data_7QCB # _entry.id 7QCB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7QCB pdb_00007qcb 10.2210/pdb7qcb/pdb WWPDB D_1292119285 ? ? BMRB 27417 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Williams-Beuren syndrome related methyltransferase WBSCR27 in complex with SAH' _pdbx_database_related.db_id 27417 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7QCB _pdbx_database_status.recvd_initial_deposition_date 2021-11-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Polshakov, V.I.' 1 0000-0002-3216-5737 'Mariasina, S.S.' 2 0000-0002-9190-1298 'Chang, C.-F.' 3 0000-0002-2961-0748 'Efimov, S.V.' 4 0000-0002-9918-8124 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Front Mol Biosci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2296-889X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 865743 _citation.page_last 865743 _citation.title 'Williams-Beuren Syndrome Related Methyltransferase WBSCR27: From Structure to Possible Function.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3389/fmolb.2022.865743 _citation.pdbx_database_id_PubMed 35782865 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mariasina, S.S.' 1 ? primary 'Chang, C.F.' 2 ? primary 'Navalayeu, T.L.' 3 ? primary 'Chugunova, A.A.' 4 ? primary 'Efimov, S.V.' 5 ? primary 'Zgoda, V.G.' 6 ? primary 'Ivlev, V.A.' 7 ? primary 'Dontsova, O.A.' 8 ? primary 'Sergiev, P.V.' 9 ? primary 'Polshakov, V.I.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Methyltransferase-like 27' 25988.480 1 ? ? ? ? 2 non-polymer syn S-ADENOSYL-L-HOMOCYSTEINE 384.411 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Williams-Beuren syndrome critical region protein 27,Williams-Beuren syndrome critical region protein 27 isoform alpha,Williams-Beuren syndrome critical region protein 27 isoform beta ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMAQEEAGRLPQVLARVGTSHGITDLACKLRFYDDWAPEYDQDVAALKYRAPRLAVDCLSRAFRGSPHDALILDVACGT GLVAVELQARGFLQVQGVDGSPEMLKQARARGLYHHLSLCTLGQEPLPDPEGTFDAVIIVGALSEGQVPCSAIPELLRVT KPGGLVCLTTRTNPSNLPYKETLEATLDSLERAGVWECLVTQPVDHWELATSEQETGLGTCANDGFISGIIYLYRKQETV ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMAQEEAGRLPQVLARVGTSHGITDLACKLRFYDDWAPEYDQDVAALKYRAPRLAVDCLSRAFRGSPHDALILDVACGT GLVAVELQARGFLQVQGVDGSPEMLKQARARGLYHHLSLCTLGQEPLPDPEGTFDAVIIVGALSEGQVPCSAIPELLRVT KPGGLVCLTTRTNPSNLPYKETLEATLDSLERAGVWECLVTQPVDHWELATSEQETGLGTCANDGFISGIIYLYRKQETV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 ALA n 1 5 GLN n 1 6 GLU n 1 7 GLU n 1 8 ALA n 1 9 GLY n 1 10 ARG n 1 11 LEU n 1 12 PRO n 1 13 GLN n 1 14 VAL n 1 15 LEU n 1 16 ALA n 1 17 ARG n 1 18 VAL n 1 19 GLY n 1 20 THR n 1 21 SER n 1 22 HIS n 1 23 GLY n 1 24 ILE n 1 25 THR n 1 26 ASP n 1 27 LEU n 1 28 ALA n 1 29 CYS n 1 30 LYS n 1 31 LEU n 1 32 ARG n 1 33 PHE n 1 34 TYR n 1 35 ASP n 1 36 ASP n 1 37 TRP n 1 38 ALA n 1 39 PRO n 1 40 GLU n 1 41 TYR n 1 42 ASP n 1 43 GLN n 1 44 ASP n 1 45 VAL n 1 46 ALA n 1 47 ALA n 1 48 LEU n 1 49 LYS n 1 50 TYR n 1 51 ARG n 1 52 ALA n 1 53 PRO n 1 54 ARG n 1 55 LEU n 1 56 ALA n 1 57 VAL n 1 58 ASP n 1 59 CYS n 1 60 LEU n 1 61 SER n 1 62 ARG n 1 63 ALA n 1 64 PHE n 1 65 ARG n 1 66 GLY n 1 67 SER n 1 68 PRO n 1 69 HIS n 1 70 ASP n 1 71 ALA n 1 72 LEU n 1 73 ILE n 1 74 LEU n 1 75 ASP n 1 76 VAL n 1 77 ALA n 1 78 CYS n 1 79 GLY n 1 80 THR n 1 81 GLY n 1 82 LEU n 1 83 VAL n 1 84 ALA n 1 85 VAL n 1 86 GLU n 1 87 LEU n 1 88 GLN n 1 89 ALA n 1 90 ARG n 1 91 GLY n 1 92 PHE n 1 93 LEU n 1 94 GLN n 1 95 VAL n 1 96 GLN n 1 97 GLY n 1 98 VAL n 1 99 ASP n 1 100 GLY n 1 101 SER n 1 102 PRO n 1 103 GLU n 1 104 MET n 1 105 LEU n 1 106 LYS n 1 107 GLN n 1 108 ALA n 1 109 ARG n 1 110 ALA n 1 111 ARG n 1 112 GLY n 1 113 LEU n 1 114 TYR n 1 115 HIS n 1 116 HIS n 1 117 LEU n 1 118 SER n 1 119 LEU n 1 120 CYS n 1 121 THR n 1 122 LEU n 1 123 GLY n 1 124 GLN n 1 125 GLU n 1 126 PRO n 1 127 LEU n 1 128 PRO n 1 129 ASP n 1 130 PRO n 1 131 GLU n 1 132 GLY n 1 133 THR n 1 134 PHE n 1 135 ASP n 1 136 ALA n 1 137 VAL n 1 138 ILE n 1 139 ILE n 1 140 VAL n 1 141 GLY n 1 142 ALA n 1 143 LEU n 1 144 SER n 1 145 GLU n 1 146 GLY n 1 147 GLN n 1 148 VAL n 1 149 PRO n 1 150 CYS n 1 151 SER n 1 152 ALA n 1 153 ILE n 1 154 PRO n 1 155 GLU n 1 156 LEU n 1 157 LEU n 1 158 ARG n 1 159 VAL n 1 160 THR n 1 161 LYS n 1 162 PRO n 1 163 GLY n 1 164 GLY n 1 165 LEU n 1 166 VAL n 1 167 CYS n 1 168 LEU n 1 169 THR n 1 170 THR n 1 171 ARG n 1 172 THR n 1 173 ASN n 1 174 PRO n 1 175 SER n 1 176 ASN n 1 177 LEU n 1 178 PRO n 1 179 TYR n 1 180 LYS n 1 181 GLU n 1 182 THR n 1 183 LEU n 1 184 GLU n 1 185 ALA n 1 186 THR n 1 187 LEU n 1 188 ASP n 1 189 SER n 1 190 LEU n 1 191 GLU n 1 192 ARG n 1 193 ALA n 1 194 GLY n 1 195 VAL n 1 196 TRP n 1 197 GLU n 1 198 CYS n 1 199 LEU n 1 200 VAL n 1 201 THR n 1 202 GLN n 1 203 PRO n 1 204 VAL n 1 205 ASP n 1 206 HIS n 1 207 TRP n 1 208 GLU n 1 209 LEU n 1 210 ALA n 1 211 THR n 1 212 SER n 1 213 GLU n 1 214 GLN n 1 215 GLU n 1 216 THR n 1 217 GLY n 1 218 LEU n 1 219 GLY n 1 220 THR n 1 221 CYS n 1 222 ALA n 1 223 ASN n 1 224 ASP n 1 225 GLY n 1 226 PHE n 1 227 ILE n 1 228 SER n 1 229 GLY n 1 230 ILE n 1 231 ILE n 1 232 TYR n 1 233 LEU n 1 234 TYR n 1 235 ARG n 1 236 LYS n 1 237 GLN n 1 238 GLU n 1 239 THR n 1 240 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 240 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Mettl27, BC002286, Wbscr27' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pET30aTEV _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET30aTEV-WBSCR27 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8BGM4_MOUSE _struct_ref.pdbx_db_accession Q8BGM4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QEEAGRLPQVLARVGTSHGITDLACKLRFYDDWAPEYDQDVAALKYRAPRLAVDCLSRAFRGSPHDALILDVACGTGLVA VELQARGFLQVQGVDGSPEMLKQARARGLYHHLSLCTLGQEPLPDPEGTFDAVIIVGALSEGQVPCSAIPELLRVTKPGG LVCLTTRTNPSNLPYKETLEATLDSLERAGVWECLVTQPVDHWELATSEQETGLGTCANDGFISGIIYLYRKQETV ; _struct_ref.pdbx_align_begin 3 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7QCB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 240 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8BGM4 _struct_ref_seq.db_align_beg 3 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 238 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 240 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7QCB GLY A 1 ? UNP Q8BGM4 ? ? 'expression tag' 1 1 1 7QCB ALA A 2 ? UNP Q8BGM4 ? ? 'expression tag' 2 2 1 7QCB MET A 3 ? UNP Q8BGM4 ? ? 'expression tag' 3 3 1 7QCB ALA A 4 ? UNP Q8BGM4 ? ? 'expression tag' 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SAH 'L-peptide linking' n S-ADENOSYL-L-HOMOCYSTEINE ? 'C14 H20 N6 O5 S' 384.411 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 5 '2D 1H-15N HSQC' 2 isotropic 3 1 4 '3D HNCO' 2 isotropic 4 1 4 '3D HNCACO' 2 isotropic 5 1 4 '3D HN(CO)CA' 2 isotropic 6 1 4 '3D HNCA' 2 isotropic 7 1 4 '3D CBCA(CO)NH' 2 isotropic 8 1 4 '3D HNCACB' 2 isotropic 9 1 4 '3D HBHA(CO)NH' 2 isotropic 10 1 4 '3D HNHAHB' 2 isotropic 11 1 4 '3D 1H-15N TOCSY' 2 isotropic 12 1 5 '3D HCCH-TOCSY' 2 isotropic 13 1 5 '3D 1H-13C NOESY' 2 isotropic 14 1 4 '3D 1H-13C NOESY' 5 isotropic 15 1 4 '3D 15N-1H NOESY' 2 isotropic 16 1 3 IPAP 3 anisotropic 17 1 7 '3D 15N-1H NOESY' 3 isotropic 18 1 6 '2D 1H-13C HSQC' 4 isotropic 19 1 1 '2D DQF-COSY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.00 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '1.0 mM [U-15N] WBSCR27, 10 mM SAH, 5 mM DTT, 0.2 % w/v sodium azide, 50 mM sodium phosphate, 50 mM sodium chloride, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N-wb27_sah_1 solution ? 3 ;0.2 mM [U-15N] WBSCR27, 10 mM SAH, 5 mM DTT, 0.2 % w/v sodium azide, 50 mM sodium phosphate, 50 mM sodium chloride, 0.225 % v/v phage Pf1 stock solution, 95% H2O/5% D2O ; '95% H2O/5% D2O' 15N-wb27_sah_RDC_Pf1 solution ? 4 ;0.6 mM [U-95% 13C; U-99% 15N] WBSCR27, 0.6 mM SAH, 5 mM DTT, 0.2 % w/v sodium azide, 50 mM sodium phosphate, 50 mM sodium chloride, 95% H2O/5% D2O ; '95% H2O/5% D2O' 15N_13C_wb27_sah_h2o solution ? 5 ;0.6 mM [U-95% 13C; U-99% 15N] WBSCR27, 0.6 mM SAH, 5 mM DTT, 0.2 % w/v sodium azide, 50 mM sodium phosphate, 50 mM sodium chloride, 100% D2O ; '100% D2O' 15N_13C_wb27_sah_d2o solution ? 6 ;0.3 mM [U-95% 15N] WBSCR27, 0.3 mM [U-95% 13C; U-99% 15N] SAH, 5 mM DTT, 0.2 % w/v sodium azide, 50 mM sodium phosphate, 50 mM sodium chloride, 100% D2O ; '100% D2O' 15N-wb27_13C-SAH solution ? 7 ;0.3 mM [U-95% 15N] WBSCR27, 0.3 mM [U-95% 13C; U-99% 15N] SAH, 5 mM DTT, 0.2 % w/v sodium azide, 50 mM sodium phosphate, 50 mM sodium chloride, 95% H2O/5% D2O ; '95% H2O/5% D2O' 15N-wb27_13CH3-Met-Thr solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 600 'Lomonosov MSU' 2 AVANCE ? Bruker 850 'Academia Sinica' 3 AVANCE ? Bruker 800 'Academia Sinica' 5 AVANCE ? Bruker 700 'Kazan Federal University' 4 AVANCE ? Bruker 700 RUDN # _pdbx_nmr_refine.entry_id 7QCB _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 9 # _pdbx_nmr_ensemble.entry_id 7QCB _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7QCB _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Brunger A. T. et.al.' 2 'peak picking' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' 3 'chemical shift assignment' PINE-SPARKY ? 'Lee W' 4 'chemical shift assignment' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' 5 'data analysis' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' 6 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 7 processing NMRDraw ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 8 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; 9 refinement CNS 2.21 'Brunger, Adams, Clore, Gros, Nilges and Read' 10 'data analysis' NMRest ? 'Polshakov V.' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7QCB _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7QCB _struct.title 'Williams-Beuren syndrome related methyltransferase WBSCR27 in complex with SAH' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7QCB _struct_keywords.text 'Williams-Beuren syndrome, SAM-dependent methyltransferase, Rossman fold, Class I methyltransferases, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 2 ? GLY A 9 ? ALA A 2 GLY A 9 1 ? 8 HELX_P HELX_P2 AA2 GLY A 9 ? SER A 21 ? GLY A 9 SER A 21 1 ? 13 HELX_P HELX_P3 AA3 GLY A 23 ? LYS A 49 ? GLY A 23 LYS A 49 1 ? 27 HELX_P HELX_P4 AA4 ARG A 51 ? PHE A 64 ? ARG A 51 PHE A 64 1 ? 14 HELX_P HELX_P5 AA5 THR A 80 ? GLY A 91 ? THR A 80 GLY A 91 1 ? 12 HELX_P HELX_P6 AA6 SER A 101 ? GLY A 112 ? SER A 101 GLY A 112 1 ? 12 HELX_P HELX_P7 AA7 ALA A 152 ? VAL A 159 ? ALA A 152 VAL A 159 1 ? 8 HELX_P HELX_P8 AA8 PRO A 178 ? GLY A 194 ? PRO A 178 GLY A 194 1 ? 17 HELX_P HELX_P9 AA9 ASP A 205 ? THR A 211 ? ASP A 205 THR A 211 1 ? 7 HELX_P HELX_P10 AB1 LEU A 218 ? ASN A 223 ? LEU A 218 ASN A 223 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 116 ? LEU A 119 ? HIS A 116 LEU A 119 AA1 2 VAL A 95 ? ASP A 99 ? VAL A 95 ASP A 99 AA1 3 ILE A 73 ? ASP A 75 ? ILE A 73 ASP A 75 AA1 4 PHE A 134 ? ILE A 138 ? PHE A 134 ILE A 138 AA1 5 THR A 160 ? THR A 170 ? THR A 160 THR A 170 AA1 6 ILE A 230 ? LYS A 236 ? ILE A 230 LYS A 236 AA1 7 TRP A 196 ? GLN A 202 ? TRP A 196 GLN A 202 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O HIS A 116 ? O HIS A 116 N GLY A 97 ? N GLY A 97 AA1 2 3 O GLN A 96 ? O GLN A 96 N ILE A 73 ? N ILE A 73 AA1 3 4 N LEU A 74 ? N LEU A 74 O ILE A 138 ? O ILE A 138 AA1 4 5 N VAL A 137 ? N VAL A 137 O CYS A 167 ? O CYS A 167 AA1 5 6 N GLY A 163 ? N GLY A 163 O LYS A 236 ? O LYS A 236 AA1 6 7 O ARG A 235 ? O ARG A 235 N GLU A 197 ? N GLU A 197 # _atom_sites.entry_id 7QCB _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 MET 104 104 104 MET MET A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 CYS 120 120 120 CYS CYS A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 GLN 124 124 124 GLN GLN A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 CYS 150 150 150 CYS CYS A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 PRO 154 154 154 PRO PRO A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 PRO 162 162 162 PRO PRO A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 CYS 167 167 167 CYS CYS A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 ARG 171 171 171 ARG ARG A . n A 1 172 THR 172 172 172 THR THR A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 PRO 174 174 174 PRO PRO A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 ASN 176 176 176 ASN ASN A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 PRO 178 178 178 PRO PRO A . n A 1 179 TYR 179 179 179 TYR TYR A . n A 1 180 LYS 180 180 180 LYS LYS A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 THR 186 186 186 THR THR A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 ASP 188 188 188 ASP ASP A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 GLU 191 191 191 GLU GLU A . n A 1 192 ARG 192 192 192 ARG ARG A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 TRP 196 196 196 TRP TRP A . n A 1 197 GLU 197 197 197 GLU GLU A . n A 1 198 CYS 198 198 198 CYS CYS A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 THR 201 201 201 THR THR A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 PRO 203 203 203 PRO PRO A . n A 1 204 VAL 204 204 204 VAL VAL A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 HIS 206 206 206 HIS HIS A . n A 1 207 TRP 207 207 207 TRP TRP A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 THR 211 211 211 THR THR A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 GLU 213 213 213 GLU GLU A . n A 1 214 GLN 214 214 214 GLN GLN A . n A 1 215 GLU 215 215 215 GLU GLU A . n A 1 216 THR 216 216 216 THR THR A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 GLY 219 219 219 GLY GLY A . n A 1 220 THR 220 220 220 THR THR A . n A 1 221 CYS 221 221 221 CYS CYS A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 ASN 223 223 223 ASN ASN A . n A 1 224 ASP 224 224 224 ASP ASP A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 PHE 226 226 226 PHE PHE A . n A 1 227 ILE 227 227 227 ILE ILE A . n A 1 228 SER 228 228 228 SER SER A . n A 1 229 GLY 229 229 229 GLY GLY A . n A 1 230 ILE 230 230 230 ILE ILE A . n A 1 231 ILE 231 231 231 ILE ILE A . n A 1 232 TYR 232 232 232 TYR TYR A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 TYR 234 234 234 TYR TYR A . n A 1 235 ARG 235 235 235 ARG ARG A . n A 1 236 LYS 236 236 236 LYS LYS A . n A 1 237 GLN 237 237 237 GLN GLN A . n A 1 238 GLU 238 238 238 GLU GLU A . n A 1 239 THR 239 239 239 THR THR A . n A 1 240 VAL 240 240 240 VAL VAL A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email sofia.mariasina@yandex.ru _pdbx_contact_author.name_first Sofia _pdbx_contact_author.name_last Mariasina _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9190-1298 # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id SAH _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 300 _pdbx_nonpoly_scheme.auth_seq_num 300 _pdbx_nonpoly_scheme.pdb_mon_id SAH _pdbx_nonpoly_scheme.auth_mon_id SAH _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 12640 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-12-29 2 'Structure model' 1 1 2022-07-13 3 'Structure model' 1 2 2022-07-20 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' 8 2 'Structure model' '_citation_author.identifier_ORCID' 9 2 'Structure model' '_citation_author.name' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 3 'Structure model' '_citation.pdbx_database_id_DOI' 13 3 'Structure model' '_citation.pdbx_database_id_PubMed' 14 3 'Structure model' '_citation.title' 15 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_entry_details.entry_id 7QCB _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 WBSCR27 1.0 ? mM '[U-15N]' 1 SAH 10 ? mM 'natural abundance' 1 DTT 5 ? mM 'natural abundance' 1 'sodium azide' 0.2 ? '% w/v' 'natural abundance' 1 'sodium phosphate' 50 ? mM 'natural abundance' 1 'sodium chloride' 50 ? mM 'natural abundance' 3 WBSCR27 0.2 ? mM '[U-15N]' 3 SAH 10 ? mM 'natural abundance' 3 DTT 5 ? mM 'natural abundance' 3 'sodium azide' 0.2 ? '% w/v' 'natural abundance' 3 'sodium phosphate' 50 ? mM 'natural abundance' 3 'sodium chloride' 50 ? mM 'natural abundance' 3 'phage Pf1 stock solution' 0.225 ? '% v/v' 'natural abundance' 4 WBSCR27 0.6 ? mM '[U-95% 13C; U-99% 15N]' 4 SAH 0.6 ? mM 'natural abundance' 4 DTT 5 ? mM 'natural abundance' 4 'sodium azide' 0.2 ? '% w/v' 'natural abundance' 4 'sodium phosphate' 50 ? mM 'natural abundance' 4 'sodium chloride' 50 ? mM 'natural abundance' 5 WBSCR27 0.6 ? mM '[U-95% 13C; U-99% 15N]' 5 SAH 0.6 ? mM 'natural abundance' 5 DTT 5 ? mM 'natural abundance' 5 'sodium azide' 0.2 ? '% w/v' 'natural abundance' 5 'sodium phosphate' 50 ? mM 'natural abundance' 5 'sodium chloride' 50 ? mM 'natural abundance' 6 WBSCR27 0.3 ? mM '[U-95% 15N]' 6 SAH 0.3 ? mM '[U-95% 13C; U-99% 15N]' 6 DTT 5 ? mM 'natural abundance' 6 'sodium azide' 0.2 ? '% w/v' 'natural abundance' 6 'sodium phosphate' 50 ? mM 'natural abundance' 6 'sodium chloride' 50 ? mM 'natural abundance' 7 WBSCR27 0.3 ? mM '[U-95% 15N]' 7 SAH 0.3 ? mM '[U-95% 13C; U-99% 15N]' 7 DTT 5 ? mM 'natural abundance' 7 'sodium azide' 0.2 ? '% w/v' 'natural abundance' 7 'sodium phosphate' 50 ? mM 'natural abundance' 7 'sodium chloride' 50 ? mM 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HA A ARG 171 ? ? H A GLY 229 ? ? 1.25 2 1 HG A LEU 127 ? ? HG A LEU 156 ? ? 1.32 3 1 HB A VAL 14 ? ? OG1 A THR 121 ? ? 1.46 4 1 O A PRO 102 ? ? H A LYS 106 ? ? 1.48 5 1 O A ALA 52 ? ? H A ALA 56 ? ? 1.49 6 1 O A TYR 179 ? ? H A LEU 183 ? ? 1.51 7 1 O A VAL 14 ? ? H A VAL 18 ? ? 1.56 8 1 O A LEU 74 ? ? H A ILE 138 ? ? 1.58 9 1 H A GLY 163 ? ? O A LYS 236 ? ? 1.58 10 1 O A LYS 180 ? ? H A GLU 184 ? ? 1.58 11 1 O A LEU 105 ? ? H A ARG 109 ? ? 1.58 12 1 O A LEU 55 ? ? H A CYS 59 ? ? 1.60 13 2 HA A ARG 171 ? ? H A GLY 229 ? ? 1.26 14 2 HG A LEU 157 ? ? HE3 A LYS 236 ? ? 1.30 15 2 O A PRO 102 ? ? H A LYS 106 ? ? 1.38 16 2 O A ALA 52 ? ? H A ALA 56 ? ? 1.45 17 2 O A SER 144 ? ? HG2 A GLU 145 ? ? 1.48 18 2 O A TYR 179 ? ? H A LEU 183 ? ? 1.59 19 2 O A LEU 55 ? ? H A CYS 59 ? ? 1.60 20 2 O A TRP 207 ? ? H A THR 211 ? ? 1.60 21 2 O A ALA 152 ? ? H A GLU 155 ? ? 1.60 22 3 HA A ARG 171 ? ? H A GLY 229 ? ? 1.32 23 3 HB2 A HIS 206 ? ? HG22 A ILE 227 ? ? 1.34 24 3 O A PRO 102 ? ? H A LYS 106 ? ? 1.44 25 3 O A LEU 55 ? ? H A CYS 59 ? ? 1.54 26 3 O A ALA 52 ? ? H A ALA 56 ? ? 1.57 27 3 O A SER 101 ? ? H A LEU 105 ? ? 1.57 28 3 H A GLY 163 ? ? O A LYS 236 ? ? 1.58 29 3 O A LEU 105 ? ? H A ARG 109 ? ? 1.58 30 3 O A SER 144 ? ? HG3 A GLU 145 ? ? 1.58 31 3 OD1 A ASN 173 ? ? O A LEU 177 ? ? 2.18 32 4 HA A ARG 171 ? ? H A GLY 229 ? ? 1.11 33 4 O A PRO 102 ? ? H A LYS 106 ? ? 1.43 34 4 O A ALA 52 ? ? H A ALA 56 ? ? 1.52 35 5 HB3 A ASP 75 ? ? HE1 A TYR 114 ? ? 1.31 36 5 HA A GLU 131 ? ? HA A VAL 159 ? ? 1.33 37 5 O A PRO 102 ? ? H A LYS 106 ? ? 1.41 38 5 O A TYR 179 ? ? H A LEU 183 ? ? 1.51 39 5 O A LEU 105 ? ? H A ARG 109 ? ? 1.52 40 5 O A ALA 28 ? ? H A ARG 32 ? ? 1.54 41 5 O A ALA 52 ? ? H A ALA 56 ? ? 1.59 42 6 HA A ARG 171 ? ? H A GLY 229 ? ? 1.20 43 6 H A SER 101 ? ? "HO2'" A SAH 300 ? ? 1.31 44 6 HA A GLU 131 ? ? HA A VAL 159 ? ? 1.35 45 6 O A ALA 52 ? ? H A ALA 56 ? ? 1.35 46 6 O A PRO 102 ? ? H A LYS 106 ? ? 1.44 47 6 O A GLU 208 ? ? HG1 A THR 211 ? ? 1.56 48 6 O A TYR 179 ? ? H A LEU 183 ? ? 1.58 49 6 O A LEU 55 ? ? H A CYS 59 ? ? 1.59 50 6 O A LEU 105 ? ? H A ARG 109 ? ? 1.60 51 7 HA A ARG 171 ? ? H A GLY 229 ? ? 1.07 52 7 HG13 A VAL 76 ? ? H A ALA 77 ? ? 1.28 53 7 O A PRO 102 ? ? H A LYS 106 ? ? 1.42 54 7 O A TYR 179 ? ? H A LEU 183 ? ? 1.52 55 8 HG A LEU 11 ? ? HD3 A PRO 12 ? ? 1.11 56 8 HA A ARG 171 ? ? H A GLY 229 ? ? 1.21 57 8 O A PRO 102 ? ? H A LYS 106 ? ? 1.43 58 8 O A ALA 52 ? ? H A ALA 56 ? ? 1.45 59 8 HA A THR 121 ? ? N1 A SAH 300 ? ? 1.46 60 8 O A TYR 179 ? ? H A LEU 183 ? ? 1.51 61 8 H A SER 101 ? ? "O2'" A SAH 300 ? ? 1.54 62 8 O A ILE 73 ? ? H A GLN 96 ? ? 1.56 63 8 O A GLY 9 ? ? HD2 A PRO 12 ? ? 1.56 64 8 O A GLN 107 ? ? HG2 A ARG 111 ? ? 1.58 65 8 H A GLY 141 ? ? O A THR 169 ? ? 1.59 66 8 HB3 A CYS 78 ? ? O A VAL 140 ? ? 1.59 67 9 HA A ALA 38 ? ? HA A SAH 300 ? ? 1.27 68 9 HB3 A ASN 176 ? ? HB2 A TYR 179 ? ? 1.33 69 9 HA A ARG 171 ? ? H A GLY 229 ? ? 1.34 70 9 O A ALA 52 ? ? H A ALA 56 ? ? 1.41 71 9 O A PRO 102 ? ? H A LYS 106 ? ? 1.42 72 9 HA A THR 121 ? ? N1 A SAH 300 ? ? 1.50 73 9 O A VAL 195 ? ? H A GLN 237 ? ? 1.53 74 9 O A ILE 73 ? ? H A GLN 96 ? ? 1.53 75 9 O A LEU 55 ? ? H A CYS 59 ? ? 1.54 76 9 O A LEU 60 ? ? H A PHE 64 ? ? 1.59 77 10 HA A ARG 171 ? ? H A GLY 229 ? ? 1.19 78 10 HA A ALA 210 ? ? H A PHE 226 ? ? 1.31 79 10 HB3 A LEU 11 ? ? HN61 A SAH 300 ? ? 1.33 80 10 HA A THR 121 ? ? N1 A SAH 300 ? ? 1.37 81 10 O A PRO 102 ? ? H A LYS 106 ? ? 1.43 82 10 O A ALA 52 ? ? H A ALA 56 ? ? 1.44 83 10 O A VAL 195 ? ? H A GLN 237 ? ? 1.48 84 10 O A TYR 179 ? ? H A LEU 183 ? ? 1.53 85 10 O A ALA 28 ? ? H A ARG 32 ? ? 1.59 86 10 O A LEU 105 ? ? H A ARG 109 ? ? 1.59 87 11 HG A LEU 11 ? ? HN61 A SAH 300 ? ? 1.20 88 11 HA A ARG 171 ? ? H A GLY 229 ? ? 1.33 89 11 O A ALA 52 ? ? H A ALA 56 ? ? 1.48 90 11 O A PRO 102 ? ? H A LYS 106 ? ? 1.48 91 11 O A TYR 179 ? ? H A LEU 183 ? ? 1.49 92 11 O A VAL 137 ? ? H A CYS 167 ? ? 1.51 93 11 O A LEU 74 ? ? H A ILE 138 ? ? 1.52 94 11 O A ALA 152 ? ? H A GLU 155 ? ? 1.52 95 11 O A VAL 195 ? ? H A GLN 237 ? ? 1.53 96 11 H A ASP 75 ? ? O A GLN 96 ? ? 1.55 97 11 O A LEU 105 ? ? H A ARG 109 ? ? 1.59 98 11 O A LYS 180 ? ? H A GLU 184 ? ? 1.60 99 11 O A LEU 143 ? ? OG1 A THR 170 ? ? 2.18 100 12 O A PRO 102 ? ? H A LYS 106 ? ? 1.41 101 12 HA A THR 121 ? ? N1 A SAH 300 ? ? 1.42 102 12 O A ALA 52 ? ? H A ALA 56 ? ? 1.42 103 12 O A TYR 179 ? ? H A LEU 183 ? ? 1.48 104 12 O A VAL 137 ? ? H A CYS 167 ? ? 1.50 105 12 H A ILE 139 ? ? O A CYS 167 ? ? 1.56 106 12 O A LEU 105 ? ? H A ARG 109 ? ? 1.57 107 12 O A LEU 74 ? ? H A ILE 138 ? ? 1.60 108 13 O A PRO 102 ? ? H A LYS 106 ? ? 1.43 109 13 O A ALA 52 ? ? H A ALA 56 ? ? 1.44 110 13 O A GLN 43 ? ? H A ALA 47 ? ? 1.56 111 13 O A LEU 105 ? ? H A ARG 109 ? ? 1.56 112 13 O A SER 144 ? ? HG3 A GLU 145 ? ? 1.58 113 13 O A VAL 195 ? ? H A GLN 237 ? ? 1.58 114 13 O A ALA 63 ? ? HH21 A ARG 235 ? ? 1.60 115 14 HA A ARG 171 ? ? H A GLY 229 ? ? 1.22 116 14 O A PRO 102 ? ? H A LYS 106 ? ? 1.45 117 14 O A ALA 52 ? ? H A ALA 56 ? ? 1.46 118 14 O A TYR 179 ? ? H A LEU 183 ? ? 1.48 119 14 O A LEU 15 ? ? H A GLY 19 ? ? 1.55 120 14 O A VAL 195 ? ? H A GLN 237 ? ? 1.57 121 14 O A ALA 4 ? ? H A ALA 8 ? ? 1.59 122 15 HG A LEU 11 ? ? HD3 A PRO 12 ? ? 1.14 123 15 HA A ARG 171 ? ? H A GLY 229 ? ? 1.27 124 15 O A ALA 52 ? ? H A ALA 56 ? ? 1.39 125 15 O A PRO 102 ? ? H A LYS 106 ? ? 1.44 126 15 HA A THR 121 ? ? N1 A SAH 300 ? ? 1.47 127 15 O A VAL 14 ? ? H A VAL 18 ? ? 1.55 128 15 O A ILE 73 ? ? H A GLN 96 ? ? 1.57 129 15 O A TYR 179 ? ? H A LEU 183 ? ? 1.58 130 16 HA A ARG 171 ? ? H A GLY 229 ? ? 1.16 131 16 O A ALA 52 ? ? H A ALA 56 ? ? 1.41 132 16 O A PRO 102 ? ? H A LYS 106 ? ? 1.42 133 16 HA A THR 121 ? ? N1 A SAH 300 ? ? 1.55 134 16 O A VAL 195 ? ? H A GLN 237 ? ? 1.55 135 16 O A TYR 179 ? ? H A LEU 183 ? ? 1.59 136 16 O A LEU 105 ? ? H A ARG 109 ? ? 1.59 137 16 O A LEU 74 ? ? H A ILE 138 ? ? 1.60 138 17 H A GLY 100 ? ? "HO2'" A SAH 300 ? ? 1.33 139 17 HA3 A GLY 123 ? ? HD2 A PRO 149 ? ? 1.35 140 17 O A PRO 102 ? ? H A LYS 106 ? ? 1.43 141 17 O A ALA 52 ? ? H A ALA 56 ? ? 1.44 142 17 HA A THR 121 ? ? N1 A SAH 300 ? ? 1.46 143 17 O A TYR 179 ? ? H A LEU 183 ? ? 1.57 144 17 O A ILE 73 ? ? H A GLN 96 ? ? 1.59 145 18 HD21 A LEU 177 ? ? HA A PHE 226 ? ? 1.10 146 18 HB3 A ALA 210 ? ? H A PHE 226 ? ? 1.24 147 18 HB3 A ASP 75 ? ? HE1 A TYR 114 ? ? 1.25 148 18 HA A ARG 171 ? ? H A GLY 229 ? ? 1.29 149 18 HA A THR 121 ? ? N1 A SAH 300 ? ? 1.39 150 18 O A PRO 102 ? ? H A LYS 106 ? ? 1.48 151 18 O A ALA 52 ? ? H A ALA 56 ? ? 1.52 152 18 O A LEU 105 ? ? H A ARG 109 ? ? 1.54 153 18 O A LEU 60 ? ? H A PHE 64 ? ? 1.54 154 18 O A VAL 195 ? ? H A GLN 237 ? ? 1.58 155 18 O A VAL 137 ? ? H A CYS 167 ? ? 1.59 156 18 O A TYR 179 ? ? H A LEU 183 ? ? 1.59 157 18 H A ASP 75 ? ? O A GLN 96 ? ? 1.60 158 19 HA A ARG 171 ? ? H A GLY 229 ? ? 1.29 159 19 O A PRO 102 ? ? H A LYS 106 ? ? 1.38 160 19 O A TYR 179 ? ? H A LEU 183 ? ? 1.47 161 19 O A VAL 195 ? ? H A GLN 237 ? ? 1.51 162 19 O A LEU 55 ? ? H A CYS 59 ? ? 1.52 163 19 O A ALA 52 ? ? H A ALA 56 ? ? 1.52 164 19 O A TRP 207 ? ? H A THR 211 ? ? 1.56 165 19 O A VAL 14 ? ? H A VAL 18 ? ? 1.59 166 19 O A ILE 73 ? ? H A GLN 96 ? ? 1.60 167 20 HA A ARG 171 ? ? H A GLY 229 ? ? 1.24 168 20 O A PRO 102 ? ? H A LYS 106 ? ? 1.42 169 20 O A ALA 52 ? ? H A ALA 56 ? ? 1.43 170 20 O A TYR 179 ? ? H A LEU 183 ? ? 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 8 ? ? -169.46 -51.74 2 1 ARG A 10 ? ? -41.60 -77.63 3 1 SER A 21 ? ? 55.93 -162.07 4 1 ALA A 52 ? ? -25.68 -63.97 5 1 CYS A 120 ? ? 169.98 90.02 6 1 SER A 144 ? ? -55.05 97.70 7 1 GLU A 145 ? ? 174.12 40.93 8 1 GLN A 147 ? ? -90.03 -79.82 9 1 THR A 170 ? ? 170.26 -162.60 10 1 GLU A 215 ? ? 137.34 177.25 11 1 LEU A 218 ? ? 40.00 54.55 12 1 GLN A 237 ? ? 40.37 98.17 13 2 GLN A 5 ? ? 60.12 73.03 14 2 ALA A 8 ? ? -178.64 -27.57 15 2 SER A 21 ? ? 66.69 -164.30 16 2 LYS A 49 ? ? 74.63 54.58 17 2 CYS A 120 ? ? -167.36 74.38 18 2 LEU A 127 ? ? -44.29 160.99 19 2 PRO A 128 ? ? -68.60 22.08 20 2 SER A 144 ? ? -54.58 102.39 21 2 GLU A 145 ? ? 173.81 46.14 22 2 GLN A 147 ? ? -91.16 -79.81 23 2 PRO A 154 ? ? -49.52 -16.34 24 2 THR A 170 ? ? 179.30 -169.55 25 2 ASN A 173 ? ? 161.68 99.00 26 2 TRP A 196 ? ? -170.94 -176.97 27 2 LEU A 199 ? ? -119.65 -90.84 28 2 ASN A 223 ? ? 73.29 61.37 29 2 GLN A 237 ? ? 47.69 107.36 30 3 SER A 21 ? ? 60.93 -158.83 31 3 ALA A 52 ? ? -29.63 -56.83 32 3 CYS A 78 ? ? -71.42 20.02 33 3 CYS A 120 ? ? -177.17 85.67 34 3 LEU A 122 ? ? 179.64 179.47 35 3 SER A 144 ? ? -62.65 99.96 36 3 GLU A 145 ? ? 175.73 45.05 37 3 GLN A 147 ? ? -90.33 -78.87 38 3 THR A 170 ? ? 175.64 -170.43 39 3 CYS A 198 ? ? -64.75 97.67 40 3 SER A 212 ? ? 176.94 -150.35 41 3 ILE A 230 ? ? -174.38 144.62 42 3 GLN A 237 ? ? 38.24 107.26 43 4 SER A 21 ? ? 64.39 -165.13 44 4 CYS A 120 ? ? -161.75 71.39 45 4 SER A 144 ? ? -54.28 106.46 46 4 GLU A 145 ? ? 165.63 49.53 47 4 GLN A 147 ? ? -89.99 -79.98 48 4 PRO A 149 ? ? -47.31 109.12 49 4 CYS A 150 ? ? -39.92 -24.29 50 4 THR A 170 ? ? 178.80 -173.46 51 4 ASN A 173 ? ? 171.30 88.63 52 4 THR A 211 ? ? 69.21 78.41 53 4 ASN A 223 ? ? 72.61 76.10 54 4 GLN A 237 ? ? 30.24 108.24 55 5 SER A 21 ? ? 71.79 -170.07 56 5 TYR A 50 ? ? -60.94 94.15 57 5 ALA A 52 ? ? -27.92 -61.45 58 5 CYS A 78 ? ? -72.63 21.70 59 5 CYS A 120 ? ? -172.84 78.64 60 5 PRO A 126 ? ? -48.48 165.14 61 5 SER A 144 ? ? -54.86 107.23 62 5 GLU A 145 ? ? 161.19 50.06 63 5 GLN A 147 ? ? -90.06 -79.98 64 5 THR A 170 ? ? 175.13 -162.64 65 5 VAL A 204 ? ? -104.11 -129.73 66 5 ASP A 224 ? ? -162.90 -133.90 67 5 GLN A 237 ? ? 43.39 95.54 68 6 ALA A 8 ? ? -36.86 -35.06 69 6 SER A 21 ? ? 43.80 -157.73 70 6 LYS A 49 ? ? 60.82 61.08 71 6 ALA A 77 ? ? -34.87 -32.72 72 6 CYS A 120 ? ? -174.49 79.29 73 6 LEU A 122 ? ? -174.89 -173.61 74 6 PRO A 126 ? ? -49.21 162.96 75 6 GLU A 145 ? ? 163.60 45.44 76 6 GLN A 147 ? ? -89.96 -80.05 77 6 THR A 170 ? ? 174.13 -169.96 78 6 VAL A 204 ? ? -112.23 -99.93 79 6 GLU A 208 ? ? -105.72 -64.62 80 6 LEU A 218 ? ? 28.82 47.48 81 6 GLN A 237 ? ? 47.88 98.17 82 7 ALA A 8 ? ? 83.97 98.80 83 7 SER A 21 ? ? 68.13 -167.66 84 7 CYS A 120 ? ? -163.50 70.32 85 7 SER A 144 ? ? -56.33 106.28 86 7 GLU A 145 ? ? 171.06 46.28 87 7 GLN A 147 ? ? -89.97 -77.09 88 7 PRO A 149 ? ? -45.53 106.09 89 7 CYS A 150 ? ? -39.96 -20.64 90 7 THR A 170 ? ? 173.21 -167.96 91 7 ASN A 173 ? ? -154.18 79.04 92 7 LEU A 218 ? ? 42.02 24.49 93 7 ASN A 223 ? ? 80.15 79.89 94 7 GLN A 237 ? ? 41.00 100.23 95 8 SER A 21 ? ? 58.27 -160.96 96 8 TYR A 50 ? ? -55.12 89.32 97 8 CYS A 120 ? ? 178.99 80.00 98 8 GLU A 145 ? ? 161.44 48.62 99 8 GLN A 147 ? ? -117.24 -89.85 100 8 THR A 170 ? ? 179.99 -171.65 101 8 LEU A 199 ? ? -90.37 -66.74 102 8 ASN A 223 ? ? 78.24 55.11 103 8 GLN A 237 ? ? 42.31 96.59 104 9 SER A 21 ? ? 54.23 -160.01 105 9 TYR A 50 ? ? -68.22 96.02 106 9 CYS A 120 ? ? -166.47 68.58 107 9 THR A 121 ? ? -58.88 108.44 108 9 SER A 144 ? ? -51.23 88.26 109 9 GLU A 145 ? ? -174.42 41.74 110 9 GLN A 147 ? ? -90.13 -76.90 111 9 THR A 170 ? ? 172.90 -161.76 112 9 VAL A 204 ? ? -144.53 -144.89 113 9 THR A 216 ? ? -89.92 -80.04 114 9 LEU A 218 ? ? 78.30 67.89 115 9 GLN A 237 ? ? 41.21 90.32 116 10 GLU A 7 ? ? 82.96 -2.63 117 10 ALA A 8 ? ? 76.82 50.35 118 10 SER A 21 ? ? 61.26 -159.56 119 10 TYR A 50 ? ? -53.13 89.45 120 10 CYS A 78 ? ? -73.34 20.88 121 10 CYS A 120 ? ? -160.18 69.43 122 10 ALA A 142 ? ? -110.28 73.83 123 10 SER A 144 ? ? -49.74 109.35 124 10 GLU A 145 ? ? 159.40 49.79 125 10 GLN A 147 ? ? -91.13 -78.53 126 10 THR A 170 ? ? 174.43 -169.09 127 10 LEU A 199 ? ? -91.71 -66.49 128 10 VAL A 204 ? ? -136.63 -159.00 129 10 GLN A 237 ? ? 44.56 98.28 130 11 SER A 21 ? ? 47.20 -150.34 131 11 TYR A 50 ? ? -53.20 88.59 132 11 VAL A 76 ? ? -100.07 -169.95 133 11 CYS A 78 ? ? -71.91 20.73 134 11 CYS A 120 ? ? -163.54 71.76 135 11 LEU A 143 ? ? -161.49 97.60 136 11 GLN A 147 ? ? -90.01 -79.98 137 11 CYS A 150 ? ? -40.07 -19.99 138 11 THR A 170 ? ? 177.90 -162.50 139 11 VAL A 204 ? ? -138.09 -155.68 140 11 GLN A 237 ? ? 49.29 88.92 141 12 ALA A 8 ? ? -99.68 49.48 142 12 SER A 21 ? ? 61.56 -169.96 143 12 ALA A 38 ? ? -12.27 -63.65 144 12 TYR A 50 ? ? -57.42 83.16 145 12 ALA A 52 ? ? -28.87 -64.47 146 12 VAL A 76 ? ? -104.44 -168.44 147 12 CYS A 120 ? ? -170.16 77.84 148 12 ALA A 142 ? ? -104.86 67.02 149 12 LEU A 143 ? ? -162.62 98.13 150 12 GLN A 147 ? ? -89.95 -80.08 151 12 THR A 170 ? ? 179.09 -164.26 152 12 VAL A 204 ? ? -114.20 -100.00 153 12 HIS A 206 ? ? -40.45 -71.75 154 12 ALA A 222 ? ? -36.42 -39.11 155 12 ASN A 223 ? ? 78.80 79.08 156 12 GLN A 237 ? ? 43.90 90.78 157 13 ALA A 8 ? ? -89.94 -80.04 158 13 SER A 21 ? ? 69.21 -160.01 159 13 TYR A 50 ? ? -58.44 99.59 160 13 CYS A 120 ? ? -161.13 70.34 161 13 SER A 144 ? ? -52.89 97.65 162 13 GLU A 145 ? ? 175.62 47.91 163 13 GLN A 147 ? ? -89.94 -79.05 164 13 CYS A 150 ? ? -39.95 -26.57 165 13 THR A 170 ? ? -176.64 -176.13 166 13 SER A 175 ? ? 60.81 96.36 167 13 VAL A 204 ? ? -106.54 -116.69 168 13 GLU A 208 ? ? -80.00 -70.04 169 13 ALA A 210 ? ? 19.89 -104.06 170 13 GLN A 237 ? ? 40.20 92.67 171 14 SER A 21 ? ? 64.87 -169.83 172 14 PHE A 64 ? ? -63.77 97.63 173 14 THR A 80 ? ? 66.15 103.39 174 14 CYS A 120 ? ? -163.89 72.75 175 14 LEU A 127 ? ? -37.21 151.46 176 14 SER A 144 ? ? -55.59 104.44 177 14 GLU A 145 ? ? 166.43 41.10 178 14 GLN A 147 ? ? -90.06 -78.21 179 14 PRO A 149 ? ? -54.33 107.35 180 14 CYS A 150 ? ? -39.93 -24.15 181 14 THR A 170 ? ? 171.49 -168.45 182 14 LEU A 199 ? ? -92.11 -67.02 183 14 VAL A 204 ? ? -133.49 -146.88 184 14 GLN A 214 ? ? 170.01 -150.23 185 14 LEU A 218 ? ? 72.60 54.83 186 14 ALA A 222 ? ? -177.26 86.60 187 14 GLN A 237 ? ? 42.71 94.83 188 15 ARG A 10 ? ? -49.18 -87.63 189 15 SER A 21 ? ? 49.95 -157.90 190 15 PRO A 68 ? ? -59.99 -8.89 191 15 ALA A 77 ? ? -36.61 -36.72 192 15 CYS A 78 ? ? -75.38 26.34 193 15 CYS A 120 ? ? 171.71 88.47 194 15 PRO A 126 ? ? -48.60 159.67 195 15 THR A 133 ? ? -92.90 -65.06 196 15 GLU A 145 ? ? 161.66 46.78 197 15 GLN A 147 ? ? -90.04 -80.00 198 15 CYS A 150 ? ? -40.00 -21.06 199 15 THR A 170 ? ? 178.80 -172.12 200 15 ASN A 173 ? ? 164.70 108.25 201 15 SER A 175 ? ? 64.99 -168.11 202 15 VAL A 204 ? ? -110.30 -99.42 203 15 LEU A 218 ? ? 39.98 47.54 204 15 ASN A 223 ? ? -170.97 131.37 205 15 GLN A 237 ? ? 40.02 98.77 206 16 ALA A 4 ? ? 67.55 67.57 207 16 GLU A 6 ? ? 73.30 65.11 208 16 GLU A 7 ? ? 39.58 25.23 209 16 ALA A 8 ? ? -154.29 -79.60 210 16 SER A 21 ? ? 47.59 -163.64 211 16 ALA A 38 ? ? -25.47 -59.81 212 16 LYS A 49 ? ? 60.89 60.02 213 16 CYS A 120 ? ? -179.66 76.77 214 16 SER A 144 ? ? -54.78 102.94 215 16 GLU A 145 ? ? 165.09 47.21 216 16 GLN A 147 ? ? -109.94 -80.05 217 16 PRO A 149 ? ? -50.15 105.57 218 16 THR A 170 ? ? 174.03 -169.93 219 16 VAL A 204 ? ? -140.19 -159.91 220 16 GLN A 237 ? ? 41.92 93.35 221 17 SER A 21 ? ? 53.39 -160.00 222 17 CYS A 120 ? ? 174.69 87.25 223 17 GLU A 145 ? ? 156.80 46.74 224 17 GLN A 147 ? ? -104.49 -79.97 225 17 CYS A 150 ? ? -39.99 -23.75 226 17 VAL A 204 ? ? -110.67 -130.13 227 17 LEU A 209 ? ? -121.80 -63.53 228 17 ALA A 210 ? ? 41.36 -138.23 229 17 ALA A 222 ? ? 172.74 31.47 230 17 SER A 228 ? ? -40.22 -172.47 231 17 GLN A 237 ? ? 39.99 91.86 232 18 SER A 21 ? ? 59.58 -159.87 233 18 PHE A 64 ? ? -58.93 97.24 234 18 THR A 80 ? ? -35.74 130.70 235 18 CYS A 120 ? ? -157.02 74.61 236 18 GLN A 147 ? ? -90.04 -79.99 237 18 THR A 170 ? ? -174.13 -171.38 238 18 VAL A 204 ? ? -140.13 -153.58 239 18 HIS A 206 ? ? -39.96 -24.50 240 18 ALA A 210 ? ? -179.28 139.97 241 18 GLN A 237 ? ? 44.21 88.77 242 19 ALA A 4 ? ? 75.04 56.74 243 19 GLU A 6 ? ? 71.71 54.54 244 19 ALA A 8 ? ? 63.86 73.62 245 19 SER A 21 ? ? 52.31 -166.86 246 19 TYR A 50 ? ? -52.97 89.16 247 19 CYS A 120 ? ? -159.97 68.36 248 19 LEU A 127 ? ? -37.60 143.11 249 19 SER A 144 ? ? -57.47 95.50 250 19 GLU A 145 ? ? -176.58 43.54 251 19 GLN A 147 ? ? -97.83 -77.26 252 19 CYS A 150 ? ? -39.97 -24.66 253 19 PRO A 154 ? ? -49.83 -17.83 254 19 THR A 170 ? ? 177.39 -164.53 255 19 LEU A 199 ? ? -94.13 -63.70 256 19 VAL A 204 ? ? -137.42 -143.83 257 19 ASN A 223 ? ? 72.65 37.67 258 19 GLN A 237 ? ? 47.91 96.40 259 20 GLU A 6 ? ? 27.86 55.19 260 20 ALA A 8 ? ? -141.13 -52.40 261 20 SER A 21 ? ? 77.75 -173.31 262 20 ALA A 52 ? ? -25.23 -66.04 263 20 VAL A 76 ? ? -101.64 -167.66 264 20 CYS A 120 ? ? -175.54 78.54 265 20 LEU A 122 ? ? -172.06 -179.76 266 20 SER A 144 ? ? -61.14 97.28 267 20 GLU A 145 ? ? 175.58 46.12 268 20 GLN A 147 ? ? -93.38 -79.83 269 20 CYS A 150 ? ? -37.88 -24.41 270 20 THR A 170 ? ? 173.52 -167.09 271 20 GLN A 237 ? ? 42.42 89.16 # _pdbx_audit_support.funding_organization 'Russian Foundation for Basic Research' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 20-04-00318 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id SAH _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id SAH _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name S-ADENOSYL-L-HOMOCYSTEINE _pdbx_entity_nonpoly.comp_id SAH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'NOE from the sample containing {13C,15N}-labeled SAH and {15N}-labeles WBSCR27.' #