Y N 380 TRP CZ3 C Y N 381 TRP CH2 C Y N 382 TRP OXT O N N 383 TRP H H N N 384 TRP H2 H N N 385 TRP HA H N N 386 TRP HB2 H N N 387 TRP HB3 H N N 388 TRP HD1 H N N 389 TRP HE1 H N N 390 TRP HE3 H N N 391 TRP HZ2 H N N 392 TRP HZ3 H N N 393 TRP HH2 H N N 394 TRP HXT H N N 395 TYR N N N N 396 TYR CA C N S 397 TYR C C N N 398 TYR O O N N 399 TYR CB C N N 400 TYR CG C Y N 401 TYR CD1 C Y N 402 TYR CD2 C Y N 403 TYR CE1 C Y N 404 TYR CE2 C Y N 405 TYR CZ C Y N 406 TYR OH O N N 407 TYR OXT O N N 408 TYR H H N N 409 TYR H2 H N N 410 TYR HA H N N 411 TYR HB2 H N N 412 TYR HB3 H N N 413 TYR HD1 H N N 414 TYR HD2 H N N 415 TYR HE1 H N N 416 TYR HE2 H N N 417 TYR HH H N N 418 TYR HXT H N N 419 VAL N N N N 420 VAL CA C N S 421 VAL C C N N 422 VAL O O N N 423 VAL CB C N N 424 VAL CG1 C N N 425 VAL CG2 C N N 426 VAL OXT O N N 427 VAL H H N N 428 VAL H2 H N N 429 VAL HA H N N 430 VAL HB H N N 431 VAL HG11 H N N 432 VAL HG12 H N N 433 VAL HG13 H N N 434 VAL HG21 H N N 435 VAL HG22 H N N 436 VAL HG23 H N N 437 VAL HXT H N N 438 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 ATP PG O1G doub N N 70 ATP PG O2G sing N N 71 ATP PG O3G sing N N 72 ATP PG O3B sing N N 73 ATP O2G HOG2 sing N N 74 ATP O3G HOG3 sing N N 75 ATP PB O1B doub N N 76 ATP PB O2B sing N N 77 ATP PB O3B sing N N 78 ATP PB O3A sing N N 79 ATP O2B HOB2 sing N N 80 ATP PA O1A doub N N 81 ATP PA O2A sing N N 82 ATP PA O3A sing N N 83 ATP PA "O5'" sing N N 84 ATP O2A HOA2 sing N N 85 ATP "O5'" "C5'" sing N N 86 ATP "C5'" "C4'" sing N N 87 ATP "C5'" "H5'1" sing N N 88 ATP "C5'" "H5'2" sing N N 89 ATP "C4'" "O4'" sing N N 90 ATP "C4'" "C3'" sing N N 91 ATP "C4'" "H4'" sing N N 92 ATP "O4'" "C1'" sing N N 93 ATP "C3'" "O3'" sing N N 94 ATP "C3'" "C2'" sing N N 95 ATP "C3'" "H3'" sing N N 96 ATP "O3'" "HO3'" sing N N 97 ATP "C2'" "O2'" sing N N 98 ATP "C2'" "C1'" sing N N 99 ATP "C2'" "H2'" sing N N 100 ATP "O2'" "HO2'" sing N N 101 ATP "C1'" N9 sing N N 102 ATP "C1'" "H1'" sing N N 103 ATP N9 C8 sing Y N 104 ATP N9 C4 sing Y N 105 ATP C8 N7 doub Y N 106 ATP C8 H8 sing N N 107 ATP N7 C5 sing Y N 108 ATP C5 C6 sing Y N 109 ATP C5 C4 doub Y N 110 ATP C6 N6 sing N N 111 ATP C6 N1 doub Y N 112 ATP N6 HN61 sing N N 113 ATP N6 HN62 sing N N 114 ATP N1 C2 sing Y N 115 ATP C2 N3 doub Y N 116 ATP C2 H2 sing N N 117 ATP N3 C4 sing Y N 118 CYS N CA sing N N 119 CYS N H sing N N 120 CYS N H2 sing N N 121 CYS CA C sing N N 122 CYS CA CB sing N N 123 CYS CA HA sing N N 124 CYS C O doub N N 125 CYS C OXT sing N N 126 CYS CB SG sing N N 127 CYS CB HB2 sing N N 128 CYS CB HB3 sing N N 129 CYS SG HG sing N N 130 CYS OXT HXT sing N N 131 GLN N CA sing N N 132 GLN N H sing N N 133 GLN N H2 sing N N 134 GLN CA C sing N N 135 GLN CA CB sing N N 136 GLN CA HA sing N N 137 GLN C O doub N N 138 GLN C OXT sing N N 139 GLN CB CG sing N N 140 GLN CB HB2 sing N N 141 GLN CB HB3 sing N N 142 GLN CG CD sing N N 143 GLN CG HG2 sing N N 144 GLN CG HG3 sing N N 145 GLN CD OE1 doub N N 146 GLN CD NE2 sing N N 147 GLN NE2 HE21 sing N N 148 GLN NE2 HE22 sing N N 149 GLN OXT HXT sing N N 150 GLU N CA sing N N 151 GLU N H sing N N 152 GLU N H2 sing N N 153 GLU CA C sing N N 154 GLU CA CB sing N N 155 GLU CA HA sing N N 156 GLU C O doub N N 157 GLU C OXT sing N N 158 GLU CB CG sing N N 159 GLU CB HB2 sing N N 160 GLU CB HB3 sing N N 161 GLU CG CD sing N N 162 GLU CG HG2 sing N N 163 GLU CG HG3 sing N N 164 GLU CD OE1 doub N N 165 GLU CD OE2 sing N N 166 GLU OE2 HE2 sing N N 167 GLU OXT HXT sing N N 168 GLY N CA sing N N 169 GLY N H sing N N 170 GLY N H2 sing N N 171 GLY CA C sing N N 172 GLY CA HA2 sing N N 173 GLY CA HA3 sing N N 174 GLY C O doub N N 175 GLY C OXT sing N N 176 GLY OXT HXT sing N N 177 HIS N CA sing N N 178 HIS N H sing N N 179 HIS N H2 sing N N 180 HIS CA C sing N N 181 HIS CA CB sing N N 182 HIS CA HA sing N N 183 HIS C O doub N N 184 HIS C OXT sing N N 185 HIS CB CG sing N N 186 HIS CB HB2 sing N N 187 HIS CB HB3 sing N N 188 HIS CG ND1 sing Y N 189 HIS CG CD2 doub Y N 190 HIS ND1 CE1 doub Y N 191 HIS ND1 HD1 sing N N 192 HIS CD2 NE2 sing Y N 193 HIS CD2 HD2 sing N N 194 HIS CE1 NE2 sing Y N 195 HIS CE1 HE1 sing N N 196 HIS NE2 HE2 sing N N 197 HIS OXT HXT sing N N 198 HOH O H1 sing N N 199 HOH O H2 sing N N 200 ILE N CA sing N N 201 ILE N H sing N N 202 ILE N H2 sing N N 203 ILE CA C sing N N 204 ILE CA CB sing N N 205 ILE CA HA sing N N 206 ILE C O doub N N 207 ILE C OXT sing N N 208 ILE CB CG1 sing N N 209 ILE CB CG2 sing N N 210 ILE CB HB sing N N 211 ILE CG1 CD1 sing N N 212 ILE CG1 HG12 sing N N 213 ILE CG1 HG13 sing N N 214 ILE CG2 HG21 sing N N 215 ILE CG2 HG22 sing N N 216 ILE CG2 HG23 sing N N 217 ILE CD1 HD11 sing N N 218 ILE CD1 HD12 sing N N 219 ILE CD1 HD13 sing N N 220 ILE OXT HXT sing N N 221 LEU N CA sing N N 222 LEU N H sing N N 223 LEU N H2 sing N N 224 LEU CA C sing N N 225 LEU CA CB sing N N 226 LEU CA HA sing N N 227 LEU C O doub N N 228 LEU C OXT sing N N 229 LEU CB CG sing N N 230 LEU CB HB2 sing N N 231 LEU CB HB3 sing N N 232 LEU CG CD1 sing N N 233 LEU CG CD2 sing N N 234 LEU CG HG sing N N 235 LEU CD1 HD11 sing N N 236 LEU CD1 HD12 sing N N 237 LEU CD1 HD13 sing N N 238 LEU CD2 HD21 sing N N 239 LEU CD2 HD22 sing N N 240 LEU CD2 HD23 sing N N 241 LEU OXT HXT sing N N 242 LYS N CA sing N N 243 LYS N H sing N N 244 LYS N H2 sing N N 245 LYS CA C sing N N 246 LYS CA CB sing N N 247 LYS CA HA sing N N 248 LYS C O doub N N 249 LYS C OXT sing N N 250 LYS CB CG sing N N 251 LYS CB HB2 sing N N 252 LYS CB HB3 sing N N 253 LYS CG CD sing N N 254 LYS CG HG2 sing N N 255 LYS CG HG3 sing N N 256 LYS CD CE sing N N 257 LYS CD HD2 sing N N 258 LYS CD HD3 sing N N 259 LYS CE NZ sing N N 260 LYS CE HE2 sing N N 261 LYS CE HE3 sing N N 262 LYS NZ HZ1 sing N N 263 LYS NZ HZ2 sing N N 264 LYS NZ HZ3 sing N N 265 LYS OXT HXT sing N N 266 MET N CA sing N N 267 MET N H sing N N 268 MET N H2 sing N N 269 MET CA C sing N N 270 MET CA CB sing N N 271 MET CA HA sing N N 272 MET C O doub N N 273 MET C OXT sing N N 274 MET CB CG sing N N 275 MET CB HB2 sing N N 276 MET CB HB3 sing N N 277 MET CG SD sing N N 278 MET CG HG2 sing N N 279 MET CG HG3 sing N N 280 MET SD CE sing N N 281 MET CE HE1 sing N N 282 MET CE HE2 sing N N 283 MET CE HE3 sing N N 284 MET OXT HXT sing N N 285 PHE N CA sing N N 286 PHE N H sing N N 287 PHE N H2 sing N N 288 PHE CA C sing N N 289 PHE CA CB sing N N 290 PHE CA HA sing N N 291 PHE C O doub N N 292 PHE C OXT sing N N 293 PHE CB CG sing N N 294 PHE CB HB2 sing N N 295 PHE CB HB3 sing N N 296 PHE CG CD1 doub Y N 297 PHE CG CD2 sing Y N 298 PHE CD1 CE1 sing Y N 299 PHE CD1 HD1 sing N N 300 PHE CD2 CE2 doub Y N 301 PHE CD2 HD2 sing N N 302 PHE CE1 CZ doub Y N 303 PHE CE1 HE1 sing N N 304 PHE CE2 CZ sing Y N 305 PHE CE2 HE2 sing N N 306 PHE CZ HZ sing N N 307 PHE OXT HXT sing N N 308 PRO N CA sing N N 309 PRO N CD sing N N 310 PRO N H sing N N 311 PRO CA C sing N N 312 PRO CA CB sing N N 313 PRO CA HA sing N N 314 PRO C O doub N N 315 PRO C OXT sing N N 316 PRO CB CG sing N N 317 PRO CB HB2 sing N N 318 PRO CB HB3 sing N N 319 PRO CG CD sing N N 320 PRO CG HG2 sing N N 321 PRO CG HG3 sing N N 322 PRO CD HD2 sing N N 323 PRO CD HD3 sing N N 324 PRO OXT HXT sing N N 325 SER N CA sing N N 326 SER N H sing N N 327 SER N H2 sing N N 328 SER CA C sing N N 329 SER CA CB sing N N 330 SER CA HA sing N N 331 SER C O doub N N 332 SER C OXT sing N N 333 SER CB OG sing N N 334 SER CB HB2 sing N N 335 SER CB HB3 sing N N 336 SER OG HG sing N N 337 SER OXT HXT sing N N 338 THR N CA sing N N 339 THR N H sing N N 340 THR N H2 sing N N 341 THR CA C sing N N 342 THR CA CB sing N N 343 THR CA HA sing N N 344 THR C O doub N N 345 THR C OXT sing N N 346 THR CB OG1 sing N N 347 THR CB CG2 sing N N 348 THR CB HB sing N N 349 THR OG1 HG1 sing N N 350 THR CG2 HG21 sing N N 351 THR CG2 HG22 sing N N 352 THR CG2 HG23 sing N N 353 THR OXT HXT sing N N 354 TRP N CA sing N N 355 TRP N H sing N N 356 TRP N H2 sing N N 357 TRP CA C sing N N 358 TRP CA CB sing N N 359 TRP CA HA sing N N 360 TRP C O doub N N 361 TRP C OXT sing N N 362 TRP CB CG sing N N 363 TRP CB HB2 sing N N 364 TRP CB HB3 sing N N 365 TRP CG CD1 doub Y N 366 TRP CG CD2 sing Y N 367 TRP CD1 NE1 sing Y N 368 TRP CD1 HD1 sing N N 369 TRP CD2 CE2 doub Y N 370 TRP CD2 CE3 sing Y N 371 TRP NE1 CE2 sing Y N 372 TRP NE1 HE1 sing N N 373 TRP CE2 CZ2 sing Y N 374 TRP CE3 CZ3 doub Y N 375 TRP CE3 HE3 sing N N 376 TRP CZ2 CH2 doub Y N 377 TRP CZ2 HZ2 sing N N 378 TRP CZ3 CH2 sing Y N 379 TRP CZ3 HZ3 sing N N 380 TRP CH2 HH2 sing N N 381 TRP OXT HXT sing N N 382 TYR N CA sing N N 383 TYR N H sing N N 384 TYR N H2 sing N N 385 TYR CA C sing N N 386 TYR CA CB sing N N 387 TYR CA HA sing N N 388 TYR C O doub N N 389 TYR C OXT sing N N 390 TYR CB CG sing N N 391 TYR CB HB2 sing N N 392 TYR CB HB3 sing N N 393 TYR CG CD1 doub Y N 394 TYR CG CD2 sing Y N 395 TYR CD1 CE1 sing Y N 396 TYR CD1 HD1 sing N N 397 TYR CD2 CE2 doub Y N 398 TYR CD2 HD2 sing N N 399 TYR CE1 CZ doub Y N 400 TYR CE1 HE1 sing N N 401 TYR CE2 CZ sing Y N 402 TYR CE2 HE2 sing N N 403 TYR CZ OH sing N N 404 TYR OH HH sing N N 405 TYR OXT HXT sing N N 406 VAL N CA sing N N 407 VAL N H sing N N 408 VAL N H2 sing N N 409 VAL CA C sing N N 410 VAL CA CB sing N N 411 VAL CA HA sing N N 412 VAL C O doub N N 413 VAL C OXT sing N N 414 VAL CB CG1 sing N N 415 VAL CB CG2 sing N N 416 VAL CB HB sing N N 417 VAL CG1 HG11 sing N N 418 VAL CG1 HG12 sing N N 419 VAL CG1 HG13 sing N N 420 VAL CG2 HG21 sing N N 421 VAL CG2 HG22 sing N N 422 VAL CG2 HG23 sing N N 423 VAL OXT HXT sing N N 424 # _diffrn_measurement.specimen_support 'sapphire capillary' _diffrn_measurement.diffrn_id 1 _diffrn_measurement.details ? _diffrn_measurement.device ? _diffrn_measurement.device_details ? _diffrn_measurement.device_type ? _diffrn_measurement.method ? # _pdbx_audit_support.funding_organization 'German Federal Ministry for Education and Research' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 031B0405A _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 ATP ? ? ATP ? ? 'SUBJECT OF INVESTIGATION' ? 2 MG ? ? MG ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6QF4 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7Q7E _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011871 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011871 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008528 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 24.73122 6.32584 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 2.59044 63.03566 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? 9.05267 ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 1.42069 35.72801 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_