data_7Q88 # _entry.id 7Q88 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7Q88 pdb_00007q88 10.2210/pdb7q88/pdb WWPDB D_1292118019 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-05-24 2 'Structure model' 1 1 2023-10-18 3 'Structure model' 1 2 2024-02-14 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Obsolete ? ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Data collection' 3 2 'Structure model' Other 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_database_PDB_obs_spr 4 2 'Structure model' pdbx_database_status 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_database_status.status_code' 2 2 'Structure model' '_pdbx_database_status.status_code_sf' # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2023-10-18 _pdbx_database_PDB_obs_spr.pdb_id 8QQO _pdbx_database_PDB_obs_spr.replace_pdb_id 7Q88 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7Q88 _pdbx_database_status.recvd_initial_deposition_date 2021-11-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'Dark structure Sensory Rhodopsin II' _pdbx_database_related.db_id 7PNC _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email richard.neutze@gu.se _pdbx_contact_author.name_first Richard _pdbx_contact_author.name_last Neutze _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0986-6153 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bosman, R.' 1 0000-0002-9939-602X 'Ortolani, G.' 2 0000-0001-6373-9919 'Branden, G.' 3 0000-0001-5615-7187 'Neutze, R.' 4 0000-0003-0986-6153 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural basis of the prolonged photocycle of Sensory Rhodopsin II revealed by serial millisecond crystallography' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bosman, R.' 1 0000-0002-9939-602X primary 'Ortolani, G.' 2 0000-0001-6373-9919 primary 'Branden, G.' 3 0000-0001-5615-7187 primary 'Neutze, R.' 4 0000-0003-0986-6153 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Sensory rhodopsin-2' 26666.137 1 ? ? ? ? 2 non-polymer syn RETINAL 284.436 1 ? ? ? ? 3 water nat water 18.015 38 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Sensory rhodopsin II,SR-II' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVGLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYVVMALGVGWVPVAERTVFAPRYIDWILTT PLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPGIERYALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKSLY VRLRNLTVILWAIYPFIWLLGPPGVALLTPTVDVALIVYLDLVTKVGFGFIALDAAATLRAEHGESLAGVDTDAPAVADE NSHHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MVGLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYVVMALGVGWVPVAERTVFAPRYIDWILTT PLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPGIERYALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKSLY VRLRNLTVILWAIYPFIWLLGPPGVALLTPTVDVALIVYLDLVTKVGFGFIALDAAATLRAEHGESLAGVDTDAPAVADE NSHHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 RETINAL RET 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 GLY n 1 4 LEU n 1 5 THR n 1 6 THR n 1 7 LEU n 1 8 PHE n 1 9 TRP n 1 10 LEU n 1 11 GLY n 1 12 ALA n 1 13 ILE n 1 14 GLY n 1 15 MET n 1 16 LEU n 1 17 VAL n 1 18 GLY n 1 19 THR n 1 20 LEU n 1 21 ALA n 1 22 PHE n 1 23 ALA n 1 24 TRP n 1 25 ALA n 1 26 GLY n 1 27 ARG n 1 28 ASP n 1 29 ALA n 1 30 GLY n 1 31 SER n 1 32 GLY n 1 33 GLU n 1 34 ARG n 1 35 ARG n 1 36 TYR n 1 37 TYR n 1 38 VAL n 1 39 THR n 1 40 LEU n 1 41 VAL n 1 42 GLY n 1 43 ILE n 1 44 SER n 1 45 GLY n 1 46 ILE n 1 47 ALA n 1 48 ALA n 1 49 VAL n 1 50 ALA n 1 51 TYR n 1 52 VAL n 1 53 VAL n 1 54 MET n 1 55 ALA n 1 56 LEU n 1 57 GLY n 1 58 VAL n 1 59 GLY n 1 60 TRP n 1 61 VAL n 1 62 PRO n 1 63 VAL n 1 64 ALA n 1 65 GLU n 1 66 ARG n 1 67 THR n 1 68 VAL n 1 69 PHE n 1 70 ALA n 1 71 PRO n 1 72 ARG n 1 73 TYR n 1 74 ILE n 1 75 ASP n 1 76 TRP n 1 77 ILE n 1 78 LEU n 1 79 THR n 1 80 THR n 1 81 PRO n 1 82 LEU n 1 83 ILE n 1 84 VAL n 1 85 TYR n 1 86 PHE n 1 87 LEU n 1 88 GLY n 1 89 LEU n 1 90 LEU n 1 91 ALA n 1 92 GLY n 1 93 LEU n 1 94 ASP n 1 95 SER n 1 96 ARG n 1 97 GLU n 1 98 PHE n 1 99 GLY n 1 100 ILE n 1 101 VAL n 1 102 ILE n 1 103 THR n 1 104 LEU n 1 105 ASN n 1 106 THR n 1 107 VAL n 1 108 VAL n 1 109 MET n 1 110 LEU n 1 111 ALA n 1 112 GLY n 1 113 PHE n 1 114 ALA n 1 115 GLY n 1 116 ALA n 1 117 MET n 1 118 VAL n 1 119 PRO n 1 120 GLY n 1 121 ILE n 1 122 GLU n 1 123 ARG n 1 124 TYR n 1 125 ALA n 1 126 LEU n 1 127 PHE n 1 128 GLY n 1 129 MET n 1 130 GLY n 1 131 ALA n 1 132 VAL n 1 133 ALA n 1 134 PHE n 1 135 LEU n 1 136 GLY n 1 137 LEU n 1 138 VAL n 1 139 TYR n 1 140 TYR n 1 141 LEU n 1 142 VAL n 1 143 GLY n 1 144 PRO n 1 145 MET n 1 146 THR n 1 147 GLU n 1 148 SER n 1 149 ALA n 1 150 SER n 1 151 GLN n 1 152 ARG n 1 153 SER n 1 154 SER n 1 155 GLY n 1 156 ILE n 1 157 LYS n 1 158 SER n 1 159 LEU n 1 160 TYR n 1 161 VAL n 1 162 ARG n 1 163 LEU n 1 164 ARG n 1 165 ASN n 1 166 LEU n 1 167 THR n 1 168 VAL n 1 169 ILE n 1 170 LEU n 1 171 TRP n 1 172 ALA n 1 173 ILE n 1 174 TYR n 1 175 PRO n 1 176 PHE n 1 177 ILE n 1 178 TRP n 1 179 LEU n 1 180 LEU n 1 181 GLY n 1 182 PRO n 1 183 PRO n 1 184 GLY n 1 185 VAL n 1 186 ALA n 1 187 LEU n 1 188 LEU n 1 189 THR n 1 190 PRO n 1 191 THR n 1 192 VAL n 1 193 ASP n 1 194 VAL n 1 195 ALA n 1 196 LEU n 1 197 ILE n 1 198 VAL n 1 199 TYR n 1 200 LEU n 1 201 ASP n 1 202 LEU n 1 203 VAL n 1 204 THR n 1 205 LYS n 1 206 VAL n 1 207 GLY n 1 208 PHE n 1 209 GLY n 1 210 PHE n 1 211 ILE n 1 212 ALA n 1 213 LEU n 1 214 ASP n 1 215 ALA n 1 216 ALA n 1 217 ALA n 1 218 THR n 1 219 LEU n 1 220 ARG n 1 221 ALA n 1 222 GLU n 1 223 HIS n 1 224 GLY n 1 225 GLU n 1 226 SER n 1 227 LEU n 1 228 ALA n 1 229 GLY n 1 230 VAL n 1 231 ASP n 1 232 THR n 1 233 ASP n 1 234 ALA n 1 235 PRO n 1 236 ALA n 1 237 VAL n 1 238 ALA n 1 239 ASP n 1 240 GLU n 1 241 ASN n 1 242 SER n 1 243 HIS n 1 244 HIS n 1 245 HIS n 1 246 HIS n 1 247 HIS n 1 248 HIS n 1 249 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 249 _entity_src_gen.gene_src_common_name 'Natronobacterium pharaonis' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'sop2, sopII' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Natronomonas pharaonis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2257 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RET non-polymer . RETINAL ? 'C20 H28 O' 284.436 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 TRP 60 60 60 TRP TRP A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 MET 117 117 117 MET MET A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 MET 129 129 129 MET MET A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 MET 145 145 145 MET MET A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 TYR 160 160 160 TYR TYR A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 THR 167 167 167 THR THR A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 TRP 171 171 171 TRP TRP A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 TYR 174 174 174 TYR TYR A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 ILE 177 177 177 ILE ILE A . n A 1 178 TRP 178 178 178 TRP TRP A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 THR 189 189 189 THR THR A . n A 1 190 PRO 190 190 190 PRO PRO A . n A 1 191 THR 191 191 191 THR THR A . n A 1 192 VAL 192 192 192 VAL VAL A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 VAL 194 194 194 VAL VAL A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 TYR 199 199 199 TYR TYR A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 ASP 201 201 201 ASP ASP A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 LYS 205 205 205 LYS LYS A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 GLY 207 207 207 GLY GLY A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 PHE 210 210 210 PHE PHE A . n A 1 211 ILE 211 211 211 ILE ILE A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 ASP 214 214 214 ASP ASP A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 ALA 217 217 217 ALA ALA A . n A 1 218 THR 218 218 218 THR THR A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 ARG 220 220 ? ? ? A . n A 1 221 ALA 221 221 ? ? ? A . n A 1 222 GLU 222 222 ? ? ? A . n A 1 223 HIS 223 223 ? ? ? A . n A 1 224 GLY 224 224 ? ? ? A . n A 1 225 GLU 225 225 ? ? ? A . n A 1 226 SER 226 226 ? ? ? A . n A 1 227 LEU 227 227 ? ? ? A . n A 1 228 ALA 228 228 ? ? ? A . n A 1 229 GLY 229 229 ? ? ? A . n A 1 230 VAL 230 230 ? ? ? A . n A 1 231 ASP 231 231 ? ? ? A . n A 1 232 THR 232 232 ? ? ? A . n A 1 233 ASP 233 233 ? ? ? A . n A 1 234 ALA 234 234 ? ? ? A . n A 1 235 PRO 235 235 ? ? ? A . n A 1 236 ALA 236 236 ? ? ? A . n A 1 237 VAL 237 237 ? ? ? A . n A 1 238 ALA 238 238 ? ? ? A . n A 1 239 ASP 239 239 ? ? ? A . n A 1 240 GLU 240 240 ? ? ? A . n A 1 241 ASN 241 241 ? ? ? A . n A 1 242 SER 242 242 ? ? ? A . n A 1 243 HIS 243 243 ? ? ? A . n A 1 244 HIS 244 244 ? ? ? A . n A 1 245 HIS 245 245 ? ? ? A . n A 1 246 HIS 246 246 ? ? ? A . n A 1 247 HIS 247 247 ? ? ? A . n A 1 248 HIS 248 248 ? ? ? A . n A 1 249 HIS 249 249 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 RET 1 300 300 RET RET A . C 3 HOH 1 401 32 HOH HOH A . C 3 HOH 2 402 17 HOH HOH A . C 3 HOH 3 403 3 HOH HOH A . C 3 HOH 4 404 5 HOH HOH A . C 3 HOH 5 405 46 HOH HOH A . C 3 HOH 6 406 48 HOH HOH A . C 3 HOH 7 407 2 HOH HOH A . C 3 HOH 8 408 7 HOH HOH A . C 3 HOH 9 409 15 HOH HOH A . C 3 HOH 10 410 36 HOH HOH A . C 3 HOH 11 411 19 HOH HOH A . C 3 HOH 12 412 1 HOH HOH A . C 3 HOH 13 413 4 HOH HOH A . C 3 HOH 14 414 6 HOH HOH A . C 3 HOH 15 415 34 HOH HOH A . C 3 HOH 16 416 8 HOH HOH A . C 3 HOH 17 417 10 HOH HOH A . C 3 HOH 18 418 25 HOH HOH A . C 3 HOH 19 419 29 HOH HOH A . C 3 HOH 20 420 14 HOH HOH A . C 3 HOH 21 421 39 HOH HOH A . C 3 HOH 22 422 9 HOH HOH A . C 3 HOH 23 423 43 HOH HOH A . C 3 HOH 24 424 18 HOH HOH A . C 3 HOH 25 425 35 HOH HOH A . C 3 HOH 26 426 26 HOH HOH A . C 3 HOH 27 427 11 HOH HOH A . C 3 HOH 28 428 40 HOH HOH A . C 3 HOH 29 429 33 HOH HOH A . C 3 HOH 30 430 38 HOH HOH A . C 3 HOH 31 431 44 HOH HOH A . C 3 HOH 32 432 27 HOH HOH A . C 3 HOH 33 433 37 HOH HOH A . C 3 HOH 34 434 12 HOH HOH A . C 3 HOH 35 435 49 HOH HOH A . C 3 HOH 36 436 45 HOH HOH A . C 3 HOH 37 437 41 HOH HOH A . C 3 HOH 38 438 42 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 31 ? OG ? A SER 31 OG 2 1 Y 1 A GLU 33 ? CG ? A GLU 33 CG 3 1 Y 1 A GLU 33 ? CD ? A GLU 33 CD 4 1 Y 1 A GLU 33 ? OE1 ? A GLU 33 OE1 5 1 Y 1 A GLU 33 ? OE2 ? A GLU 33 OE2 6 1 Y 1 A GLU 97 ? CG ? A GLU 97 CG 7 1 Y 1 A GLU 97 ? CD ? A GLU 97 CD 8 1 Y 1 A GLU 97 ? OE1 ? A GLU 97 OE1 9 1 Y 1 A GLU 97 ? OE2 ? A GLU 97 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7Q88 _cell.details ? _cell.formula_units_Z ? _cell.length_a 89.750 _cell.length_a_esd ? _cell.length_b 131.700 _cell.length_b_esd ? _cell.length_c 51.000 _cell.length_c_esd ? _cell.volume 602823.825 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7Q88 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7Q88 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.80 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.04 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'LIPIDIC CUBIC PHASE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 296.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'CaCl 150mM, Glycine 100mM, 38%(v/v) PEG 400, pH 7.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment Y # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-05-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000342 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000342 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 45.51 _reflns.entry_id 7Q88 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.4 _reflns.d_resolution_low 40 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11240 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 256.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.32 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.994 _reflns.pdbx_CC_star 0.998 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.4 _reflns_shell.d_res_low 40 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 11240 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.994 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 56.87 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7Q88 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.40 _refine.ls_d_res_low 44.88 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12198 _refine.ls_number_reflns_R_free 597 _refine.ls_number_reflns_R_work 11601 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.92 _refine.ls_percent_reflns_R_free 4.89 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2115 _refine.ls_R_factor_R_free 0.2499 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2094 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1H68 _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.5602 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3106 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 44.88 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 1703 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1645 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0121 ? 3414 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.4593 ? 4676 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0625 ? 564 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0093 ? 562 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.0277 ? 490 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.40 2.64 . . 140 2854 99.90 . . . 0.3573 . 0.2815 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.64 3.02 . . 141 2862 99.93 . . . 0.2784 . 0.2258 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.02 3.81 . . 143 2893 99.93 . . . 0.2502 . 0.2062 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.81 44.88 . . 173 2992 99.94 . . . 0.2255 . 0.1929 . . . . . . . . . . . # _struct.entry_id 7Q88 _struct.title 'Light structure of sensory rhodopsin-II solved by serial millisecond crystallography' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7Q88 _struct_keywords.text ;SRII, serial millisecond crystallography, sensory rhodopsin, sensory rhodopsin II, SMX, SSX, Time-resolved crystallography, TRX, SIGNALING PROTEIN ; _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BACS2_NATPH _struct_ref.pdbx_db_accession P42196 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVGLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYVVMALGVGWVPVAERTVFAPRYIDWILTT PLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPGIERYALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKSLY VRLRNLTVILWAIYPFIWLLGPPGVALLTPTVDVALIVYLDLVTKVGFGFIALDAAATLRAEHGESLAGVDTDAPAVAD ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7Q88 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 239 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P42196 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 239 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 239 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7Q88 GLU A 240 ? UNP P42196 ? ? 'expression tag' 240 1 1 7Q88 ASN A 241 ? UNP P42196 ? ? 'expression tag' 241 2 1 7Q88 SER A 242 ? UNP P42196 ? ? 'expression tag' 242 3 1 7Q88 HIS A 243 ? UNP P42196 ? ? 'expression tag' 243 4 1 7Q88 HIS A 244 ? UNP P42196 ? ? 'expression tag' 244 5 1 7Q88 HIS A 245 ? UNP P42196 ? ? 'expression tag' 245 6 1 7Q88 HIS A 246 ? UNP P42196 ? ? 'expression tag' 246 7 1 7Q88 HIS A 247 ? UNP P42196 ? ? 'expression tag' 247 8 1 7Q88 HIS A 248 ? UNP P42196 ? ? 'expression tag' 248 9 1 7Q88 HIS A 249 ? UNP P42196 ? ? 'expression tag' 249 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 770 ? 1 MORE -2 ? 1 'SSA (A^2)' 10230 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 3 ? ARG A 27 ? GLY A 3 ARG A 27 1 ? 25 HELX_P HELX_P2 AA2 GLU A 33 ? LEU A 56 ? GLU A 33 LEU A 56 1 ? 24 HELX_P HELX_P3 AA3 ALA A 70 ? GLY A 92 ? ALA A 70 GLY A 92 1 ? 23 HELX_P HELX_P4 AA4 ASP A 94 ? VAL A 118 ? ASP A 94 VAL A 118 1 ? 25 HELX_P HELX_P5 AA5 ILE A 121 ? GLY A 143 ? ILE A 121 GLY A 143 1 ? 23 HELX_P HELX_P6 AA6 GLY A 143 ? SER A 150 ? GLY A 143 SER A 150 1 ? 8 HELX_P HELX_P7 AA7 SER A 153 ? ALA A 172 ? SER A 153 ALA A 172 1 ? 20 HELX_P HELX_P8 AA8 ILE A 173 ? GLY A 181 ? ILE A 173 GLY A 181 1 ? 9 HELX_P HELX_P9 AA9 THR A 189 ? LEU A 219 ? THR A 189 LEU A 219 1 ? 31 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? A LYS 205 NZ A ? ? 1_555 B RET . C15 A ? A LYS 205 A RET 300 1_555 ? ? ? ? ? ? ? 1.429 ? ? covale2 covale one ? A LYS 205 NZ B ? ? 1_555 B RET . C15 B ? A LYS 205 A RET 300 1_555 ? ? ? ? ? ? ? 1.264 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 60 ? VAL A 63 ? TRP A 60 VAL A 63 AA1 2 ARG A 66 ? PHE A 69 ? ARG A 66 PHE A 69 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 61 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 61 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 68 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 68 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A LEU 110 ? B CB A LEU 110 ? B CG A LEU 110 ? B 99.30 115.30 -16.00 2.30 N 2 1 CA A LEU 159 ? B CB A LEU 159 ? B CG A LEU 159 ? B 129.87 115.30 14.57 2.30 N 3 1 CA A LEU 179 ? B CB A LEU 179 ? B CG A LEU 179 ? B 100.21 115.30 -15.09 2.30 N 4 1 CB A LEU 187 ? B CG A LEU 187 ? B CD2 A LEU 187 ? B 95.07 111.00 -15.93 1.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 27 ? A -29.45 -62.96 2 1 ASP A 28 ? A -76.39 -76.28 3 1 ASP A 28 ? B -70.48 -101.96 4 1 ALA A 29 ? B 77.45 -14.73 5 1 ALA A 64 ? A 55.36 -106.96 6 1 ALA A 64 ? B 60.67 -131.91 7 1 PHE A 69 ? B -103.38 77.72 8 1 PHE A 98 ? B -51.07 -74.41 9 1 ILE A 100 ? B -52.19 -81.25 10 1 LEU A 110 ? B -26.90 -62.90 11 1 PRO A 144 ? B -25.55 -80.29 12 1 ARG A 152 ? B -64.59 -177.34 13 1 LEU A 187 ? B -59.11 -98.82 14 1 LEU A 188 ? B -17.53 139.21 15 1 PRO A 190 ? B -22.12 -46.34 16 1 LYS A 205 ? B -115.29 -83.33 17 1 PHE A 208 ? B -20.63 -45.55 18 1 ASP A 214 ? B -63.63 12.20 19 1 ALA A 215 ? B -142.21 -24.94 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 434 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # _pdbx_entry_details.entry_id 7Q88 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O A A HOH 436 ? 6.55 . 2 1 O A A HOH 437 ? 8.06 . 3 1 O A A HOH 438 ? 8.64 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ARG 220 ? A ARG 220 2 1 Y 1 A ALA 221 ? A ALA 221 3 1 Y 1 A GLU 222 ? A GLU 222 4 1 Y 1 A HIS 223 ? A HIS 223 5 1 Y 1 A GLY 224 ? A GLY 224 6 1 Y 1 A GLU 225 ? A GLU 225 7 1 Y 1 A SER 226 ? A SER 226 8 1 Y 1 A LEU 227 ? A LEU 227 9 1 Y 1 A ALA 228 ? A ALA 228 10 1 Y 1 A GLY 229 ? A GLY 229 11 1 Y 1 A VAL 230 ? A VAL 230 12 1 Y 1 A ASP 231 ? A ASP 231 13 1 Y 1 A THR 232 ? A THR 232 14 1 Y 1 A ASP 233 ? A ASP 233 15 1 Y 1 A ALA 234 ? A ALA 234 16 1 Y 1 A PRO 235 ? A PRO 235 17 1 Y 1 A ALA 236 ? A ALA 236 18 1 Y 1 A VAL 237 ? A VAL 237 19 1 Y 1 A ALA 238 ? A ALA 238 20 1 Y 1 A ASP 239 ? A ASP 239 21 1 Y 1 A GLU 240 ? A GLU 240 22 1 Y 1 A ASN 241 ? A ASN 241 23 1 Y 1 A SER 242 ? A SER 242 24 1 Y 1 A HIS 243 ? A HIS 243 25 1 Y 1 A HIS 244 ? A HIS 244 26 1 Y 1 A HIS 245 ? A HIS 245 27 1 Y 1 A HIS 246 ? A HIS 246 28 1 Y 1 A HIS 247 ? A HIS 247 29 1 Y 1 A HIS 248 ? A HIS 248 30 1 Y 1 A HIS 249 ? A HIS 249 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 RET C1 C N N 276 RET C2 C N N 277 RET C3 C N N 278 RET C4 C N N 279 RET C5 C N N 280 RET C6 C N N 281 RET C7 C N N 282 RET C8 C N N 283 RET C9 C N N 284 RET C10 C N N 285 RET C11 C N N 286 RET C12 C N N 287 RET C13 C N N 288 RET C14 C N N 289 RET C15 C N N 290 RET O1 O N N 291 RET C16 C N N 292 RET C17 C N N 293 RET C18 C N N 294 RET C19 C N N 295 RET C20 C N N 296 RET H21 H N N 297 RET H22 H N N 298 RET H31 H N N 299 RET H32 H N N 300 RET H41 H N N 301 RET H42 H N N 302 RET H7 H N N 303 RET H8 H N N 304 RET H10 H N N 305 RET H11 H N N 306 RET H12 H N N 307 RET H14 H N N 308 RET H15 H N N 309 RET H161 H N N 310 RET H162 H N N 311 RET H163 H N N 312 RET H171 H N N 313 RET H172 H N N 314 RET H173 H N N 315 RET H181 H N N 316 RET H182 H N N 317 RET H183 H N N 318 RET H191 H N N 319 RET H192 H N N 320 RET H193 H N N 321 RET H201 H N N 322 RET H202 H N N 323 RET H203 H N N 324 SER N N N N 325 SER CA C N S 326 SER C C N N 327 SER O O N N 328 SER CB C N N 329 SER OG O N N 330 SER OXT O N N 331 SER H H N N 332 SER H2 H N N 333 SER HA H N N 334 SER HB2 H N N 335 SER HB3 H N N 336 SER HG H N N 337 SER HXT H N N 338 THR N N N N 339 THR CA C N S 340 THR C C N N 341 THR O O N N 342 THR CB C N R 343 THR OG1 O N N 344 THR CG2 C N N 345 THR OXT O N N 346 THR H H N N 347 THR H2 H N N 348 THR HA H N N 349 THR HB H N N 350 THR HG1 H N N 351 THR HG21 H N N 352 THR HG22 H N N 353 THR HG23 H N N 354 THR HXT H N N 355 TRP N N N N 356 TRP CA C N S 357 TRP C C N N 358 TRP O O N N 359 TRP CB C N N 360 TRP CG C Y N 361 TRP CD1 C Y N 362 TRP CD2 C Y N 363 TRP NE1 N Y N 364 TRP CE2 C Y N 365 TRP CE3 C Y N 366 TRP CZ2 C Y N 367 TRP CZ3 C Y N 368 TRP CH2 C Y N 369 TRP OXT O N N 370 TRP H H N N 371 TRP H2 H N N 372 TRP HA H N N 373 TRP HB2 H N N 374 TRP HB3 H N N 375 TRP HD1 H N N 376 TRP HE1 H N N 377 TRP HE3 H N N 378 TRP HZ2 H N N 379 TRP HZ3 H N N 380 TRP HH2 H N N 381 TRP HXT H N N 382 TYR N N N N 383 TYR CA C N S 384 TYR C C N N 385 TYR O O N N 386 TYR CB C N N 387 TYR CG C Y N 388 TYR CD1 C Y N 389 TYR CD2 C Y N 390 TYR CE1 C Y N 391 TYR CE2 C Y N 392 TYR CZ C Y N 393 TYR OH O N N 394 TYR OXT O N N 395 TYR H H N N 396 TYR H2 H N N 397 TYR HA H N N 398 TYR HB2 H N N 399 TYR HB3 H N N 400 TYR HD1 H N N 401 TYR HD2 H N N 402 TYR HE1 H N N 403 TYR HE2 H N N 404 TYR HH H N N 405 TYR HXT H N N 406 VAL N N N N 407 VAL CA C N S 408 VAL C C N N 409 VAL O O N N 410 VAL CB C N N 411 VAL CG1 C N N 412 VAL CG2 C N N 413 VAL OXT O N N 414 VAL H H N N 415 VAL H2 H N N 416 VAL HA H N N 417 VAL HB H N N 418 VAL HG11 H N N 419 VAL HG12 H N N 420 VAL HG13 H N N 421 VAL HG21 H N N 422 VAL HG22 H N N 423 VAL HG23 H N N 424 VAL HXT H N N 425 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 RET C1 C2 sing N N 264 RET C1 C6 sing N N 265 RET C1 C16 sing N N 266 RET C1 C17 sing N N 267 RET C2 C3 sing N N 268 RET C2 H21 sing N N 269 RET C2 H22 sing N N 270 RET C3 C4 sing N N 271 RET C3 H31 sing N N 272 RET C3 H32 sing N N 273 RET C4 C5 sing N N 274 RET C4 H41 sing N N 275 RET C4 H42 sing N N 276 RET C5 C6 doub N N 277 RET C5 C18 sing N N 278 RET C6 C7 sing N N 279 RET C7 C8 doub N E 280 RET C7 H7 sing N N 281 RET C8 C9 sing N N 282 RET C8 H8 sing N N 283 RET C9 C10 doub N E 284 RET C9 C19 sing N N 285 RET C10 C11 sing N N 286 RET C10 H10 sing N N 287 RET C11 C12 doub N E 288 RET C11 H11 sing N N 289 RET C12 C13 sing N N 290 RET C12 H12 sing N N 291 RET C13 C14 doub N E 292 RET C13 C20 sing N N 293 RET C14 C15 sing N N 294 RET C14 H14 sing N N 295 RET C15 O1 doub N N 296 RET C15 H15 sing N N 297 RET C16 H161 sing N N 298 RET C16 H162 sing N N 299 RET C16 H163 sing N N 300 RET C17 H171 sing N N 301 RET C17 H172 sing N N 302 RET C17 H173 sing N N 303 RET C18 H181 sing N N 304 RET C18 H182 sing N N 305 RET C18 H183 sing N N 306 RET C19 H191 sing N N 307 RET C19 H192 sing N N 308 RET C19 H193 sing N N 309 RET C20 H201 sing N N 310 RET C20 H202 sing N N 311 RET C20 H203 sing N N 312 SER N CA sing N N 313 SER N H sing N N 314 SER N H2 sing N N 315 SER CA C sing N N 316 SER CA CB sing N N 317 SER CA HA sing N N 318 SER C O doub N N 319 SER C OXT sing N N 320 SER CB OG sing N N 321 SER CB HB2 sing N N 322 SER CB HB3 sing N N 323 SER OG HG sing N N 324 SER OXT HXT sing N N 325 THR N CA sing N N 326 THR N H sing N N 327 THR N H2 sing N N 328 THR CA C sing N N 329 THR CA CB sing N N 330 THR CA HA sing N N 331 THR C O doub N N 332 THR C OXT sing N N 333 THR CB OG1 sing N N 334 THR CB CG2 sing N N 335 THR CB HB sing N N 336 THR OG1 HG1 sing N N 337 THR CG2 HG21 sing N N 338 THR CG2 HG22 sing N N 339 THR CG2 HG23 sing N N 340 THR OXT HXT sing N N 341 TRP N CA sing N N 342 TRP N H sing N N 343 TRP N H2 sing N N 344 TRP CA C sing N N 345 TRP CA CB sing N N 346 TRP CA HA sing N N 347 TRP C O doub N N 348 TRP C OXT sing N N 349 TRP CB CG sing N N 350 TRP CB HB2 sing N N 351 TRP CB HB3 sing N N 352 TRP CG CD1 doub Y N 353 TRP CG CD2 sing Y N 354 TRP CD1 NE1 sing Y N 355 TRP CD1 HD1 sing N N 356 TRP CD2 CE2 doub Y N 357 TRP CD2 CE3 sing Y N 358 TRP NE1 CE2 sing Y N 359 TRP NE1 HE1 sing N N 360 TRP CE2 CZ2 sing Y N 361 TRP CE3 CZ3 doub Y N 362 TRP CE3 HE3 sing N N 363 TRP CZ2 CH2 doub Y N 364 TRP CZ2 HZ2 sing N N 365 TRP CZ3 CH2 sing Y N 366 TRP CZ3 HZ3 sing N N 367 TRP CH2 HH2 sing N N 368 TRP OXT HXT sing N N 369 TYR N CA sing N N 370 TYR N H sing N N 371 TYR N H2 sing N N 372 TYR CA C sing N N 373 TYR CA CB sing N N 374 TYR CA HA sing N N 375 TYR C O doub N N 376 TYR C OXT sing N N 377 TYR CB CG sing N N 378 TYR CB HB2 sing N N 379 TYR CB HB3 sing N N 380 TYR CG CD1 doub Y N 381 TYR CG CD2 sing Y N 382 TYR CD1 CE1 sing Y N 383 TYR CD1 HD1 sing N N 384 TYR CD2 CE2 doub Y N 385 TYR CD2 HD2 sing N N 386 TYR CE1 CZ doub Y N 387 TYR CE1 HE1 sing N N 388 TYR CE2 CZ sing Y N 389 TYR CE2 HE2 sing N N 390 TYR CZ OH sing N N 391 TYR OH HH sing N N 392 TYR OXT HXT sing N N 393 VAL N CA sing N N 394 VAL N H sing N N 395 VAL N H2 sing N N 396 VAL CA C sing N N 397 VAL CA CB sing N N 398 VAL CA HA sing N N 399 VAL C O doub N N 400 VAL C OXT sing N N 401 VAL CB CG1 sing N N 402 VAL CB CG2 sing N N 403 VAL CB HB sing N N 404 VAL CG1 HG11 sing N N 405 VAL CG1 HG12 sing N N 406 VAL CG1 HG13 sing N N 407 VAL CG2 HG21 sing N N 408 VAL CG2 HG22 sing N N 409 VAL CG2 HG23 sing N N 410 VAL OXT HXT sing N N 411 # _pdbx_audit_support.funding_organization 'H2020 Marie Curie Actions of the European Commission' _pdbx_audit_support.country 'European Union' _pdbx_audit_support.grant_number 637295 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id RET _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id RET _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.accession_code 1H68 _pdbx_initial_refinement_model.details ? _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.type 'experimental model' # _pdbx_serial_crystallography_sample_delivery.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery.description ? _pdbx_serial_crystallography_sample_delivery.method injection # _pdbx_serial_crystallography_sample_delivery_injection.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery_injection.description ? _pdbx_serial_crystallography_sample_delivery_injection.injector_diameter ? _pdbx_serial_crystallography_sample_delivery_injection.injector_temperature ? _pdbx_serial_crystallography_sample_delivery_injection.injector_pressure ? _pdbx_serial_crystallography_sample_delivery_injection.flow_rate ? _pdbx_serial_crystallography_sample_delivery_injection.carrier_solvent LCP _pdbx_serial_crystallography_sample_delivery_injection.crystal_concentration ? _pdbx_serial_crystallography_sample_delivery_injection.preparation ? _pdbx_serial_crystallography_sample_delivery_injection.power_by ? _pdbx_serial_crystallography_sample_delivery_injection.injector_nozzle ? _pdbx_serial_crystallography_sample_delivery_injection.jet_diameter 75 _pdbx_serial_crystallography_sample_delivery_injection.filter_size ? # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 7Q88 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011142 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007593 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019608 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_