data_7QDW # _entry.id 7QDW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7QDW pdb_00007qdw 10.2210/pdb7qdw/pdb WWPDB D_1292119473 ? ? BMRB 34693 ? 10.13018/BMR34693 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-03-30 2 'Structure model' 1 1 2022-04-06 3 'Structure model' 1 2 2022-04-13 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' Other 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 4 'Structure model' pdbx_database_status 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond 6 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_citation.journal_volume' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' 6 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 7 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7QDW _pdbx_database_status.recvd_initial_deposition_date 2021-11-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of the complex between plasmodial ZNHIT3 and NUFIP1 proteins' _pdbx_database_related.db_id 34693 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email marc.quinternet@univ-lorraine.fr _pdbx_contact_author.name_first Marc _pdbx_contact_author.name_last Quinternet _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8299-7136 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chagot, M.E.' 1 0000-0001-6407-9131 'Quinternet, M.' 2 0000-0002-8299-7136 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 61 _citation.language ? _citation.page_first 479 _citation.page_last 493 _citation.title 'Structural Analysis of the Plasmodial Proteins ZNHIT3 and NUFIP1 Provides Insights into the Selectivity of a Conserved Interaction.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.1c00792 _citation.pdbx_database_id_PubMed 35315277 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chagot, M.E.' 1 ? primary 'Boutilliat, A.' 2 ? primary 'Kriznik, A.' 3 ? primary 'Quinternet, M.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein, putative' 8578.843 1 ? ? ? ? 2 polymer man 'NUFIP1 domain-containing protein' 3107.529 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GPHMDYDMLTEEQKKKLKEDHTLKILLKNNYVREVFKQFTLSNDKIGYLSHYINDPTIVQVIDHIMKTIDDT GPHMDYDMLTEEQKKKLKEDHTLKILLKNNYVREVFKQFTLSNDKIGYLSHYINDPTIVQVIDHIMKTIDDT A ? 2 'polypeptide(L)' no no DIYTYEKKLIKSIEYITKNKFFDDS DIYTYEKKLIKSIEYITKNKFFDDS B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 HIS n 1 4 MET n 1 5 ASP n 1 6 TYR n 1 7 ASP n 1 8 MET n 1 9 LEU n 1 10 THR n 1 11 GLU n 1 12 GLU n 1 13 GLN n 1 14 LYS n 1 15 LYS n 1 16 LYS n 1 17 LEU n 1 18 LYS n 1 19 GLU n 1 20 ASP n 1 21 HIS n 1 22 THR n 1 23 LEU n 1 24 LYS n 1 25 ILE n 1 26 LEU n 1 27 LEU n 1 28 LYS n 1 29 ASN n 1 30 ASN n 1 31 TYR n 1 32 VAL n 1 33 ARG n 1 34 GLU n 1 35 VAL n 1 36 PHE n 1 37 LYS n 1 38 GLN n 1 39 PHE n 1 40 THR n 1 41 LEU n 1 42 SER n 1 43 ASN n 1 44 ASP n 1 45 LYS n 1 46 ILE n 1 47 GLY n 1 48 TYR n 1 49 LEU n 1 50 SER n 1 51 HIS n 1 52 TYR n 1 53 ILE n 1 54 ASN n 1 55 ASP n 1 56 PRO n 1 57 THR n 1 58 ILE n 1 59 VAL n 1 60 GLN n 1 61 VAL n 1 62 ILE n 1 63 ASP n 1 64 HIS n 1 65 ILE n 1 66 MET n 1 67 LYS n 1 68 THR n 1 69 ILE n 1 70 ASP n 1 71 ASP n 1 72 THR n 2 1 ASP n 2 2 ILE n 2 3 TYR n 2 4 THR n 2 5 TYR n 2 6 GLU n 2 7 LYS n 2 8 LYS n 2 9 LEU n 2 10 ILE n 2 11 LYS n 2 12 SER n 2 13 ILE n 2 14 GLU n 2 15 TYR n 2 16 ILE n 2 17 THR n 2 18 LYS n 2 19 ASN n 2 20 LYS n 2 21 PHE n 2 22 PHE n 2 23 ASP n 2 24 ASP n 2 25 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 72 ? ? PF3D7_0916900 ? 'isolate 3D7' ? ? ? ? 'Plasmodium falciparum (isolate 3D7)' 36329 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 25 ? ? PF3D7_1473900 ? 'isolate 3D7' ? ? ? ? 'Plasmodium falciparum (isolate 3D7)' 36329 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 261 261 GLY GLY A . n A 1 2 PRO 2 262 262 PRO PRO A . n A 1 3 HIS 3 263 263 HIS HIS A . n A 1 4 MET 4 264 264 MET MET A . n A 1 5 ASP 5 265 265 ASP ASP A . n A 1 6 TYR 6 266 266 TYR TYR A . n A 1 7 ASP 7 267 267 ASP ASP A . n A 1 8 MET 8 268 268 MET MET A . n A 1 9 LEU 9 269 269 LEU LEU A . n A 1 10 THR 10 270 270 THR THR A . n A 1 11 GLU 11 271 271 GLU GLU A . n A 1 12 GLU 12 272 272 GLU GLU A . n A 1 13 GLN 13 273 273 GLN GLN A . n A 1 14 LYS 14 274 274 LYS LYS A . n A 1 15 LYS 15 275 275 LYS LYS A . n A 1 16 LYS 16 276 276 LYS LYS A . n A 1 17 LEU 17 277 277 LEU LEU A . n A 1 18 LYS 18 278 278 LYS LYS A . n A 1 19 GLU 19 279 279 GLU GLU A . n A 1 20 ASP 20 280 280 ASP ASP A . n A 1 21 HIS 21 281 281 HIS HIS A . n A 1 22 THR 22 282 282 THR THR A . n A 1 23 LEU 23 283 283 LEU LEU A . n A 1 24 LYS 24 284 284 LYS LYS A . n A 1 25 ILE 25 285 285 ILE ILE A . n A 1 26 LEU 26 286 286 LEU LEU A . n A 1 27 LEU 27 287 287 LEU LEU A . n A 1 28 LYS 28 288 288 LYS LYS A . n A 1 29 ASN 29 289 289 ASN ASN A . n A 1 30 ASN 30 290 290 ASN ASN A . n A 1 31 TYR 31 291 291 TYR TYR A . n A 1 32 VAL 32 292 292 VAL VAL A . n A 1 33 ARG 33 293 293 ARG ARG A . n A 1 34 GLU 34 294 294 GLU GLU A . n A 1 35 VAL 35 295 295 VAL VAL A . n A 1 36 PHE 36 296 296 PHE PHE A . n A 1 37 LYS 37 297 297 LYS LYS A . n A 1 38 GLN 38 298 298 GLN GLN A . n A 1 39 PHE 39 299 299 PHE PHE A . n A 1 40 THR 40 300 300 THR THR A . n A 1 41 LEU 41 301 301 LEU LEU A . n A 1 42 SER 42 302 302 SER SER A . n A 1 43 ASN 43 303 303 ASN ASN A . n A 1 44 ASP 44 304 304 ASP ASP A . n A 1 45 LYS 45 305 305 LYS LYS A . n A 1 46 ILE 46 306 306 ILE ILE A . n A 1 47 GLY 47 307 307 GLY GLY A . n A 1 48 TYR 48 308 308 TYR TYR A . n A 1 49 LEU 49 309 309 LEU LEU A . n A 1 50 SER 50 310 310 SER SER A . n A 1 51 HIS 51 311 311 HIS HIS A . n A 1 52 TYR 52 312 312 TYR TYR A . n A 1 53 ILE 53 313 313 ILE ILE A . n A 1 54 ASN 54 314 314 ASN ASN A . n A 1 55 ASP 55 315 315 ASP ASP A . n A 1 56 PRO 56 316 316 PRO PRO A . n A 1 57 THR 57 317 317 THR THR A . n A 1 58 ILE 58 318 318 ILE ILE A . n A 1 59 VAL 59 319 319 VAL VAL A . n A 1 60 GLN 60 320 320 GLN GLN A . n A 1 61 VAL 61 321 321 VAL VAL A . n A 1 62 ILE 62 322 322 ILE ILE A . n A 1 63 ASP 63 323 323 ASP ASP A . n A 1 64 HIS 64 324 324 HIS HIS A . n A 1 65 ILE 65 325 325 ILE ILE A . n A 1 66 MET 66 326 326 MET MET A . n A 1 67 LYS 67 327 327 LYS LYS A . n A 1 68 THR 68 328 328 THR THR A . n A 1 69 ILE 69 329 329 ILE ILE A . n A 1 70 ASP 70 330 330 ASP ASP A . n A 1 71 ASP 71 331 331 ASP ASP A . n A 1 72 THR 72 332 332 THR THR A . n B 2 1 ASP 1 817 817 ASP ASP B . n B 2 2 ILE 2 818 818 ILE ILE B . n B 2 3 TYR 3 819 819 TYR TYR B . n B 2 4 THR 4 820 820 THR THR B . n B 2 5 TYR 5 821 821 TYR TYR B . n B 2 6 GLU 6 822 822 GLU GLU B . n B 2 7 LYS 7 823 823 LYS LYS B . n B 2 8 LYS 8 824 824 LYS LYS B . n B 2 9 LEU 9 825 825 LEU LEU B . n B 2 10 ILE 10 826 826 ILE ILE B . n B 2 11 LYS 11 827 827 LYS LYS B . n B 2 12 SER 12 828 828 SER SER B . n B 2 13 ILE 13 829 829 ILE ILE B . n B 2 14 GLU 14 830 830 GLU GLU B . n B 2 15 TYR 15 831 831 TYR TYR B . n B 2 16 ILE 16 832 832 ILE ILE B . n B 2 17 THR 17 833 833 THR THR B . n B 2 18 LYS 18 834 834 LYS LYS B . n B 2 19 ASN 19 835 835 ASN ASN B . n B 2 20 LYS 20 836 836 LYS LYS B . n B 2 21 PHE 21 837 837 PHE PHE B . n B 2 22 PHE 22 838 838 PHE PHE B . n B 2 23 ASP 23 839 839 ASP ASP B . n B 2 24 ASP 24 840 840 ASP ASP B . n B 2 25 SER 25 841 841 SER SER B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7QDW _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7QDW _struct.title 'Solution structure of the complex between plasmodial ZNHIT3 and NUFIP1 proteins' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7QDW _struct_keywords.text 'PAC-HIT FOLD, JAW HELICES, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP Q8I2Y4_PLAF7 Q8I2Y4 ? 1 DYDMLTEEQKKKLKEDHTLKILLKNNYVREVFKQFTLSNDKIGYLSHYINDPTIVQVIDHIMKTIDDT 265 2 UNP Q8IK99_PLAF7 Q8IK99 ? 2 DIYTYEKKLIKSIEYITKNKFFDDS 817 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7QDW A 5 ? 72 ? Q8I2Y4 265 ? 332 ? 265 332 2 2 7QDW B 1 ? 25 ? Q8IK99 817 ? 841 ? 817 841 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7QDW GLY A 1 ? UNP Q8I2Y4 ? ? 'expression tag' 261 1 1 7QDW PRO A 2 ? UNP Q8I2Y4 ? ? 'expression tag' 262 2 1 7QDW HIS A 3 ? UNP Q8I2Y4 ? ? 'expression tag' 263 3 1 7QDW MET A 4 ? UNP Q8I2Y4 ? ? 'expression tag' 264 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2250 ? 1 MORE -20 ? 1 'SSA (A^2)' 6750 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'NMR Distance Restraints' ? 2 1 'gel filtration' ? 3 1 'light scattering' ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 10 ? ASP A 20 ? THR A 270 ASP A 280 1 ? 11 HELX_P HELX_P2 AA2 ASP A 20 ? LYS A 28 ? ASP A 280 LYS A 288 1 ? 9 HELX_P HELX_P3 AA3 ASN A 29 ? SER A 42 ? ASN A 289 SER A 302 1 ? 14 HELX_P HELX_P4 AA4 ASP A 44 ? ILE A 53 ? ASP A 304 ILE A 313 1 ? 10 HELX_P HELX_P5 AA5 ASP A 55 ? ASP A 71 ? ASP A 315 ASP A 331 1 ? 17 HELX_P HELX_P6 AA6 ILE B 2 ? ASN B 19 ? ILE B 818 ASN B 835 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 NE A ARG 293 ? ? CZ A ARG 293 ? ? NH1 A ARG 293 ? ? 123.68 120.30 3.38 0.50 N 2 6 NE A ARG 293 ? ? CZ A ARG 293 ? ? NH1 A ARG 293 ? ? 123.78 120.30 3.48 0.50 N 3 11 NE A ARG 293 ? ? CZ A ARG 293 ? ? NH1 A ARG 293 ? ? 123.37 120.30 3.07 0.50 N 4 13 NE A ARG 293 ? ? CZ A ARG 293 ? ? NH1 A ARG 293 ? ? 123.69 120.30 3.39 0.50 N 5 14 NE A ARG 293 ? ? CZ A ARG 293 ? ? NH1 A ARG 293 ? ? 123.40 120.30 3.10 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 331 ? ? -87.19 38.58 2 2 ASP A 265 ? ? -92.16 42.81 3 2 ASP A 267 ? ? -78.70 34.88 4 2 ASP A 331 ? ? -83.03 35.64 5 3 ASP A 331 ? ? -88.64 39.65 6 3 ILE B 818 ? ? -149.34 -46.67 7 4 ASP A 267 ? ? -73.18 20.08 8 5 HIS A 263 ? ? 61.70 -52.05 9 5 TYR A 266 ? ? -78.12 34.54 10 5 ASP A 267 ? ? -82.15 48.95 11 5 ASP A 331 ? ? 58.38 12.05 12 5 ILE B 818 ? ? -142.65 -43.08 13 8 TYR A 266 ? ? -92.71 43.26 14 8 ILE B 818 ? ? -148.12 -50.08 15 9 HIS A 263 ? ? 53.31 -95.10 16 9 ASP A 265 ? ? -91.86 55.13 17 9 TYR A 266 ? ? -75.86 39.53 18 9 ASP B 839 ? ? -87.33 34.55 19 10 ASP A 331 ? ? 52.54 17.60 20 10 ASP B 839 ? ? 27.18 50.68 21 11 HIS A 263 ? ? -113.70 63.50 22 11 TYR A 266 ? ? -79.96 34.99 23 11 ASP A 304 ? ? -102.37 69.33 24 11 ILE B 818 ? ? -138.76 -38.40 25 13 TYR A 266 ? ? -95.73 35.18 26 13 ASP A 267 ? ? -83.52 47.83 27 15 ASP A 267 ? ? -93.07 40.64 28 17 MET A 264 ? ? 59.51 171.88 29 18 ASP A 267 ? ? -82.66 38.34 30 18 ASP A 331 ? ? 58.44 12.63 31 19 ASP A 267 ? ? -94.05 47.41 32 19 ASP A 331 ? ? 50.08 19.80 33 20 ASP A 265 ? ? -102.72 54.34 34 20 TYR A 266 ? ? -74.25 25.13 35 20 ASP A 331 ? ? -77.41 32.04 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 ARG A 293 ? ? 0.078 'SIDE CHAIN' 2 4 ARG A 293 ? ? 0.091 'SIDE CHAIN' 3 8 ARG A 293 ? ? 0.086 'SIDE CHAIN' 4 13 ARG A 293 ? ? 0.098 'SIDE CHAIN' 5 18 ARG A 293 ? ? 0.088 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 7QDW _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest restraint energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7QDW _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'structure with the lowest restraint energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;0.7 mM [U-100% 13C; U-100% 15N] pfZNHIT3, 0.7 mM [U-100% 13C; U-100% 15N] pfNUFIP1, 150 mM sodium chloride, 10 mM sodium phosphate, 95% H2O/5% D2O ; _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label cplx _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 pfZNHIT3 0.7 ? mM '[U-100% 13C; U-100% 15N]' 1 pfNUFIP1 0.7 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium chloride' 150 ? mM 'natural abundance' 1 'sodium phosphate' 10 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCA' 1 isotropic 2 1 1 '3D HNCACB' 1 isotropic 3 1 1 '3D CBCA(CO)NH' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HNCACO' 1 isotropic 8 1 1 '3D HBHA(CO)NH' 1 isotropic 7 1 1 '3D C(CO)NH' 1 isotropic 6 1 1 '3D H(CCO)NH' 1 isotropic 10 1 1 '3D HCCH-COSY' 1 isotropic 9 1 1 '3D HCCH-TOCSY' 1 isotropic 11 1 1 '3D HNHA' 1 isotropic 12 1 1 '3D HNCO ECosy' 1 isotropic 15 1 1 '2D 1H-1H NOESY' 1 isotropic 14 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 13 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic 16 1 1 '3D 1H-15N NOESY' 1 isotropic 17 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 18 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 19 1 1 '2D 1H-15N HSQC' 1 isotropic # _pdbx_nmr_refine.entry_id 7QDW _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 7 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin 3.6.2 'Bruker Biospin' 2 'chemical shift assignment' CARA ? 'Keller and Wuthrich' 3 processing TopSpin 3.6.2 'Bruker Biospin' 4 'peak picking' CARA ? 'Keller and Wuthrich' 5 'structure calculation' TALOS-N ? 'Yang Shen, and Ad Bax' 6 'structure calculation' CYANA 3.98.13 'Guntert, Mumenthaler and Wuthrich' 7 refinement Amber 14 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 MET N N N N 200 MET CA C N S 201 MET C C N N 202 MET O O N N 203 MET CB C N N 204 MET CG C N N 205 MET SD S N N 206 MET CE C N N 207 MET OXT O N N 208 MET H H N N 209 MET H2 H N N 210 MET HA H N N 211 MET HB2 H N N 212 MET HB3 H N N 213 MET HG2 H N N 214 MET HG3 H N N 215 MET HE1 H N N 216 MET HE2 H N N 217 MET HE3 H N N 218 MET HXT H N N 219 PHE N N N N 220 PHE CA C N S 221 PHE C C N N 222 PHE O O N N 223 PHE CB C N N 224 PHE CG C Y N 225 PHE CD1 C Y N 226 PHE CD2 C Y N 227 PHE CE1 C Y N 228 PHE CE2 C Y N 229 PHE CZ C Y N 230 PHE OXT O N N 231 PHE H H N N 232 PHE H2 H N N 233 PHE HA H N N 234 PHE HB2 H N N 235 PHE HB3 H N N 236 PHE HD1 H N N 237 PHE HD2 H N N 238 PHE HE1 H N N 239 PHE HE2 H N N 240 PHE HZ H N N 241 PHE HXT H N N 242 PRO N N N N 243 PRO CA C N S 244 PRO C C N N 245 PRO O O N N 246 PRO CB C N N 247 PRO CG C N N 248 PRO CD C N N 249 PRO OXT O N N 250 PRO H H N N 251 PRO HA H N N 252 PRO HB2 H N N 253 PRO HB3 H N N 254 PRO HG2 H N N 255 PRO HG3 H N N 256 PRO HD2 H N N 257 PRO HD3 H N N 258 PRO HXT H N N 259 SER N N N N 260 SER CA C N S 261 SER C C N N 262 SER O O N N 263 SER CB C N N 264 SER OG O N N 265 SER OXT O N N 266 SER H H N N 267 SER H2 H N N 268 SER HA H N N 269 SER HB2 H N N 270 SER HB3 H N N 271 SER HG H N N 272 SER HXT H N N 273 THR N N N N 274 THR CA C N S 275 THR C C N N 276 THR O O N N 277 THR CB C N R 278 THR OG1 O N N 279 THR CG2 C N N 280 THR OXT O N N 281 THR H H N N 282 THR H2 H N N 283 THR HA H N N 284 THR HB H N N 285 THR HG1 H N N 286 THR HG21 H N N 287 THR HG22 H N N 288 THR HG23 H N N 289 THR HXT H N N 290 TYR N N N N 291 TYR CA C N S 292 TYR C C N N 293 TYR O O N N 294 TYR CB C N N 295 TYR CG C Y N 296 TYR CD1 C Y N 297 TYR CD2 C Y N 298 TYR CE1 C Y N 299 TYR CE2 C Y N 300 TYR CZ C Y N 301 TYR OH O N N 302 TYR OXT O N N 303 TYR H H N N 304 TYR H2 H N N 305 TYR HA H N N 306 TYR HB2 H N N 307 TYR HB3 H N N 308 TYR HD1 H N N 309 TYR HD2 H N N 310 TYR HE1 H N N 311 TYR HE2 H N N 312 TYR HH H N N 313 TYR HXT H N N 314 VAL N N N N 315 VAL CA C N S 316 VAL C C N N 317 VAL O O N N 318 VAL CB C N N 319 VAL CG1 C N N 320 VAL CG2 C N N 321 VAL OXT O N N 322 VAL H H N N 323 VAL H2 H N N 324 VAL HA H N N 325 VAL HB H N N 326 VAL HG11 H N N 327 VAL HG12 H N N 328 VAL HG13 H N N 329 VAL HG21 H N N 330 VAL HG22 H N N 331 VAL HG23 H N N 332 VAL HXT H N N 333 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 GLN N CA sing N N 58 GLN N H sing N N 59 GLN N H2 sing N N 60 GLN CA C sing N N 61 GLN CA CB sing N N 62 GLN CA HA sing N N 63 GLN C O doub N N 64 GLN C OXT sing N N 65 GLN CB CG sing N N 66 GLN CB HB2 sing N N 67 GLN CB HB3 sing N N 68 GLN CG CD sing N N 69 GLN CG HG2 sing N N 70 GLN CG HG3 sing N N 71 GLN CD OE1 doub N N 72 GLN CD NE2 sing N N 73 GLN NE2 HE21 sing N N 74 GLN NE2 HE22 sing N N 75 GLN OXT HXT sing N N 76 GLU N CA sing N N 77 GLU N H sing N N 78 GLU N H2 sing N N 79 GLU CA C sing N N 80 GLU CA CB sing N N 81 GLU CA HA sing N N 82 GLU C O doub N N 83 GLU C OXT sing N N 84 GLU CB CG sing N N 85 GLU CB HB2 sing N N 86 GLU CB HB3 sing N N 87 GLU CG CD sing N N 88 GLU CG HG2 sing N N 89 GLU CG HG3 sing N N 90 GLU CD OE1 doub N N 91 GLU CD OE2 sing N N 92 GLU OE2 HE2 sing N N 93 GLU OXT HXT sing N N 94 GLY N CA sing N N 95 GLY N H sing N N 96 GLY N H2 sing N N 97 GLY CA C sing N N 98 GLY CA HA2 sing N N 99 GLY CA HA3 sing N N 100 GLY C O doub N N 101 GLY C OXT sing N N 102 GLY OXT HXT sing N N 103 HIS N CA sing N N 104 HIS N H sing N N 105 HIS N H2 sing N N 106 HIS CA C sing N N 107 HIS CA CB sing N N 108 HIS CA HA sing N N 109 HIS C O doub N N 110 HIS C OXT sing N N 111 HIS CB CG sing N N 112 HIS CB HB2 sing N N 113 HIS CB HB3 sing N N 114 HIS CG ND1 sing Y N 115 HIS CG CD2 doub Y N 116 HIS ND1 CE1 doub Y N 117 HIS ND1 HD1 sing N N 118 HIS CD2 NE2 sing Y N 119 HIS CD2 HD2 sing N N 120 HIS CE1 NE2 sing Y N 121 HIS CE1 HE1 sing N N 122 HIS NE2 HE2 sing N N 123 HIS OXT HXT sing N N 124 ILE N CA sing N N 125 ILE N H sing N N 126 ILE N H2 sing N N 127 ILE CA C sing N N 128 ILE CA CB sing N N 129 ILE CA HA sing N N 130 ILE C O doub N N 131 ILE C OXT sing N N 132 ILE CB CG1 sing N N 133 ILE CB CG2 sing N N 134 ILE CB HB sing N N 135 ILE CG1 CD1 sing N N 136 ILE CG1 HG12 sing N N 137 ILE CG1 HG13 sing N N 138 ILE CG2 HG21 sing N N 139 ILE CG2 HG22 sing N N 140 ILE CG2 HG23 sing N N 141 ILE CD1 HD11 sing N N 142 ILE CD1 HD12 sing N N 143 ILE CD1 HD13 sing N N 144 ILE OXT HXT sing N N 145 LEU N CA sing N N 146 LEU N H sing N N 147 LEU N H2 sing N N 148 LEU CA C sing N N 149 LEU CA CB sing N N 150 LEU CA HA sing N N 151 LEU C O doub N N 152 LEU C OXT sing N N 153 LEU CB CG sing N N 154 LEU CB HB2 sing N N 155 LEU CB HB3 sing N N 156 LEU CG CD1 sing N N 157 LEU CG CD2 sing N N 158 LEU CG HG sing N N 159 LEU CD1 HD11 sing N N 160 LEU CD1 HD12 sing N N 161 LEU CD1 HD13 sing N N 162 LEU CD2 HD21 sing N N 163 LEU CD2 HD22 sing N N 164 LEU CD2 HD23 sing N N 165 LEU OXT HXT sing N N 166 LYS N CA sing N N 167 LYS N H sing N N 168 LYS N H2 sing N N 169 LYS CA C sing N N 170 LYS CA CB sing N N 171 LYS CA HA sing N N 172 LYS C O doub N N 173 LYS C OXT sing N N 174 LYS CB CG sing N N 175 LYS CB HB2 sing N N 176 LYS CB HB3 sing N N 177 LYS CG CD sing N N 178 LYS CG HG2 sing N N 179 LYS CG HG3 sing N N 180 LYS CD CE sing N N 181 LYS CD HD2 sing N N 182 LYS CD HD3 sing N N 183 LYS CE NZ sing N N 184 LYS CE HE2 sing N N 185 LYS CE HE3 sing N N 186 LYS NZ HZ1 sing N N 187 LYS NZ HZ2 sing N N 188 LYS NZ HZ3 sing N N 189 LYS OXT HXT sing N N 190 MET N CA sing N N 191 MET N H sing N N 192 MET N H2 sing N N 193 MET CA C sing N N 194 MET CA CB sing N N 195 MET CA HA sing N N 196 MET C O doub N N 197 MET C OXT sing N N 198 MET CB CG sing N N 199 MET CB HB2 sing N N 200 MET CB HB3 sing N N 201 MET CG SD sing N N 202 MET CG HG2 sing N N 203 MET CG HG3 sing N N 204 MET SD CE sing N N 205 MET CE HE1 sing N N 206 MET CE HE2 sing N N 207 MET CE HE3 sing N N 208 MET OXT HXT sing N N 209 PHE N CA sing N N 210 PHE N H sing N N 211 PHE N H2 sing N N 212 PHE CA C sing N N 213 PHE CA CB sing N N 214 PHE CA HA sing N N 215 PHE C O doub N N 216 PHE C OXT sing N N 217 PHE CB CG sing N N 218 PHE CB HB2 sing N N 219 PHE CB HB3 sing N N 220 PHE CG CD1 doub Y N 221 PHE CG CD2 sing Y N 222 PHE CD1 CE1 sing Y N 223 PHE CD1 HD1 sing N N 224 PHE CD2 CE2 doub Y N 225 PHE CD2 HD2 sing N N 226 PHE CE1 CZ doub Y N 227 PHE CE1 HE1 sing N N 228 PHE CE2 CZ sing Y N 229 PHE CE2 HE2 sing N N 230 PHE CZ HZ sing N N 231 PHE OXT HXT sing N N 232 PRO N CA sing N N 233 PRO N CD sing N N 234 PRO N H sing N N 235 PRO CA C sing N N 236 PRO CA CB sing N N 237 PRO CA HA sing N N 238 PRO C O doub N N 239 PRO C OXT sing N N 240 PRO CB CG sing N N 241 PRO CB HB2 sing N N 242 PRO CB HB3 sing N N 243 PRO CG CD sing N N 244 PRO CG HG2 sing N N 245 PRO CG HG3 sing N N 246 PRO CD HD2 sing N N 247 PRO CD HD3 sing N N 248 PRO OXT HXT sing N N 249 SER N CA sing N N 250 SER N H sing N N 251 SER N H2 sing N N 252 SER CA C sing N N 253 SER CA CB sing N N 254 SER CA HA sing N N 255 SER C O doub N N 256 SER C OXT sing N N 257 SER CB OG sing N N 258 SER CB HB2 sing N N 259 SER CB HB3 sing N N 260 SER OG HG sing N N 261 SER OXT HXT sing N N 262 THR N CA sing N N 263 THR N H sing N N 264 THR N H2 sing N N 265 THR CA C sing N N 266 THR CA CB sing N N 267 THR CA HA sing N N 268 THR C O doub N N 269 THR C OXT sing N N 270 THR CB OG1 sing N N 271 THR CB CG2 sing N N 272 THR CB HB sing N N 273 THR OG1 HG1 sing N N 274 THR CG2 HG21 sing N N 275 THR CG2 HG22 sing N N 276 THR CG2 HG23 sing N N 277 THR OXT HXT sing N N 278 TYR N CA sing N N 279 TYR N H sing N N 280 TYR N H2 sing N N 281 TYR CA C sing N N 282 TYR CA CB sing N N 283 TYR CA HA sing N N 284 TYR C O doub N N 285 TYR C OXT sing N N 286 TYR CB CG sing N N 287 TYR CB HB2 sing N N 288 TYR CB HB3 sing N N 289 TYR CG CD1 doub Y N 290 TYR CG CD2 sing Y N 291 TYR CD1 CE1 sing Y N 292 TYR CD1 HD1 sing N N 293 TYR CD2 CE2 doub Y N 294 TYR CD2 HD2 sing N N 295 TYR CE1 CZ doub Y N 296 TYR CE1 HE1 sing N N 297 TYR CE2 CZ sing Y N 298 TYR CE2 HE2 sing N N 299 TYR CZ OH sing N N 300 TYR OH HH sing N N 301 TYR OXT HXT sing N N 302 VAL N CA sing N N 303 VAL N H sing N N 304 VAL N H2 sing N N 305 VAL CA C sing N N 306 VAL CA CB sing N N 307 VAL CA HA sing N N 308 VAL C O doub N N 309 VAL C OXT sing N N 310 VAL CB CG1 sing N N 311 VAL CB CG2 sing N N 312 VAL CB HB sing N N 313 VAL CG1 HG11 sing N N 314 VAL CG1 HG12 sing N N 315 VAL CG1 HG13 sing N N 316 VAL CG2 HG21 sing N N 317 VAL CG2 HG22 sing N N 318 VAL CG2 HG23 sing N N 319 VAL OXT HXT sing N N 320 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'French National Research Agency' France ANR-11-BSV8-01503 1 'French National Research Agency' France 'ANR-16-CE11-0032-02]' 2 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details cryoprobe # _atom_sites.entry_id 7QDW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_