data_7QB2 # _entry.id 7QB2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7QB2 pdb_00007qb2 10.2210/pdb7qb2/pdb WWPDB D_1292117984 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-30 2 'Structure model' 1 1 2023-02-01 3 'Structure model' 1 2 2024-02-07 4 'Structure model' 1 3 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7QB2 _pdbx_database_status.recvd_initial_deposition_date 2021-11-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email wibke.diederich@staff.uni-marburg.de _pdbx_contact_author.name_first Wibke _pdbx_contact_author.name_last Diederich _pdbx_contact_author.name_mi E. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5671-6575 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hochban, P.M.M.' 1 0000-0003-3526-7314 'Heine, A.' 2 0000-0002-5285-4089 'Diederich, W.E.' 3 0000-0001-5671-6575 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country FR _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Eur.J.Med.Chem. _citation.journal_id_ASTM EJMCA5 _citation.journal_id_CSD 0493 _citation.journal_id_ISSN 0223-5234 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 245 _citation.language ? _citation.page_first 114914 _citation.page_last 114914 _citation.title ;Pose, duplicate, then elaborate: Steps towards increased affinity for inhibitors targeting the specificity surface of the Pim-1 kinase. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.ejmech.2022.114914 _citation.pdbx_database_id_PubMed 36410167 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Heyder, L.' 1 ? primary 'Hochban, P.M.M.' 2 ? primary 'Taylor, C.' 3 ? primary 'Chevillard, F.' 4 ? primary 'Siefker, C.' 5 ? primary 'Iking, C.' 6 ? primary 'Borchardt, H.' 7 ? primary 'Aigner, A.' 8 ? primary 'Klebe, G.' 9 ? primary 'Heine, A.' 10 ? primary 'Kolb, P.' 11 ? primary 'Diederich, W.E.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase pim-1' 35583.398 1 2.7.11.1 R250G ? ? 2 polymer syn Pimtide 1592.850 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 non-polymer syn '4-[(E)-(6-azanyl-1-methyl-2-oxidanylidene-indol-3-ylidene)methyl]benzoic acid' 294.305 1 ? ? ? ? 5 water nat water 18.015 87 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGEL PNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHN CGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI PFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS ; ;MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGEL PNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHN CGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI PFEHDEEIIGGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS ; A ? 2 'polypeptide(L)' no no ARKRRRHPSGPPTA ARKRRRHPSGPPTA D ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 GLYCEROL GOL 4 '4-[(E)-(6-azanyl-1-methyl-2-oxidanylidene-indol-3-ylidene)methyl]benzoic acid' A7X 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 LEU n 1 4 SER n 1 5 LYS n 1 6 ILE n 1 7 ASN n 1 8 SER n 1 9 LEU n 1 10 ALA n 1 11 HIS n 1 12 LEU n 1 13 ARG n 1 14 ALA n 1 15 ALA n 1 16 PRO n 1 17 CYS n 1 18 ASN n 1 19 ASP n 1 20 LEU n 1 21 HIS n 1 22 ALA n 1 23 THR n 1 24 LYS n 1 25 LEU n 1 26 ALA n 1 27 PRO n 1 28 GLY n 1 29 LYS n 1 30 GLU n 1 31 LYS n 1 32 GLU n 1 33 PRO n 1 34 LEU n 1 35 GLU n 1 36 SER n 1 37 GLN n 1 38 TYR n 1 39 GLN n 1 40 VAL n 1 41 GLY n 1 42 PRO n 1 43 LEU n 1 44 LEU n 1 45 GLY n 1 46 SER n 1 47 GLY n 1 48 GLY n 1 49 PHE n 1 50 GLY n 1 51 SER n 1 52 VAL n 1 53 TYR n 1 54 SER n 1 55 GLY n 1 56 ILE n 1 57 ARG n 1 58 VAL n 1 59 SER n 1 60 ASP n 1 61 ASN n 1 62 LEU n 1 63 PRO n 1 64 VAL n 1 65 ALA n 1 66 ILE n 1 67 LYS n 1 68 HIS n 1 69 VAL n 1 70 GLU n 1 71 LYS n 1 72 ASP n 1 73 ARG n 1 74 ILE n 1 75 SER n 1 76 ASP n 1 77 TRP n 1 78 GLY n 1 79 GLU n 1 80 LEU n 1 81 PRO n 1 82 ASN n 1 83 GLY n 1 84 THR n 1 85 ARG n 1 86 VAL n 1 87 PRO n 1 88 MET n 1 89 GLU n 1 90 VAL n 1 91 VAL n 1 92 LEU n 1 93 LEU n 1 94 LYS n 1 95 LYS n 1 96 VAL n 1 97 SER n 1 98 SER n 1 99 GLY n 1 100 PHE n 1 101 SER n 1 102 GLY n 1 103 VAL n 1 104 ILE n 1 105 ARG n 1 106 LEU n 1 107 LEU n 1 108 ASP n 1 109 TRP n 1 110 PHE n 1 111 GLU n 1 112 ARG n 1 113 PRO n 1 114 ASP n 1 115 SER n 1 116 PHE n 1 117 VAL n 1 118 LEU n 1 119 ILE n 1 120 LEU n 1 121 GLU n 1 122 ARG n 1 123 PRO n 1 124 GLU n 1 125 PRO n 1 126 VAL n 1 127 GLN n 1 128 ASP n 1 129 LEU n 1 130 PHE n 1 131 ASP n 1 132 PHE n 1 133 ILE n 1 134 THR n 1 135 GLU n 1 136 ARG n 1 137 GLY n 1 138 ALA n 1 139 LEU n 1 140 GLN n 1 141 GLU n 1 142 GLU n 1 143 LEU n 1 144 ALA n 1 145 ARG n 1 146 SER n 1 147 PHE n 1 148 PHE n 1 149 TRP n 1 150 GLN n 1 151 VAL n 1 152 LEU n 1 153 GLU n 1 154 ALA n 1 155 VAL n 1 156 ARG n 1 157 HIS n 1 158 CYS n 1 159 HIS n 1 160 ASN n 1 161 CYS n 1 162 GLY n 1 163 VAL n 1 164 LEU n 1 165 HIS n 1 166 ARG n 1 167 ASP n 1 168 ILE n 1 169 LYS n 1 170 ASP n 1 171 GLU n 1 172 ASN n 1 173 ILE n 1 174 LEU n 1 175 ILE n 1 176 ASP n 1 177 LEU n 1 178 ASN n 1 179 ARG n 1 180 GLY n 1 181 GLU n 1 182 LEU n 1 183 LYS n 1 184 LEU n 1 185 ILE n 1 186 ASP n 1 187 PHE n 1 188 GLY n 1 189 SER n 1 190 GLY n 1 191 ALA n 1 192 LEU n 1 193 LEU n 1 194 LYS n 1 195 ASP n 1 196 THR n 1 197 VAL n 1 198 TYR n 1 199 THR n 1 200 ASP n 1 201 PHE n 1 202 ASP n 1 203 GLY n 1 204 THR n 1 205 ARG n 1 206 VAL n 1 207 TYR n 1 208 SER n 1 209 PRO n 1 210 PRO n 1 211 GLU n 1 212 TRP n 1 213 ILE n 1 214 ARG n 1 215 TYR n 1 216 HIS n 1 217 ARG n 1 218 TYR n 1 219 HIS n 1 220 GLY n 1 221 ARG n 1 222 SER n 1 223 ALA n 1 224 ALA n 1 225 VAL n 1 226 TRP n 1 227 SER n 1 228 LEU n 1 229 GLY n 1 230 ILE n 1 231 LEU n 1 232 LEU n 1 233 TYR n 1 234 ASP n 1 235 MET n 1 236 VAL n 1 237 CYS n 1 238 GLY n 1 239 ASP n 1 240 ILE n 1 241 PRO n 1 242 PHE n 1 243 GLU n 1 244 HIS n 1 245 ASP n 1 246 GLU n 1 247 GLU n 1 248 ILE n 1 249 ILE n 1 250 GLY n 1 251 GLY n 1 252 GLN n 1 253 VAL n 1 254 PHE n 1 255 PHE n 1 256 ARG n 1 257 GLN n 1 258 ARG n 1 259 VAL n 1 260 SER n 1 261 SEP n 1 262 GLU n 1 263 CYS n 1 264 GLN n 1 265 HIS n 1 266 LEU n 1 267 ILE n 1 268 ARG n 1 269 TRP n 1 270 CYS n 1 271 LEU n 1 272 ALA n 1 273 LEU n 1 274 ARG n 1 275 PRO n 1 276 SER n 1 277 ASP n 1 278 ARG n 1 279 PRO n 1 280 THR n 1 281 PHE n 1 282 GLU n 1 283 GLU n 1 284 ILE n 1 285 GLN n 1 286 ASN n 1 287 HIS n 1 288 PRO n 1 289 TRP n 1 290 MET n 1 291 GLN n 1 292 ASP n 1 293 VAL n 1 294 LEU n 1 295 LEU n 1 296 PRO n 1 297 GLN n 1 298 GLU n 1 299 THR n 1 300 ALA n 1 301 GLU n 1 302 ILE n 1 303 HIS n 1 304 LEU n 1 305 HIS n 1 306 SER n 1 307 LEU n 1 308 SER n 1 309 PRO n 1 310 GLY n 1 311 PRO n 1 312 SER n 2 1 ALA n 2 2 ARG n 2 3 LYS n 2 4 ARG n 2 5 ARG n 2 6 ARG n 2 7 HIS n 2 8 PRO n 2 9 SER n 2 10 GLY n 2 11 PRO n 2 12 PRO n 2 13 THR n 2 14 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 312 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PIM1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pLIC-SGC _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 14 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A7X non-polymer . '4-[(E)-(6-azanyl-1-methyl-2-oxidanylidene-indol-3-ylidene)methyl]benzoic acid' '(E)-4-((6-amino-1-methyl-2-oxoindolin-3-ylidene)methyl)benzoic acid' 'C17 H14 N2 O3' 294.305 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LEU 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 ILE 6 6 ? ? ? A . n A 1 7 ASN 7 7 ? ? ? A . n A 1 8 SER 8 8 ? ? ? A . n A 1 9 LEU 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 HIS 11 11 ? ? ? A . n A 1 12 LEU 12 12 ? ? ? A . n A 1 13 ARG 13 13 ? ? ? A . n A 1 14 ALA 14 14 ? ? ? A . n A 1 15 ALA 15 15 ? ? ? A . n A 1 16 PRO 16 16 ? ? ? A . n A 1 17 CYS 17 17 ? ? ? A . n A 1 18 ASN 18 18 ? ? ? A . n A 1 19 ASP 19 19 ? ? ? A . n A 1 20 LEU 20 20 ? ? ? A . n A 1 21 HIS 21 21 ? ? ? A . n A 1 22 ALA 22 22 ? ? ? A . n A 1 23 THR 23 23 ? ? ? A . n A 1 24 LYS 24 24 ? ? ? A . n A 1 25 LEU 25 25 ? ? ? A . n A 1 26 ALA 26 26 ? ? ? A . n A 1 27 PRO 27 27 ? ? ? A . n A 1 28 GLY 28 28 ? ? ? A . n A 1 29 LYS 29 29 ? ? ? A . n A 1 30 GLU 30 30 ? ? ? A . n A 1 31 LYS 31 31 ? ? ? A . n A 1 32 GLU 32 32 ? ? ? A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 TRP 149 149 149 TRP TRP A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 HIS 157 157 157 HIS HIS A . n A 1 158 CYS 158 158 158 CYS CYS A . n A 1 159 HIS 159 159 159 HIS HIS A . n A 1 160 ASN 160 160 160 ASN ASN A . n A 1 161 CYS 161 161 161 CYS CYS A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 HIS 165 165 165 HIS HIS A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 ASN 172 172 172 ASN ASN A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 ASN 178 178 178 ASN ASN A . n A 1 179 ARG 179 179 179 ARG ARG A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 ILE 185 185 185 ILE ILE A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 PHE 187 187 187 PHE PHE A . n A 1 188 GLY 188 188 188 GLY GLY A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 LYS 194 194 194 LYS LYS A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 THR 196 196 196 THR THR A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 TYR 198 198 198 TYR TYR A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 PHE 201 201 201 PHE PHE A . n A 1 202 ASP 202 202 202 ASP ASP A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 ARG 205 205 205 ARG ARG A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 TYR 207 207 207 TYR TYR A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 PRO 210 210 210 PRO PRO A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 TRP 212 212 212 TRP TRP A . n A 1 213 ILE 213 213 213 ILE ILE A . n A 1 214 ARG 214 214 214 ARG ARG A . n A 1 215 TYR 215 215 215 TYR TYR A . n A 1 216 HIS 216 216 216 HIS HIS A . n A 1 217 ARG 217 217 217 ARG ARG A . n A 1 218 TYR 218 218 218 TYR TYR A . n A 1 219 HIS 219 219 219 HIS HIS A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 ARG 221 221 221 ARG ARG A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 ALA 223 223 223 ALA ALA A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 TRP 226 226 226 TRP TRP A . n A 1 227 SER 227 227 227 SER SER A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 GLY 229 229 229 GLY GLY A . n A 1 230 ILE 230 230 230 ILE ILE A . n A 1 231 LEU 231 231 231 LEU LEU A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 TYR 233 233 233 TYR TYR A . n A 1 234 ASP 234 234 234 ASP ASP A . n A 1 235 MET 235 235 235 MET MET A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 CYS 237 237 237 CYS CYS A . n A 1 238 GLY 238 238 238 GLY GLY A . n A 1 239 ASP 239 239 239 ASP ASP A . n A 1 240 ILE 240 240 240 ILE ILE A . n A 1 241 PRO 241 241 241 PRO PRO A . n A 1 242 PHE 242 242 242 PHE PHE A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 HIS 244 244 244 HIS HIS A . n A 1 245 ASP 245 245 245 ASP ASP A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 GLU 247 247 247 GLU GLU A . n A 1 248 ILE 248 248 248 ILE ILE A . n A 1 249 ILE 249 249 249 ILE ILE A . n A 1 250 GLY 250 250 250 GLY GLY A . n A 1 251 GLY 251 251 251 GLY GLY A . n A 1 252 GLN 252 252 252 GLN GLN A . n A 1 253 VAL 253 253 253 VAL VAL A . n A 1 254 PHE 254 254 254 PHE PHE A . n A 1 255 PHE 255 255 255 PHE PHE A . n A 1 256 ARG 256 256 256 ARG ARG A . n A 1 257 GLN 257 257 257 GLN GLN A . n A 1 258 ARG 258 258 258 ARG ARG A . n A 1 259 VAL 259 259 259 VAL VAL A . n A 1 260 SER 260 260 260 SER SER A . n A 1 261 SEP 261 261 261 SEP SEP A . n A 1 262 GLU 262 262 262 GLU GLU A . n A 1 263 CYS 263 263 263 CYS CYS A . n A 1 264 GLN 264 264 264 GLN GLN A . n A 1 265 HIS 265 265 265 HIS HIS A . n A 1 266 LEU 266 266 266 LEU LEU A . n A 1 267 ILE 267 267 267 ILE ILE A . n A 1 268 ARG 268 268 268 ARG ARG A . n A 1 269 TRP 269 269 269 TRP TRP A . n A 1 270 CYS 270 270 270 CYS CYS A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 ALA 272 272 272 ALA ALA A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 ARG 274 274 274 ARG ARG A . n A 1 275 PRO 275 275 275 PRO PRO A . n A 1 276 SER 276 276 276 SER SER A . n A 1 277 ASP 277 277 277 ASP ASP A . n A 1 278 ARG 278 278 278 ARG ARG A . n A 1 279 PRO 279 279 279 PRO PRO A . n A 1 280 THR 280 280 280 THR THR A . n A 1 281 PHE 281 281 281 PHE PHE A . n A 1 282 GLU 282 282 282 GLU GLU A . n A 1 283 GLU 283 283 283 GLU GLU A . n A 1 284 ILE 284 284 284 ILE ILE A . n A 1 285 GLN 285 285 285 GLN GLN A . n A 1 286 ASN 286 286 286 ASN ASN A . n A 1 287 HIS 287 287 287 HIS HIS A . n A 1 288 PRO 288 288 288 PRO PRO A . n A 1 289 TRP 289 289 289 TRP TRP A . n A 1 290 MET 290 290 290 MET MET A . n A 1 291 GLN 291 291 291 GLN GLN A . n A 1 292 ASP 292 292 292 ASP ASP A . n A 1 293 VAL 293 293 293 VAL VAL A . n A 1 294 LEU 294 294 294 LEU LEU A . n A 1 295 LEU 295 295 295 LEU LEU A . n A 1 296 PRO 296 296 296 PRO PRO A . n A 1 297 GLN 297 297 297 GLN GLN A . n A 1 298 GLU 298 298 298 GLU GLU A . n A 1 299 THR 299 299 299 THR THR A . n A 1 300 ALA 300 300 300 ALA ALA A . n A 1 301 GLU 301 301 301 GLU GLU A . n A 1 302 ILE 302 302 302 ILE ILE A . n A 1 303 HIS 303 303 303 HIS HIS A . n A 1 304 LEU 304 304 304 LEU LEU A . n A 1 305 HIS 305 305 305 HIS HIS A . n A 1 306 SER 306 306 ? ? ? A . n A 1 307 LEU 307 307 ? ? ? A . n A 1 308 SER 308 308 ? ? ? A . n A 1 309 PRO 309 309 ? ? ? A . n A 1 310 GLY 310 310 ? ? ? A . n A 1 311 PRO 311 311 ? ? ? A . n A 1 312 SER 312 312 ? ? ? A . n B 2 1 ALA 1 1 ? ? ? D . n B 2 2 ARG 2 2 2 ARG ARG D . n B 2 3 LYS 3 3 3 LYS LYS D . n B 2 4 ARG 4 4 4 ARG ARG D . n B 2 5 ARG 5 5 5 ARG ARG D . n B 2 6 ARG 6 6 6 ARG ARG D . n B 2 7 HIS 7 7 7 HIS HIS D . n B 2 8 PRO 8 8 8 PRO PRO D . n B 2 9 SER 9 9 9 SER SER D . n B 2 10 GLY 10 10 ? ? ? D . n B 2 11 PRO 11 11 ? ? ? D . n B 2 12 PRO 12 12 ? ? ? D . n B 2 13 THR 13 13 ? ? ? D . n B 2 14 ALA 14 14 ? ? ? D . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A7X _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A7X _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GOL 1 401 1 GOL GOL A . D 4 A7X 1 402 1 A7X 552 A . E 5 HOH 1 501 91 HOH HOH A . E 5 HOH 2 502 64 HOH HOH A . E 5 HOH 3 503 75 HOH HOH A . E 5 HOH 4 504 107 HOH HOH A . E 5 HOH 5 505 30 HOH HOH A . E 5 HOH 6 506 37 HOH HOH A . E 5 HOH 7 507 25 HOH HOH A . E 5 HOH 8 508 7 HOH HOH A . E 5 HOH 9 509 80 HOH HOH A . E 5 HOH 10 510 9 HOH HOH A . E 5 HOH 11 511 89 HOH HOH A . E 5 HOH 12 512 39 HOH HOH A . E 5 HOH 13 513 31 HOH HOH A . E 5 HOH 14 514 8 HOH HOH A . E 5 HOH 15 515 45 HOH HOH A . E 5 HOH 16 516 16 HOH HOH A . E 5 HOH 17 517 56 HOH HOH A . E 5 HOH 18 518 59 HOH HOH A . E 5 HOH 19 519 24 HOH HOH A . E 5 HOH 20 520 18 HOH HOH A . E 5 HOH 21 521 48 HOH HOH A . E 5 HOH 22 522 6 HOH HOH A . E 5 HOH 23 523 38 HOH HOH A . E 5 HOH 24 524 52 HOH HOH A . E 5 HOH 25 525 50 HOH HOH A . E 5 HOH 26 526 86 HOH HOH A . E 5 HOH 27 527 3 HOH HOH A . E 5 HOH 28 528 95 HOH HOH A . E 5 HOH 29 529 65 HOH HOH A . E 5 HOH 30 530 22 HOH HOH A . E 5 HOH 31 531 97 HOH HOH A . E 5 HOH 32 532 2 HOH HOH A . E 5 HOH 33 533 79 HOH HOH A . E 5 HOH 34 534 105 HOH HOH A . E 5 HOH 35 535 23 HOH HOH A . E 5 HOH 36 536 27 HOH HOH A . E 5 HOH 37 537 69 HOH HOH A . E 5 HOH 38 538 83 HOH HOH A . E 5 HOH 39 539 17 HOH HOH A . E 5 HOH 40 540 62 HOH HOH A . E 5 HOH 41 541 5 HOH HOH A . E 5 HOH 42 542 70 HOH HOH A . E 5 HOH 43 543 68 HOH HOH A . E 5 HOH 44 544 28 HOH HOH A . E 5 HOH 45 545 98 HOH HOH A . E 5 HOH 46 546 34 HOH HOH A . E 5 HOH 47 547 44 HOH HOH A . E 5 HOH 48 548 103 HOH HOH A . E 5 HOH 49 549 73 HOH HOH A . E 5 HOH 50 550 10 HOH HOH A . E 5 HOH 51 551 47 HOH HOH A . E 5 HOH 52 552 14 HOH HOH A . E 5 HOH 53 553 43 HOH HOH A . E 5 HOH 54 554 49 HOH HOH A . E 5 HOH 55 555 66 HOH HOH A . E 5 HOH 56 556 96 HOH HOH A . E 5 HOH 57 557 93 HOH HOH A . E 5 HOH 58 558 1 HOH HOH A . E 5 HOH 59 559 102 HOH HOH A . E 5 HOH 60 560 54 HOH HOH A . E 5 HOH 61 561 4 HOH HOH A . E 5 HOH 62 562 53 HOH HOH A . E 5 HOH 63 563 88 HOH HOH A . E 5 HOH 64 564 63 HOH HOH A . E 5 HOH 65 565 104 HOH HOH A . E 5 HOH 66 566 46 HOH HOH A . E 5 HOH 67 567 21 HOH HOH A . E 5 HOH 68 568 11 HOH HOH A . E 5 HOH 69 569 99 HOH HOH A . E 5 HOH 70 570 77 HOH HOH A . E 5 HOH 71 571 13 HOH HOH A . E 5 HOH 72 572 78 HOH HOH A . E 5 HOH 73 573 15 HOH HOH A . E 5 HOH 74 574 71 HOH HOH A . E 5 HOH 75 575 101 HOH HOH A . E 5 HOH 76 576 19 HOH HOH A . E 5 HOH 77 577 33 HOH HOH A . E 5 HOH 78 578 32 HOH HOH A . E 5 HOH 79 579 58 HOH HOH A . E 5 HOH 80 580 106 HOH HOH A . E 5 HOH 81 581 51 HOH HOH A . E 5 HOH 82 582 100 HOH HOH A . E 5 HOH 83 583 76 HOH HOH A . F 5 HOH 1 101 85 HOH HOH D . F 5 HOH 2 102 60 HOH HOH D . F 5 HOH 3 103 74 HOH HOH D . F 5 HOH 4 104 67 HOH HOH D . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PRO 33 ? CG ? A PRO 33 CG 2 1 Y 1 A PRO 33 ? CD ? A PRO 33 CD 3 1 Y 1 A LEU 34 ? CG ? A LEU 34 CG 4 1 Y 1 A LEU 34 ? CD1 ? A LEU 34 CD1 5 1 Y 1 A LEU 34 ? CD2 ? A LEU 34 CD2 6 1 Y 1 A GLU 35 ? CG ? A GLU 35 CG 7 1 Y 1 A GLU 35 ? CD ? A GLU 35 CD 8 1 Y 1 A GLU 35 ? OE1 ? A GLU 35 OE1 9 1 Y 1 A GLU 35 ? OE2 ? A GLU 35 OE2 10 1 Y 1 A GLN 39 ? CD ? A GLN 39 CD 11 1 Y 1 A GLN 39 ? OE1 ? A GLN 39 OE1 12 1 Y 1 A GLN 39 ? NE2 ? A GLN 39 NE2 13 1 Y 1 A LEU 43 ? CD2 ? A LEU 43 CD2 14 1 Y 1 A PHE 49 ? CG ? A PHE 49 CG 15 1 Y 1 A PHE 49 ? CD1 ? A PHE 49 CD1 16 1 Y 1 A PHE 49 ? CD2 ? A PHE 49 CD2 17 1 Y 1 A PHE 49 ? CE1 ? A PHE 49 CE1 18 1 Y 1 A PHE 49 ? CE2 ? A PHE 49 CE2 19 1 Y 1 A PHE 49 ? CZ ? A PHE 49 CZ 20 1 Y 1 A ILE 56 ? CG2 ? A ILE 56 CG2 21 1 Y 1 A ILE 56 ? CD1 ? A ILE 56 CD1 22 1 Y 1 A VAL 58 ? CG1 ? A VAL 58 CG1 23 1 Y 1 A SER 59 ? OG ? A SER 59 OG 24 1 Y 1 A ASN 61 ? ND2 ? A ASN 61 ND2 25 1 Y 1 A LEU 62 ? CD2 ? A LEU 62 CD2 26 1 Y 1 A GLU 70 ? OE2 ? A GLU 70 OE2 27 1 Y 1 A ASP 72 ? OD1 ? A ASP 72 OD1 28 1 Y 1 A ARG 73 ? CD ? A ARG 73 CD 29 1 Y 1 A ARG 73 ? NE ? A ARG 73 NE 30 1 Y 1 A ARG 73 ? CZ ? A ARG 73 CZ 31 1 Y 1 A ARG 73 ? NH1 ? A ARG 73 NH1 32 1 Y 1 A ARG 73 ? NH2 ? A ARG 73 NH2 33 1 Y 1 A SER 75 ? OG ? A SER 75 OG 34 1 Y 1 A ASP 76 ? OD1 ? A ASP 76 OD1 35 1 Y 1 A ASP 76 ? OD2 ? A ASP 76 OD2 36 1 Y 1 A GLU 79 ? CG ? A GLU 79 CG 37 1 Y 1 A GLU 79 ? CD ? A GLU 79 CD 38 1 Y 1 A GLU 79 ? OE1 ? A GLU 79 OE1 39 1 Y 1 A GLU 79 ? OE2 ? A GLU 79 OE2 40 1 Y 1 A LEU 80 ? CG ? A LEU 80 CG 41 1 Y 1 A LEU 80 ? CD1 ? A LEU 80 CD1 42 1 Y 1 A LEU 80 ? CD2 ? A LEU 80 CD2 43 1 Y 1 A PRO 81 ? CG ? A PRO 81 CG 44 1 Y 1 A PRO 81 ? CD ? A PRO 81 CD 45 1 Y 1 A ASN 82 ? CG ? A ASN 82 CG 46 1 Y 1 A ASN 82 ? OD1 ? A ASN 82 OD1 47 1 Y 1 A ASN 82 ? ND2 ? A ASN 82 ND2 48 1 Y 1 A THR 84 ? OG1 ? A THR 84 OG1 49 1 Y 1 A THR 84 ? CG2 ? A THR 84 CG2 50 1 Y 1 A ARG 85 ? CG ? A ARG 85 CG 51 1 Y 1 A ARG 85 ? CD ? A ARG 85 CD 52 1 Y 1 A ARG 85 ? NE ? A ARG 85 NE 53 1 Y 1 A ARG 85 ? CZ ? A ARG 85 CZ 54 1 Y 1 A ARG 85 ? NH1 ? A ARG 85 NH1 55 1 Y 1 A ARG 85 ? NH2 ? A ARG 85 NH2 56 1 Y 1 A LYS 94 ? CE ? A LYS 94 CE 57 1 Y 1 A LYS 94 ? NZ ? A LYS 94 NZ 58 1 Y 1 A SER 101 ? OG ? A SER 101 OG 59 1 Y 1 A ARG 105 ? CZ ? A ARG 105 CZ 60 1 Y 1 A ARG 105 ? NH1 ? A ARG 105 NH1 61 1 Y 1 A ARG 105 ? NH2 ? A ARG 105 NH2 62 1 Y 1 A LEU 107 ? CD1 ? A LEU 107 CD1 63 1 Y 1 A PHE 110 ? CE1 ? A PHE 110 CE1 64 1 Y 1 A PHE 110 ? CE2 ? A PHE 110 CE2 65 1 Y 1 A PHE 110 ? CZ ? A PHE 110 CZ 66 1 Y 1 A ASP 114 ? OD1 ? A ASP 114 OD1 67 1 Y 1 A ASP 114 ? OD2 ? A ASP 114 OD2 68 1 Y 1 A GLU 124 ? OE1 ? A GLU 124 OE1 69 1 Y 1 A VAL 126 ? CG1 ? A VAL 126 CG1 70 1 Y 1 A ARG 179 ? NH1 ? A ARG 179 NH1 71 1 Y 1 A LEU 184 ? CD2 ? A LEU 184 CD2 72 1 Y 1 A ASP 202 ? OD1 ? A ASP 202 OD1 73 1 Y 1 A ASP 202 ? OD2 ? A ASP 202 OD2 74 1 Y 1 A ARG 214 ? NH1 ? A ARG 214 NH1 75 1 Y 1 A ARG 214 ? NH2 ? A ARG 214 NH2 76 1 Y 1 A GLU 246 ? OE1 ? A GLU 246 OE1 77 1 Y 1 A GLN 252 ? OE1 ? A GLN 252 OE1 78 1 Y 1 A GLN 252 ? NE2 ? A GLN 252 NE2 79 1 Y 1 A GLU 262 ? OE1 ? A GLU 262 OE1 80 1 Y 1 A GLU 262 ? OE2 ? A GLU 262 OE2 81 1 Y 1 A ARG 274 ? CD ? A ARG 274 CD 82 1 Y 1 A ARG 274 ? NE ? A ARG 274 NE 83 1 Y 1 A ARG 274 ? CZ ? A ARG 274 CZ 84 1 Y 1 A ARG 274 ? NH1 ? A ARG 274 NH1 85 1 Y 1 A ARG 274 ? NH2 ? A ARG 274 NH2 86 1 Y 1 A GLN 297 ? CG ? A GLN 297 CG 87 1 Y 1 A GLN 297 ? CD ? A GLN 297 CD 88 1 Y 1 A GLN 297 ? OE1 ? A GLN 297 OE1 89 1 Y 1 A GLN 297 ? NE2 ? A GLN 297 NE2 90 1 Y 1 A GLU 301 ? OE1 ? A GLU 301 OE1 91 1 Y 1 A GLU 301 ? OE2 ? A GLU 301 OE2 92 1 Y 1 D LYS 3 ? CD ? B LYS 3 CD 93 1 Y 1 D LYS 3 ? CE ? B LYS 3 CE 94 1 Y 1 D LYS 3 ? NZ ? B LYS 3 NZ 95 1 Y 1 D ARG 5 ? NE ? B ARG 5 NE 96 1 Y 1 D ARG 5 ? CZ ? B ARG 5 CZ 97 1 Y 1 D ARG 5 ? NH1 ? B ARG 5 NH1 98 1 Y 1 D ARG 5 ? NH2 ? B ARG 5 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.7.1 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 1.02 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 1.02 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MxCuBE ? ? ? . 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7QB2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 97.785 _cell.length_a_esd ? _cell.length_b 97.785 _cell.length_b_esd ? _cell.length_c 80.188 _cell.length_c_esd ? _cell.volume 664025.096 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7QB2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall 'P 65' _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7QB2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.1 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.5 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM bis-tris propane (pH 7.0), 10% ethylene glycol, 0.3% DMSO, 20% PEG3350, 200 mM MgOAc' _exptl_crystal_grow.pdbx_pH_range '6.8 - 7.2' # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'Sagitally bended Si111-crystal' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-03-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 39.56 _reflns.entry_id 7QB2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.53 _reflns.d_resolution_low 48.893 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14667 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.08 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.0 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.53 _reflns_shell.d_res_low 2.68 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5.38 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2355 _reflns_shell.percent_possible_all 99.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 11.68 _reflns_shell.pdbx_Rsym_value 0.526 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.959 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 42.50 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7QB2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.53 _refine.ls_d_res_low 48.89 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14662 _refine.ls_number_reflns_R_free 734 _refine.ls_number_reflns_R_work 13928 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.85 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1593 _refine.ls_R_factor_R_free 0.2019 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1571 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5NDT _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.0239 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2101 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.53 _refine_hist.d_res_low 48.89 _refine_hist.number_atoms_solvent 87 _refine_hist.number_atoms_total 2314 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2199 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0072 ? 2285 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8045 ? 3096 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0537 ? 328 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0059 ? 420 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 19.8172 ? 1352 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.53 2.72 . . 145 2747 99.42 . . . 0.2462 . 0.1752 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.72 3.00 . . 146 2767 99.97 . . . 0.1965 . 0.1645 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.00 3.43 . . 146 2786 100.00 . . . 0.2191 . 0.1559 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.43 4.32 . . 147 2790 99.97 . . . 0.1729 . 0.1440 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.32 48.89 . . 150 2838 99.90 . . . 0.2081 . 0.1615 . . . . . . . . . . . # _struct.entry_id 7QB2 _struct.title 'Pim1 in complex with (E)-4-((6-amino-1-methyl-2-oxoindolin-3-ylidene)methyl)benzoic acid and Pimtide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7QB2 _struct_keywords.text ;SERINE KINASE, KINASE, COMPLEX, PIM1, PIM, PIM-1, INHIBITOR, TUMORIGENISIS, CANCER, PIMTIDE, PROTO ONCOGEN, ATP, PHOSPHORYLATION, APOPTOSIS, CELL CYCLE, TRANSFERASE ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PIM1_HUMAN P11309 ? 1 ;MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGEL PNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHN CGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS ; 1 2 PDB 7QB2 7QB2 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7QB2 A 1 ? 312 ? P11309 1 ? 312 ? 1 312 2 2 7QB2 D 1 ? 14 ? 7QB2 1 ? 14 ? 1 14 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7QB2 _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 250 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P11309 _struct_ref_seq_dif.db_mon_id ARG _struct_ref_seq_dif.pdbx_seq_db_seq_num 250 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 250 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1360 ? 1 MORE 3 ? 1 'SSA (A^2)' 12920 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 72 ? ILE A 74 ? ASP A 72 ILE A 74 5 ? 3 HELX_P HELX_P2 AA2 MET A 88 ? SER A 97 ? MET A 88 SER A 97 1 ? 10 HELX_P HELX_P3 AA3 LEU A 129 ? GLY A 137 ? LEU A 129 GLY A 137 1 ? 9 HELX_P HELX_P4 AA4 GLN A 140 ? CYS A 161 ? GLN A 140 CYS A 161 1 ? 22 HELX_P HELX_P5 AA5 LYS A 169 ? GLU A 171 ? LYS A 169 GLU A 171 5 ? 3 HELX_P HELX_P6 AA6 THR A 204 ? SER A 208 ? THR A 204 SER A 208 5 ? 5 HELX_P HELX_P7 AA7 PRO A 209 ? HIS A 216 ? PRO A 209 HIS A 216 1 ? 8 HELX_P HELX_P8 AA8 HIS A 219 ? GLY A 238 ? HIS A 219 GLY A 238 1 ? 20 HELX_P HELX_P9 AA9 HIS A 244 ? GLY A 251 ? HIS A 244 GLY A 251 1 ? 8 HELX_P HELX_P10 AB1 SER A 260 ? LEU A 271 ? SER A 260 LEU A 271 1 ? 12 HELX_P HELX_P11 AB2 ARG A 274 ? ARG A 278 ? ARG A 274 ARG A 278 5 ? 5 HELX_P HELX_P12 AB3 THR A 280 ? ASN A 286 ? THR A 280 ASN A 286 1 ? 7 HELX_P HELX_P13 AB4 HIS A 287 ? GLN A 291 ? HIS A 287 GLN A 291 5 ? 5 HELX_P HELX_P14 AB5 LEU A 295 ? LEU A 304 ? LEU A 295 LEU A 304 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A SER 260 C ? ? ? 1_555 A SEP 261 N ? ? A SER 260 A SEP 261 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? A SEP 261 C ? ? ? 1_555 A GLU 262 N ? ? A SEP 261 A GLU 262 1_555 ? ? ? ? ? ? ? 1.328 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id SEP _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 261 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id SEP _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 261 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id SER _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id SEP _pdbx_modification_feature.type Phosphorylation _pdbx_modification_feature.category 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 124 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 124 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 125 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 125 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.19 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 3 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 38 ? LEU A 43 ? TYR A 38 LEU A 43 AA1 2 SER A 51 ? ARG A 57 ? SER A 51 ARG A 57 AA1 3 PRO A 63 ? GLU A 70 ? PRO A 63 GLU A 70 AA1 4 SER A 115 ? GLU A 121 ? SER A 115 GLU A 121 AA1 5 LEU A 106 ? GLU A 111 ? LEU A 106 GLU A 111 AA2 1 TRP A 77 ? GLU A 79 ? TRP A 77 GLU A 79 AA2 2 ARG A 85 ? PRO A 87 ? ARG A 85 PRO A 87 AA3 1 VAL A 126 ? ASP A 128 ? VAL A 126 ASP A 128 AA3 2 ILE A 173 ? ASP A 176 ? ILE A 173 ASP A 176 AA3 3 GLU A 181 ? LEU A 184 ? GLU A 181 LEU A 184 AA4 1 VAL A 163 ? LEU A 164 ? VAL A 163 LEU A 164 AA4 2 ALA A 191 ? LEU A 192 ? ALA A 191 LEU A 192 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 41 ? N GLY A 41 O SER A 54 ? O SER A 54 AA1 2 3 N TYR A 53 ? N TYR A 53 O ILE A 66 ? O ILE A 66 AA1 3 4 N ALA A 65 ? N ALA A 65 O LEU A 120 ? O LEU A 120 AA1 4 5 O ILE A 119 ? O ILE A 119 N LEU A 107 ? N LEU A 107 AA2 1 2 N GLY A 78 ? N GLY A 78 O VAL A 86 ? O VAL A 86 AA3 1 2 N GLN A 127 ? N GLN A 127 O ILE A 175 ? O ILE A 175 AA3 2 3 N ASP A 176 ? N ASP A 176 O GLU A 181 ? O GLU A 181 AA4 1 2 N LEU A 164 ? N LEU A 164 O ALA A 191 ? O ALA A 191 # _pdbx_entry_details.entry_id 7QB2 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 34 ? ? -130.99 -59.84 2 1 PHE A 49 ? ? -75.61 25.62 3 1 ASP A 60 ? ? -147.57 21.40 4 1 ASN A 82 ? ? -67.63 7.89 5 1 SER A 98 ? ? 174.77 -179.63 6 1 ASP A 108 ? ? 178.73 164.28 7 1 ASP A 167 ? ? -140.07 43.99 8 1 ASP A 186 ? ? 53.43 82.50 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SEP _pdbx_struct_mod_residue.label_seq_id 261 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SEP _pdbx_struct_mod_residue.auth_seq_id 261 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details 'modified residue' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+5/6 3 y,-x+y,z+1/6 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 -x,-y,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -36.8303545303 3.23439589139 -2.19848002847 0.544861077235 ? 0.081257813476 ? 0.00240493050425 ? 0.327933380863 ? 0.0494431580933 ? 0.424703071986 ? 0.3899340995 ? 0.575903428941 ? 0.11641438261 ? 1.10536236449 ? 0.428638295424 ? 1.4367459478 ? -0.302962219862 ? -0.0754445142314 ? 0.152123438613 ? -0.535957883895 ? 0.311920554527 ? -0.114193285856 ? -0.612748379249 ? 0.255487101876 ? 0.0256666821291 ? 2 'X-RAY DIFFRACTION' ? refined -43.1139424613 -3.59311773917 2.88062262852 0.335085128523 ? 0.04150657116 ? 0.00626153280356 ? 0.242093502571 ? 0.0056093381777 ? 0.283442361847 ? 0.167446072355 ? 0.183417279647 ? 0.363632621736 ? 0.807002748885 ? 0.381030514069 ? 0.918885165261 ? 0.0476110931684 ? -0.0144369317641 ? 0.314509602997 ? 0.141759466481 ? 0.209828216027 ? 0.317320981436 ? -0.536157836605 ? -0.342304170503 ? 0.0405258278212 ? 3 'X-RAY DIFFRACTION' ? refined -39.080579739 -20.9246540694 6.80590625764 0.279513102312 ? 0.0219372303457 ? -0.0291101062731 ? 0.257410851398 ? 0.00243671849689 ? 0.277280187421 ? 0.834318102142 ? 0.0959034775249 ? -0.527178560269 ? 1.24406931079 ? 0.0230770577606 ? 2.25534331067 ? 0.0391127285014 ? 0.0197940467214 ? 0.00311396305971 ? 0.0879836388718 ? -0.0164157829317 ? -0.0598319588558 ? 0.206717517677 ? 0.00242252822874 ? -3.24615959097e-05 ? 4 'X-RAY DIFFRACTION' ? refined -35.7837519333 -11.0825483216 19.1579468576 0.47817402046 ? -0.0157455308812 ? -0.0104482071118 ? 0.402861455947 ? -0.097247440433 ? 0.403675421631 ? 0.0184144385456 ? 0.0114733886275 ? 0.0184031287019 ? 0.0121753374344 ? 0.0139484314012 ? 0.0149862664163 ? -0.095305930835 ? -0.254295414414 ? -0.0430957327346 ? 0.130594383702 ? 0.205815491809 ? -0.129215462363 ? -0.0516819885232 ? 0.247547809544 ? -0.000124019878686 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 33 through 96 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 97 through 140 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 141 through 305 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 2 through 9 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LEU 2 ? A LEU 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A ILE 6 ? A ILE 6 7 1 Y 1 A ASN 7 ? A ASN 7 8 1 Y 1 A SER 8 ? A SER 8 9 1 Y 1 A LEU 9 ? A LEU 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A HIS 11 ? A HIS 11 12 1 Y 1 A LEU 12 ? A LEU 12 13 1 Y 1 A ARG 13 ? A ARG 13 14 1 Y 1 A ALA 14 ? A ALA 14 15 1 Y 1 A ALA 15 ? A ALA 15 16 1 Y 1 A PRO 16 ? A PRO 16 17 1 Y 1 A CYS 17 ? A CYS 17 18 1 Y 1 A ASN 18 ? A ASN 18 19 1 Y 1 A ASP 19 ? A ASP 19 20 1 Y 1 A LEU 20 ? A LEU 20 21 1 Y 1 A HIS 21 ? A HIS 21 22 1 Y 1 A ALA 22 ? A ALA 22 23 1 Y 1 A THR 23 ? A THR 23 24 1 Y 1 A LYS 24 ? A LYS 24 25 1 Y 1 A LEU 25 ? A LEU 25 26 1 Y 1 A ALA 26 ? A ALA 26 27 1 Y 1 A PRO 27 ? A PRO 27 28 1 Y 1 A GLY 28 ? A GLY 28 29 1 Y 1 A LYS 29 ? A LYS 29 30 1 Y 1 A GLU 30 ? A GLU 30 31 1 Y 1 A LYS 31 ? A LYS 31 32 1 Y 1 A GLU 32 ? A GLU 32 33 1 Y 1 A SER 306 ? A SER 306 34 1 Y 1 A LEU 307 ? A LEU 307 35 1 Y 1 A SER 308 ? A SER 308 36 1 Y 1 A PRO 309 ? A PRO 309 37 1 Y 1 A GLY 310 ? A GLY 310 38 1 Y 1 A PRO 311 ? A PRO 311 39 1 Y 1 A SER 312 ? A SER 312 40 1 Y 1 D ALA 1 ? B ALA 1 41 1 Y 1 D GLY 10 ? B GLY 10 42 1 Y 1 D PRO 11 ? B PRO 11 43 1 Y 1 D PRO 12 ? B PRO 12 44 1 Y 1 D THR 13 ? B THR 13 45 1 Y 1 D ALA 14 ? B ALA 14 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A7X C10 C Y N 1 A7X C12 C Y N 2 A7X C15 C Y N 3 A7X C16 C Y N 4 A7X C14 C N N 5 A7X C13 C Y N 6 A7X N N N N 7 A7X C C N N 8 A7X O O N N 9 A7X C1 C N N 10 A7X C11 C Y N 11 A7X C2 C N N 12 A7X C3 C Y N 13 A7X C4 C Y N 14 A7X C5 C Y N 15 A7X C6 C Y N 16 A7X C7 C Y N 17 A7X C8 C Y N 18 A7X C9 C N N 19 A7X N1 N N N 20 A7X O1 O N N 21 A7X O2 O N N 22 A7X H1 H N N 23 A7X H2 H N N 24 A7X H3 H N N 25 A7X H4 H N N 26 A7X H5 H N N 27 A7X H6 H N N 28 A7X H7 H N N 29 A7X H8 H N N 30 A7X H9 H N N 31 A7X H10 H N N 32 A7X H11 H N N 33 A7X H12 H N N 34 A7X H13 H N N 35 A7X H14 H N N 36 ALA N N N N 37 ALA CA C N S 38 ALA C C N N 39 ALA O O N N 40 ALA CB C N N 41 ALA OXT O N N 42 ALA H H N N 43 ALA H2 H N N 44 ALA HA H N N 45 ALA HB1 H N N 46 ALA HB2 H N N 47 ALA HB3 H N N 48 ALA HXT H N N 49 ARG N N N N 50 ARG CA C N S 51 ARG C C N N 52 ARG O O N N 53 ARG CB C N N 54 ARG CG C N N 55 ARG CD C N N 56 ARG NE N N N 57 ARG CZ C N N 58 ARG NH1 N N N 59 ARG NH2 N N N 60 ARG OXT O N N 61 ARG H H N N 62 ARG H2 H N N 63 ARG HA H N N 64 ARG HB2 H N N 65 ARG HB3 H N N 66 ARG HG2 H N N 67 ARG HG3 H N N 68 ARG HD2 H N N 69 ARG HD3 H N N 70 ARG HE H N N 71 ARG HH11 H N N 72 ARG HH12 H N N 73 ARG HH21 H N N 74 ARG HH22 H N N 75 ARG HXT H N N 76 ASN N N N N 77 ASN CA C N S 78 ASN C C N N 79 ASN O O N N 80 ASN CB C N N 81 ASN CG C N N 82 ASN OD1 O N N 83 ASN ND2 N N N 84 ASN OXT O N N 85 ASN H H N N 86 ASN H2 H N N 87 ASN HA H N N 88 ASN HB2 H N N 89 ASN HB3 H N N 90 ASN HD21 H N N 91 ASN HD22 H N N 92 ASN HXT H N N 93 ASP N N N N 94 ASP CA C N S 95 ASP C C N N 96 ASP O O N N 97 ASP CB C N N 98 ASP CG C N N 99 ASP OD1 O N N 100 ASP OD2 O N N 101 ASP OXT O N N 102 ASP H H N N 103 ASP H2 H N N 104 ASP HA H N N 105 ASP HB2 H N N 106 ASP HB3 H N N 107 ASP HD2 H N N 108 ASP HXT H N N 109 CYS N N N N 110 CYS CA C N R 111 CYS C C N N 112 CYS O O N N 113 CYS CB C N N 114 CYS SG S N N 115 CYS OXT O N N 116 CYS H H N N 117 CYS H2 H N N 118 CYS HA H N N 119 CYS HB2 H N N 120 CYS HB3 H N N 121 CYS HG H N N 122 CYS HXT H N N 123 GLN N N N N 124 GLN CA C N S 125 GLN C C N N 126 GLN O O N N 127 GLN CB C N N 128 GLN CG C N N 129 GLN CD C N N 130 GLN OE1 O N N 131 GLN NE2 N N N 132 GLN OXT O N N 133 GLN H H N N 134 GLN H2 H N N 135 GLN HA H N N 136 GLN HB2 H N N 137 GLN HB3 H N N 138 GLN HG2 H N N 139 GLN HG3 H N N 140 GLN HE21 H N N 141 GLN HE22 H N N 142 GLN HXT H N N 143 GLU N N N N 144 GLU CA C N S 145 GLU C C N N 146 GLU O O N N 147 GLU CB C N N 148 GLU CG C N N 149 GLU CD C N N 150 GLU OE1 O N N 151 GLU OE2 O N N 152 GLU OXT O N N 153 GLU H H N N 154 GLU H2 H N N 155 GLU HA H N N 156 GLU HB2 H N N 157 GLU HB3 H N N 158 GLU HG2 H N N 159 GLU HG3 H N N 160 GLU HE2 H N N 161 GLU HXT H N N 162 GLY N N N N 163 GLY CA C N N 164 GLY C C N N 165 GLY O O N N 166 GLY OXT O N N 167 GLY H H N N 168 GLY H2 H N N 169 GLY HA2 H N N 170 GLY HA3 H N N 171 GLY HXT H N N 172 GOL C1 C N N 173 GOL O1 O N N 174 GOL C2 C N N 175 GOL O2 O N N 176 GOL C3 C N N 177 GOL O3 O N N 178 GOL H11 H N N 179 GOL H12 H N N 180 GOL HO1 H N N 181 GOL H2 H N N 182 GOL HO2 H N N 183 GOL H31 H N N 184 GOL H32 H N N 185 GOL HO3 H N N 186 HIS N N N N 187 HIS CA C N S 188 HIS C C N N 189 HIS O O N N 190 HIS CB C N N 191 HIS CG C Y N 192 HIS ND1 N Y N 193 HIS CD2 C Y N 194 HIS CE1 C Y N 195 HIS NE2 N Y N 196 HIS OXT O N N 197 HIS H H N N 198 HIS H2 H N N 199 HIS HA H N N 200 HIS HB2 H N N 201 HIS HB3 H N N 202 HIS HD1 H N N 203 HIS HD2 H N N 204 HIS HE1 H N N 205 HIS HE2 H N N 206 HIS HXT H N N 207 HOH O O N N 208 HOH H1 H N N 209 HOH H2 H N N 210 ILE N N N N 211 ILE CA C N S 212 ILE C C N N 213 ILE O O N N 214 ILE CB C N S 215 ILE CG1 C N N 216 ILE CG2 C N N 217 ILE CD1 C N N 218 ILE OXT O N N 219 ILE H H N N 220 ILE H2 H N N 221 ILE HA H N N 222 ILE HB H N N 223 ILE HG12 H N N 224 ILE HG13 H N N 225 ILE HG21 H N N 226 ILE HG22 H N N 227 ILE HG23 H N N 228 ILE HD11 H N N 229 ILE HD12 H N N 230 ILE HD13 H N N 231 ILE HXT H N N 232 LEU N N N N 233 LEU CA C N S 234 LEU C C N N 235 LEU O O N N 236 LEU CB C N N 237 LEU CG C N N 238 LEU CD1 C N N 239 LEU CD2 C N N 240 LEU OXT O N N 241 LEU H H N N 242 LEU H2 H N N 243 LEU HA H N N 244 LEU HB2 H N N 245 LEU HB3 H N N 246 LEU HG H N N 247 LEU HD11 H N N 248 LEU HD12 H N N 249 LEU HD13 H N N 250 LEU HD21 H N N 251 LEU HD22 H N N 252 LEU HD23 H N N 253 LEU HXT H N N 254 LYS N N N N 255 LYS CA C N S 256 LYS C C N N 257 LYS O O N N 258 LYS CB C N N 259 LYS CG C N N 260 LYS CD C N N 261 LYS CE C N N 262 LYS NZ N N N 263 LYS OXT O N N 264 LYS H H N N 265 LYS H2 H N N 266 LYS HA H N N 267 LYS HB2 H N N 268 LYS HB3 H N N 269 LYS HG2 H N N 270 LYS HG3 H N N 271 LYS HD2 H N N 272 LYS HD3 H N N 273 LYS HE2 H N N 274 LYS HE3 H N N 275 LYS HZ1 H N N 276 LYS HZ2 H N N 277 LYS HZ3 H N N 278 LYS HXT H N N 279 MET N N N N 280 MET CA C N S 281 MET C C N N 282 MET O O N N 283 MET CB C N N 284 MET CG C N N 285 MET SD S N N 286 MET CE C N N 287 MET OXT O N N 288 MET H H N N 289 MET H2 H N N 290 MET HA H N N 291 MET HB2 H N N 292 MET HB3 H N N 293 MET HG2 H N N 294 MET HG3 H N N 295 MET HE1 H N N 296 MET HE2 H N N 297 MET HE3 H N N 298 MET HXT H N N 299 PHE N N N N 300 PHE CA C N S 301 PHE C C N N 302 PHE O O N N 303 PHE CB C N N 304 PHE CG C Y N 305 PHE CD1 C Y N 306 PHE CD2 C Y N 307 PHE CE1 C Y N 308 PHE CE2 C Y N 309 PHE CZ C Y N 310 PHE OXT O N N 311 PHE H H N N 312 PHE H2 H N N 313 PHE HA H N N 314 PHE HB2 H N N 315 PHE HB3 H N N 316 PHE HD1 H N N 317 PHE HD2 H N N 318 PHE HE1 H N N 319 PHE HE2 H N N 320 PHE HZ H N N 321 PHE HXT H N N 322 PRO N N N N 323 PRO CA C N S 324 PRO C C N N 325 PRO O O N N 326 PRO CB C N N 327 PRO CG C N N 328 PRO CD C N N 329 PRO OXT O N N 330 PRO H H N N 331 PRO HA H N N 332 PRO HB2 H N N 333 PRO HB3 H N N 334 PRO HG2 H N N 335 PRO HG3 H N N 336 PRO HD2 H N N 337 PRO HD3 H N N 338 PRO HXT H N N 339 SEP N N N N 340 SEP CA C N S 341 SEP CB C N N 342 SEP OG O N N 343 SEP C C N N 344 SEP O O N N 345 SEP OXT O N N 346 SEP P P N N 347 SEP O1P O N N 348 SEP O2P O N N 349 SEP O3P O N N 350 SEP H H N N 351 SEP H2 H N N 352 SEP HA H N N 353 SEP HB2 H N N 354 SEP HB3 H N N 355 SEP HXT H N N 356 SEP HOP2 H N N 357 SEP HOP3 H N N 358 SER N N N N 359 SER CA C N S 360 SER C C N N 361 SER O O N N 362 SER CB C N N 363 SER OG O N N 364 SER OXT O N N 365 SER H H N N 366 SER H2 H N N 367 SER HA H N N 368 SER HB2 H N N 369 SER HB3 H N N 370 SER HG H N N 371 SER HXT H N N 372 THR N N N N 373 THR CA C N S 374 THR C C N N 375 THR O O N N 376 THR CB C N R 377 THR OG1 O N N 378 THR CG2 C N N 379 THR OXT O N N 380 THR H H N N 381 THR H2 H N N 382 THR HA H N N 383 THR HB H N N 384 THR HG1 H N N 385 THR HG21 H N N 386 THR HG22 H N N 387 THR HG23 H N N 388 THR HXT H N N 389 TRP N N N N 390 TRP CA C N S 391 TRP C C N N 392 TRP O O N N 393 TRP CB C N N 394 TRP CG C Y N 395 TRP CD1 C Y N 396 TRP CD2 C Y N 397 TRP NE1 N Y N 398 TRP CE2 C Y N 399 TRP CE3 C Y N 400 TRP CZ2 C Y N 401 TRP CZ3 C Y N 402 TRP CH2 C Y N 403 TRP OXT O N N 404 TRP H H N N 405 TRP H2 H N N 406 TRP HA H N N 407 TRP HB2 H N N 408 TRP HB3 H N N 409 TRP HD1 H N N 410 TRP HE1 H N N 411 TRP HE3 H N N 412 TRP HZ2 H N N 413 TRP HZ3 H N N 414 TRP HH2 H N N 415 TRP HXT H N N 416 TYR N N N N 417 TYR CA C N S 418 TYR C C N N 419 TYR O O N N 420 TYR CB C N N 421 TYR CG C Y N 422 TYR CD1 C Y N 423 TYR CD2 C Y N 424 TYR CE1 C Y N 425 TYR CE2 C Y N 426 TYR CZ C Y N 427 TYR OH O N N 428 TYR OXT O N N 429 TYR H H N N 430 TYR H2 H N N 431 TYR HA H N N 432 TYR HB2 H N N 433 TYR HB3 H N N 434 TYR HD1 H N N 435 TYR HD2 H N N 436 TYR HE1 H N N 437 TYR HE2 H N N 438 TYR HH H N N 439 TYR HXT H N N 440 VAL N N N N 441 VAL CA C N S 442 VAL C C N N 443 VAL O O N N 444 VAL CB C N N 445 VAL CG1 C N N 446 VAL CG2 C N N 447 VAL OXT O N N 448 VAL H H N N 449 VAL H2 H N N 450 VAL HA H N N 451 VAL HB H N N 452 VAL HG11 H N N 453 VAL HG12 H N N 454 VAL HG13 H N N 455 VAL HG21 H N N 456 VAL HG22 H N N 457 VAL HG23 H N N 458 VAL HXT H N N 459 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A7X O1 C14 doub N N 1 A7X C12 C11 doub Y N 2 A7X C12 C13 sing Y N 3 A7X C14 O2 sing N N 4 A7X C14 C13 sing N N 5 A7X C11 C10 sing Y N 6 A7X C13 C15 doub Y N 7 A7X C10 C9 sing N N 8 A7X C10 C16 doub Y N 9 A7X C15 C16 sing Y N 10 A7X C9 C2 doub N E 11 A7X O C doub N N 12 A7X C2 C sing N N 13 A7X C2 C3 sing N N 14 A7X C N sing N N 15 A7X C3 C8 doub Y N 16 A7X C3 C4 sing Y N 17 A7X C8 C7 sing Y N 18 A7X N C4 sing N N 19 A7X N C1 sing N N 20 A7X C4 C5 doub Y N 21 A7X C7 C6 doub Y N 22 A7X C5 C6 sing Y N 23 A7X C6 N1 sing N N 24 A7X C12 H1 sing N N 25 A7X C15 H2 sing N N 26 A7X C16 H3 sing N N 27 A7X C1 H4 sing N N 28 A7X C1 H5 sing N N 29 A7X C1 H6 sing N N 30 A7X C11 H7 sing N N 31 A7X C5 H8 sing N N 32 A7X C7 H9 sing N N 33 A7X C8 H10 sing N N 34 A7X C9 H11 sing N N 35 A7X N1 H12 sing N N 36 A7X N1 H13 sing N N 37 A7X O2 H14 sing N N 38 ALA N CA sing N N 39 ALA N H sing N N 40 ALA N H2 sing N N 41 ALA CA C sing N N 42 ALA CA CB sing N N 43 ALA CA HA sing N N 44 ALA C O doub N N 45 ALA C OXT sing N N 46 ALA CB HB1 sing N N 47 ALA CB HB2 sing N N 48 ALA CB HB3 sing N N 49 ALA OXT HXT sing N N 50 ARG N CA sing N N 51 ARG N H sing N N 52 ARG N H2 sing N N 53 ARG CA C sing N N 54 ARG CA CB sing N N 55 ARG CA HA sing N N 56 ARG C O doub N N 57 ARG C OXT sing N N 58 ARG CB CG sing N N 59 ARG CB HB2 sing N N 60 ARG CB HB3 sing N N 61 ARG CG CD sing N N 62 ARG CG HG2 sing N N 63 ARG CG HG3 sing N N 64 ARG CD NE sing N N 65 ARG CD HD2 sing N N 66 ARG CD HD3 sing N N 67 ARG NE CZ sing N N 68 ARG NE HE sing N N 69 ARG CZ NH1 sing N N 70 ARG CZ NH2 doub N N 71 ARG NH1 HH11 sing N N 72 ARG NH1 HH12 sing N N 73 ARG NH2 HH21 sing N N 74 ARG NH2 HH22 sing N N 75 ARG OXT HXT sing N N 76 ASN N CA sing N N 77 ASN N H sing N N 78 ASN N H2 sing N N 79 ASN CA C sing N N 80 ASN CA CB sing N N 81 ASN CA HA sing N N 82 ASN C O doub N N 83 ASN C OXT sing N N 84 ASN CB CG sing N N 85 ASN CB HB2 sing N N 86 ASN CB HB3 sing N N 87 ASN CG OD1 doub N N 88 ASN CG ND2 sing N N 89 ASN ND2 HD21 sing N N 90 ASN ND2 HD22 sing N N 91 ASN OXT HXT sing N N 92 ASP N CA sing N N 93 ASP N H sing N N 94 ASP N H2 sing N N 95 ASP CA C sing N N 96 ASP CA CB sing N N 97 ASP CA HA sing N N 98 ASP C O doub N N 99 ASP C OXT sing N N 100 ASP CB CG sing N N 101 ASP CB HB2 sing N N 102 ASP CB HB3 sing N N 103 ASP CG OD1 doub N N 104 ASP CG OD2 sing N N 105 ASP OD2 HD2 sing N N 106 ASP OXT HXT sing N N 107 CYS N CA sing N N 108 CYS N H sing N N 109 CYS N H2 sing N N 110 CYS CA C sing N N 111 CYS CA CB sing N N 112 CYS CA HA sing N N 113 CYS C O doub N N 114 CYS C OXT sing N N 115 CYS CB SG sing N N 116 CYS CB HB2 sing N N 117 CYS CB HB3 sing N N 118 CYS SG HG sing N N 119 CYS OXT HXT sing N N 120 GLN N CA sing N N 121 GLN N H sing N N 122 GLN N H2 sing N N 123 GLN CA C sing N N 124 GLN CA CB sing N N 125 GLN CA HA sing N N 126 GLN C O doub N N 127 GLN C OXT sing N N 128 GLN CB CG sing N N 129 GLN CB HB2 sing N N 130 GLN CB HB3 sing N N 131 GLN CG CD sing N N 132 GLN CG HG2 sing N N 133 GLN CG HG3 sing N N 134 GLN CD OE1 doub N N 135 GLN CD NE2 sing N N 136 GLN NE2 HE21 sing N N 137 GLN NE2 HE22 sing N N 138 GLN OXT HXT sing N N 139 GLU N CA sing N N 140 GLU N H sing N N 141 GLU N H2 sing N N 142 GLU CA C sing N N 143 GLU CA CB sing N N 144 GLU CA HA sing N N 145 GLU C O doub N N 146 GLU C OXT sing N N 147 GLU CB CG sing N N 148 GLU CB HB2 sing N N 149 GLU CB HB3 sing N N 150 GLU CG CD sing N N 151 GLU CG HG2 sing N N 152 GLU CG HG3 sing N N 153 GLU CD OE1 doub N N 154 GLU CD OE2 sing N N 155 GLU OE2 HE2 sing N N 156 GLU OXT HXT sing N N 157 GLY N CA sing N N 158 GLY N H sing N N 159 GLY N H2 sing N N 160 GLY CA C sing N N 161 GLY CA HA2 sing N N 162 GLY CA HA3 sing N N 163 GLY C O doub N N 164 GLY C OXT sing N N 165 GLY OXT HXT sing N N 166 GOL C1 O1 sing N N 167 GOL C1 C2 sing N N 168 GOL C1 H11 sing N N 169 GOL C1 H12 sing N N 170 GOL O1 HO1 sing N N 171 GOL C2 O2 sing N N 172 GOL C2 C3 sing N N 173 GOL C2 H2 sing N N 174 GOL O2 HO2 sing N N 175 GOL C3 O3 sing N N 176 GOL C3 H31 sing N N 177 GOL C3 H32 sing N N 178 GOL O3 HO3 sing N N 179 HIS N CA sing N N 180 HIS N H sing N N 181 HIS N H2 sing N N 182 HIS CA C sing N N 183 HIS CA CB sing N N 184 HIS CA HA sing N N 185 HIS C O doub N N 186 HIS C OXT sing N N 187 HIS CB CG sing N N 188 HIS CB HB2 sing N N 189 HIS CB HB3 sing N N 190 HIS CG ND1 sing Y N 191 HIS CG CD2 doub Y N 192 HIS ND1 CE1 doub Y N 193 HIS ND1 HD1 sing N N 194 HIS CD2 NE2 sing Y N 195 HIS CD2 HD2 sing N N 196 HIS CE1 NE2 sing Y N 197 HIS CE1 HE1 sing N N 198 HIS NE2 HE2 sing N N 199 HIS OXT HXT sing N N 200 HOH O H1 sing N N 201 HOH O H2 sing N N 202 ILE N CA sing N N 203 ILE N H sing N N 204 ILE N H2 sing N N 205 ILE CA C sing N N 206 ILE CA CB sing N N 207 ILE CA HA sing N N 208 ILE C O doub N N 209 ILE C OXT sing N N 210 ILE CB CG1 sing N N 211 ILE CB CG2 sing N N 212 ILE CB HB sing N N 213 ILE CG1 CD1 sing N N 214 ILE CG1 HG12 sing N N 215 ILE CG1 HG13 sing N N 216 ILE CG2 HG21 sing N N 217 ILE CG2 HG22 sing N N 218 ILE CG2 HG23 sing N N 219 ILE CD1 HD11 sing N N 220 ILE CD1 HD12 sing N N 221 ILE CD1 HD13 sing N N 222 ILE OXT HXT sing N N 223 LEU N CA sing N N 224 LEU N H sing N N 225 LEU N H2 sing N N 226 LEU CA C sing N N 227 LEU CA CB sing N N 228 LEU CA HA sing N N 229 LEU C O doub N N 230 LEU C OXT sing N N 231 LEU CB CG sing N N 232 LEU CB HB2 sing N N 233 LEU CB HB3 sing N N 234 LEU CG CD1 sing N N 235 LEU CG CD2 sing N N 236 LEU CG HG sing N N 237 LEU CD1 HD11 sing N N 238 LEU CD1 HD12 sing N N 239 LEU CD1 HD13 sing N N 240 LEU CD2 HD21 sing N N 241 LEU CD2 HD22 sing N N 242 LEU CD2 HD23 sing N N 243 LEU OXT HXT sing N N 244 LYS N CA sing N N 245 LYS N H sing N N 246 LYS N H2 sing N N 247 LYS CA C sing N N 248 LYS CA CB sing N N 249 LYS CA HA sing N N 250 LYS C O doub N N 251 LYS C OXT sing N N 252 LYS CB CG sing N N 253 LYS CB HB2 sing N N 254 LYS CB HB3 sing N N 255 LYS CG CD sing N N 256 LYS CG HG2 sing N N 257 LYS CG HG3 sing N N 258 LYS CD CE sing N N 259 LYS CD HD2 sing N N 260 LYS CD HD3 sing N N 261 LYS CE NZ sing N N 262 LYS CE HE2 sing N N 263 LYS CE HE3 sing N N 264 LYS NZ HZ1 sing N N 265 LYS NZ HZ2 sing N N 266 LYS NZ HZ3 sing N N 267 LYS OXT HXT sing N N 268 MET N CA sing N N 269 MET N H sing N N 270 MET N H2 sing N N 271 MET CA C sing N N 272 MET CA CB sing N N 273 MET CA HA sing N N 274 MET C O doub N N 275 MET C OXT sing N N 276 MET CB CG sing N N 277 MET CB HB2 sing N N 278 MET CB HB3 sing N N 279 MET CG SD sing N N 280 MET CG HG2 sing N N 281 MET CG HG3 sing N N 282 MET SD CE sing N N 283 MET CE HE1 sing N N 284 MET CE HE2 sing N N 285 MET CE HE3 sing N N 286 MET OXT HXT sing N N 287 PHE N CA sing N N 288 PHE N H sing N N 289 PHE N H2 sing N N 290 PHE CA C sing N N 291 PHE CA CB sing N N 292 PHE CA HA sing N N 293 PHE C O doub N N 294 PHE C OXT sing N N 295 PHE CB CG sing N N 296 PHE CB HB2 sing N N 297 PHE CB HB3 sing N N 298 PHE CG CD1 doub Y N 299 PHE CG CD2 sing Y N 300 PHE CD1 CE1 sing Y N 301 PHE CD1 HD1 sing N N 302 PHE CD2 CE2 doub Y N 303 PHE CD2 HD2 sing N N 304 PHE CE1 CZ doub Y N 305 PHE CE1 HE1 sing N N 306 PHE CE2 CZ sing Y N 307 PHE CE2 HE2 sing N N 308 PHE CZ HZ sing N N 309 PHE OXT HXT sing N N 310 PRO N CA sing N N 311 PRO N CD sing N N 312 PRO N H sing N N 313 PRO CA C sing N N 314 PRO CA CB sing N N 315 PRO CA HA sing N N 316 PRO C O doub N N 317 PRO C OXT sing N N 318 PRO CB CG sing N N 319 PRO CB HB2 sing N N 320 PRO CB HB3 sing N N 321 PRO CG CD sing N N 322 PRO CG HG2 sing N N 323 PRO CG HG3 sing N N 324 PRO CD HD2 sing N N 325 PRO CD HD3 sing N N 326 PRO OXT HXT sing N N 327 SEP N CA sing N N 328 SEP N H sing N N 329 SEP N H2 sing N N 330 SEP CA CB sing N N 331 SEP CA C sing N N 332 SEP CA HA sing N N 333 SEP CB OG sing N N 334 SEP CB HB2 sing N N 335 SEP CB HB3 sing N N 336 SEP OG P sing N N 337 SEP C O doub N N 338 SEP C OXT sing N N 339 SEP OXT HXT sing N N 340 SEP P O1P doub N N 341 SEP P O2P sing N N 342 SEP P O3P sing N N 343 SEP O2P HOP2 sing N N 344 SEP O3P HOP3 sing N N 345 SER N CA sing N N 346 SER N H sing N N 347 SER N H2 sing N N 348 SER CA C sing N N 349 SER CA CB sing N N 350 SER CA HA sing N N 351 SER C O doub N N 352 SER C OXT sing N N 353 SER CB OG sing N N 354 SER CB HB2 sing N N 355 SER CB HB3 sing N N 356 SER OG HG sing N N 357 SER OXT HXT sing N N 358 THR N CA sing N N 359 THR N H sing N N 360 THR N H2 sing N N 361 THR CA C sing N N 362 THR CA CB sing N N 363 THR CA HA sing N N 364 THR C O doub N N 365 THR C OXT sing N N 366 THR CB OG1 sing N N 367 THR CB CG2 sing N N 368 THR CB HB sing N N 369 THR OG1 HG1 sing N N 370 THR CG2 HG21 sing N N 371 THR CG2 HG22 sing N N 372 THR CG2 HG23 sing N N 373 THR OXT HXT sing N N 374 TRP N CA sing N N 375 TRP N H sing N N 376 TRP N H2 sing N N 377 TRP CA C sing N N 378 TRP CA CB sing N N 379 TRP CA HA sing N N 380 TRP C O doub N N 381 TRP C OXT sing N N 382 TRP CB CG sing N N 383 TRP CB HB2 sing N N 384 TRP CB HB3 sing N N 385 TRP CG CD1 doub Y N 386 TRP CG CD2 sing Y N 387 TRP CD1 NE1 sing Y N 388 TRP CD1 HD1 sing N N 389 TRP CD2 CE2 doub Y N 390 TRP CD2 CE3 sing Y N 391 TRP NE1 CE2 sing Y N 392 TRP NE1 HE1 sing N N 393 TRP CE2 CZ2 sing Y N 394 TRP CE3 CZ3 doub Y N 395 TRP CE3 HE3 sing N N 396 TRP CZ2 CH2 doub Y N 397 TRP CZ2 HZ2 sing N N 398 TRP CZ3 CH2 sing Y N 399 TRP CZ3 HZ3 sing N N 400 TRP CH2 HH2 sing N N 401 TRP OXT HXT sing N N 402 TYR N CA sing N N 403 TYR N H sing N N 404 TYR N H2 sing N N 405 TYR CA C sing N N 406 TYR CA CB sing N N 407 TYR CA HA sing N N 408 TYR C O doub N N 409 TYR C OXT sing N N 410 TYR CB CG sing N N 411 TYR CB HB2 sing N N 412 TYR CB HB3 sing N N 413 TYR CG CD1 doub Y N 414 TYR CG CD2 sing Y N 415 TYR CD1 CE1 sing Y N 416 TYR CD1 HD1 sing N N 417 TYR CD2 CE2 doub Y N 418 TYR CD2 HD2 sing N N 419 TYR CE1 CZ doub Y N 420 TYR CE1 HE1 sing N N 421 TYR CE2 CZ sing Y N 422 TYR CE2 HE2 sing N N 423 TYR CZ OH sing N N 424 TYR OH HH sing N N 425 TYR OXT HXT sing N N 426 VAL N CA sing N N 427 VAL N H sing N N 428 VAL N H2 sing N N 429 VAL CA C sing N N 430 VAL CA CB sing N N 431 VAL CA HA sing N N 432 VAL C O doub N N 433 VAL C OXT sing N N 434 VAL CB CG1 sing N N 435 VAL CB CG2 sing N N 436 VAL CB HB sing N N 437 VAL CG1 HG11 sing N N 438 VAL CG1 HG12 sing N N 439 VAL CG1 HG13 sing N N 440 VAL CG2 HG21 sing N N 441 VAL CG2 HG22 sing N N 442 VAL CG2 HG23 sing N N 443 VAL OXT HXT sing N N 444 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5NDT _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 65' _space_group.name_Hall 'P 65' _space_group.IT_number 170 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 7QB2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010227 _atom_sites.fract_transf_matrix[1][2] 0.005904 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011809 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012471 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_