data_7QEH # _entry.id 7QEH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7QEH pdb_00007qeh 10.2210/pdb7qeh/pdb WWPDB D_1292119510 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-12-14 2 'Structure model' 1 1 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' citation 4 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7QEH _pdbx_database_status.recvd_initial_deposition_date 2021-12-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email tea.pavkov@uni-graz.at _pdbx_contact_author.name_first Tea _pdbx_contact_author.name_last Pavkov-Keller _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7871-6680 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Eder, M.' 1 0000-0002-0580-4564 'Dordic, A.' 2 ? 'Sagmeister, T.' 3 0000-0002-6703-5510 'Pavkov-Keller, T.' 4 0000-0001-7871-6680 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 121 _citation.language ? _citation.page_first e2401686121 _citation.page_last e2401686121 _citation.title 'The molecular architecture of Lactobacillus S-layer: Assembly and attachment to teichoic acids.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2401686121 _citation.pdbx_database_id_PubMed 38838019 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sagmeister, T.' 1 ? primary 'Gubensak, N.' 2 0000-0002-0415-4299 primary 'Buhlheller, C.' 3 0000-0001-9358-5316 primary 'Grininger, C.' 4 0000-0002-1154-4244 primary 'Eder, M.' 5 0000-0002-0580-4564 primary 'Ðordic, A.' 6 ? primary 'Millan, C.' 7 ? primary 'Medina, A.' 8 ? primary 'Murcia, P.A.S.' 9 ? primary 'Berni, F.' 10 ? primary 'Hynonen, U.' 11 ? primary 'Vejzovic, D.' 12 0000-0002-7526-4399 primary 'Damisch, E.' 13 0000-0003-0833-8412 primary 'Kulminskaya, N.' 14 ? primary 'Petrowitsch, L.' 15 0009-0001-7304-2231 primary 'Oberer, M.' 16 ? primary 'Palva, A.' 17 ? primary 'Malanovic, N.' 18 ? primary 'Codee, J.' 19 0000-0003-3531-2138 primary 'Keller, W.' 20 0000-0002-2261-958X primary 'Uson, I.' 21 0000-0003-2504-1696 primary 'Pavkov-Keller, T.' 22 0000-0001-7871-6680 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man S-layer 16231.854 1 ? ? ? ? 2 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 3 water nat water 18.015 75 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)VSVANAAQTPAAQETTKNVTI(MSE)HISTIYDKTGKATNEPALRAYDTVSVVSDPVTINNAKFYKLAGKDQYIK VGNVDGTSRTLKHNSYVYKSSGKRANKKTLKKGSSVTTYGKSF(MSE)IAGHQ(MSE)YRIGKNQYVKKANFLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MVSVANAAQTPAAQETTKNVTIMHISTIYDKTGKATNEPALRAYDTVSVVSDPVTINNAKFYKLAGKDQYIKVGNVDGTS RTLKHNSYVYKSSGKRANKKTLKKGSSVTTYGKSFMIAGHQMYRIGKNQYVKKANFLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHATE ION' PO4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 VAL n 1 3 SER n 1 4 VAL n 1 5 ALA n 1 6 ASN n 1 7 ALA n 1 8 ALA n 1 9 GLN n 1 10 THR n 1 11 PRO n 1 12 ALA n 1 13 ALA n 1 14 GLN n 1 15 GLU n 1 16 THR n 1 17 THR n 1 18 LYS n 1 19 ASN n 1 20 VAL n 1 21 THR n 1 22 ILE n 1 23 MSE n 1 24 HIS n 1 25 ILE n 1 26 SER n 1 27 THR n 1 28 ILE n 1 29 TYR n 1 30 ASP n 1 31 LYS n 1 32 THR n 1 33 GLY n 1 34 LYS n 1 35 ALA n 1 36 THR n 1 37 ASN n 1 38 GLU n 1 39 PRO n 1 40 ALA n 1 41 LEU n 1 42 ARG n 1 43 ALA n 1 44 TYR n 1 45 ASP n 1 46 THR n 1 47 VAL n 1 48 SER n 1 49 VAL n 1 50 VAL n 1 51 SER n 1 52 ASP n 1 53 PRO n 1 54 VAL n 1 55 THR n 1 56 ILE n 1 57 ASN n 1 58 ASN n 1 59 ALA n 1 60 LYS n 1 61 PHE n 1 62 TYR n 1 63 LYS n 1 64 LEU n 1 65 ALA n 1 66 GLY n 1 67 LYS n 1 68 ASP n 1 69 GLN n 1 70 TYR n 1 71 ILE n 1 72 LYS n 1 73 VAL n 1 74 GLY n 1 75 ASN n 1 76 VAL n 1 77 ASP n 1 78 GLY n 1 79 THR n 1 80 SER n 1 81 ARG n 1 82 THR n 1 83 LEU n 1 84 LYS n 1 85 HIS n 1 86 ASN n 1 87 SER n 1 88 TYR n 1 89 VAL n 1 90 TYR n 1 91 LYS n 1 92 SER n 1 93 SER n 1 94 GLY n 1 95 LYS n 1 96 ARG n 1 97 ALA n 1 98 ASN n 1 99 LYS n 1 100 LYS n 1 101 THR n 1 102 LEU n 1 103 LYS n 1 104 LYS n 1 105 GLY n 1 106 SER n 1 107 SER n 1 108 VAL n 1 109 THR n 1 110 THR n 1 111 TYR n 1 112 GLY n 1 113 LYS n 1 114 SER n 1 115 PHE n 1 116 MSE n 1 117 ILE n 1 118 ALA n 1 119 GLY n 1 120 HIS n 1 121 GLN n 1 122 MSE n 1 123 TYR n 1 124 ARG n 1 125 ILE n 1 126 GLY n 1 127 LYS n 1 128 ASN n 1 129 GLN n 1 130 TYR n 1 131 VAL n 1 132 LYS n 1 133 LYS n 1 134 ALA n 1 135 ASN n 1 136 PHE n 1 137 LEU n 1 138 GLU n 1 139 HIS n 1 140 HIS n 1 141 HIS n 1 142 HIS n 1 143 HIS n 1 144 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 144 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene LA2_00970 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'GRL 1112' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactobacillus amylovorus (strain GRL 1112)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 695560 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 321 ? ? ? A . n A 1 2 VAL 2 322 ? ? ? A . n A 1 3 SER 3 323 ? ? ? A . n A 1 4 VAL 4 324 ? ? ? A . n A 1 5 ALA 5 325 ? ? ? A . n A 1 6 ASN 6 326 ? ? ? A . n A 1 7 ALA 7 327 ? ? ? A . n A 1 8 ALA 8 328 ? ? ? A . n A 1 9 GLN 9 329 ? ? ? A . n A 1 10 THR 10 330 ? ? ? A . n A 1 11 PRO 11 331 ? ? ? A . n A 1 12 ALA 12 332 ? ? ? A . n A 1 13 ALA 13 333 ? ? ? A . n A 1 14 GLN 14 334 ? ? ? A . n A 1 15 GLU 15 335 335 GLU GLU A . n A 1 16 THR 16 336 336 THR THR A . n A 1 17 THR 17 337 337 THR THR A . n A 1 18 LYS 18 338 338 LYS LYS A . n A 1 19 ASN 19 339 339 ASN ASN A . n A 1 20 VAL 20 340 340 VAL VAL A . n A 1 21 THR 21 341 341 THR THR A . n A 1 22 ILE 22 342 342 ILE ILE A . n A 1 23 MSE 23 343 343 MSE MSE A . n A 1 24 HIS 24 344 344 HIS HIS A . n A 1 25 ILE 25 345 345 ILE ILE A . n A 1 26 SER 26 346 346 SER SER A . n A 1 27 THR 27 347 347 THR THR A . n A 1 28 ILE 28 348 348 ILE ILE A . n A 1 29 TYR 29 349 349 TYR TYR A . n A 1 30 ASP 30 350 350 ASP ASP A . n A 1 31 LYS 31 351 351 LYS LYS A . n A 1 32 THR 32 352 352 THR THR A . n A 1 33 GLY 33 353 353 GLY GLY A . n A 1 34 LYS 34 354 354 LYS LYS A . n A 1 35 ALA 35 355 355 ALA ALA A . n A 1 36 THR 36 356 356 THR THR A . n A 1 37 ASN 37 357 357 ASN ASN A . n A 1 38 GLU 38 358 358 GLU GLU A . n A 1 39 PRO 39 359 359 PRO PRO A . n A 1 40 ALA 40 360 360 ALA ALA A . n A 1 41 LEU 41 361 361 LEU LEU A . n A 1 42 ARG 42 362 362 ARG ARG A . n A 1 43 ALA 43 363 363 ALA ALA A . n A 1 44 TYR 44 364 364 TYR TYR A . n A 1 45 ASP 45 365 365 ASP ASP A . n A 1 46 THR 46 366 366 THR THR A . n A 1 47 VAL 47 367 367 VAL VAL A . n A 1 48 SER 48 368 368 SER SER A . n A 1 49 VAL 49 369 369 VAL VAL A . n A 1 50 VAL 50 370 370 VAL VAL A . n A 1 51 SER 51 371 371 SER SER A . n A 1 52 ASP 52 372 372 ASP ASP A . n A 1 53 PRO 53 373 373 PRO PRO A . n A 1 54 VAL 54 374 374 VAL VAL A . n A 1 55 THR 55 375 375 THR THR A . n A 1 56 ILE 56 376 376 ILE ILE A . n A 1 57 ASN 57 377 377 ASN ASN A . n A 1 58 ASN 58 378 378 ASN ASN A . n A 1 59 ALA 59 379 379 ALA ALA A . n A 1 60 LYS 60 380 380 LYS LYS A . n A 1 61 PHE 61 381 381 PHE PHE A . n A 1 62 TYR 62 382 382 TYR TYR A . n A 1 63 LYS 63 383 383 LYS LYS A . n A 1 64 LEU 64 384 384 LEU LEU A . n A 1 65 ALA 65 385 385 ALA ALA A . n A 1 66 GLY 66 386 386 GLY GLY A . n A 1 67 LYS 67 387 387 LYS LYS A . n A 1 68 ASP 68 388 388 ASP ASP A . n A 1 69 GLN 69 389 389 GLN GLN A . n A 1 70 TYR 70 390 390 TYR TYR A . n A 1 71 ILE 71 391 391 ILE ILE A . n A 1 72 LYS 72 392 392 LYS LYS A . n A 1 73 VAL 73 393 393 VAL VAL A . n A 1 74 GLY 74 394 394 GLY GLY A . n A 1 75 ASN 75 395 395 ASN ASN A . n A 1 76 VAL 76 396 396 VAL VAL A . n A 1 77 ASP 77 397 397 ASP ASP A . n A 1 78 GLY 78 398 398 GLY GLY A . n A 1 79 THR 79 399 399 THR THR A . n A 1 80 SER 80 400 400 SER SER A . n A 1 81 ARG 81 401 401 ARG ARG A . n A 1 82 THR 82 402 402 THR THR A . n A 1 83 LEU 83 403 403 LEU LEU A . n A 1 84 LYS 84 404 404 LYS LYS A . n A 1 85 HIS 85 405 405 HIS HIS A . n A 1 86 ASN 86 406 406 ASN ASN A . n A 1 87 SER 87 407 407 SER SER A . n A 1 88 TYR 88 408 408 TYR TYR A . n A 1 89 VAL 89 409 409 VAL VAL A . n A 1 90 TYR 90 410 410 TYR TYR A . n A 1 91 LYS 91 411 411 LYS LYS A . n A 1 92 SER 92 412 412 SER SER A . n A 1 93 SER 93 413 413 SER SER A . n A 1 94 GLY 94 414 414 GLY GLY A . n A 1 95 LYS 95 415 415 LYS LYS A . n A 1 96 ARG 96 416 416 ARG ARG A . n A 1 97 ALA 97 417 417 ALA ALA A . n A 1 98 ASN 98 418 418 ASN ASN A . n A 1 99 LYS 99 419 419 LYS LYS A . n A 1 100 LYS 100 420 420 LYS LYS A . n A 1 101 THR 101 421 421 THR THR A . n A 1 102 LEU 102 422 422 LEU LEU A . n A 1 103 LYS 103 423 423 LYS LYS A . n A 1 104 LYS 104 424 424 LYS LYS A . n A 1 105 GLY 105 425 425 GLY GLY A . n A 1 106 SER 106 426 426 SER SER A . n A 1 107 SER 107 427 427 SER SER A . n A 1 108 VAL 108 428 428 VAL VAL A . n A 1 109 THR 109 429 429 THR THR A . n A 1 110 THR 110 430 430 THR THR A . n A 1 111 TYR 111 431 431 TYR TYR A . n A 1 112 GLY 112 432 432 GLY GLY A . n A 1 113 LYS 113 433 433 LYS LYS A . n A 1 114 SER 114 434 434 SER SER A . n A 1 115 PHE 115 435 435 PHE PHE A . n A 1 116 MSE 116 436 436 MSE MSE A . n A 1 117 ILE 117 437 437 ILE ILE A . n A 1 118 ALA 118 438 438 ALA ALA A . n A 1 119 GLY 119 439 439 GLY GLY A . n A 1 120 HIS 120 440 440 HIS HIS A . n A 1 121 GLN 121 441 441 GLN GLN A . n A 1 122 MSE 122 442 442 MSE MSE A . n A 1 123 TYR 123 443 443 TYR TYR A . n A 1 124 ARG 124 444 444 ARG ARG A . n A 1 125 ILE 125 445 445 ILE ILE A . n A 1 126 GLY 126 446 446 GLY GLY A . n A 1 127 LYS 127 447 447 LYS LYS A . n A 1 128 ASN 128 448 448 ASN ASN A . n A 1 129 GLN 129 449 449 GLN GLN A . n A 1 130 TYR 130 450 450 TYR TYR A . n A 1 131 VAL 131 451 451 VAL VAL A . n A 1 132 LYS 132 452 452 LYS LYS A . n A 1 133 LYS 133 453 453 LYS LYS A . n A 1 134 ALA 134 454 454 ALA ALA A . n A 1 135 ASN 135 455 455 ASN ASN A . n A 1 136 PHE 136 456 456 PHE PHE A . n A 1 137 LEU 137 457 457 LEU LEU A . n A 1 138 GLU 138 458 ? ? ? A . n A 1 139 HIS 139 459 ? ? ? A . n A 1 140 HIS 140 460 ? ? ? A . n A 1 141 HIS 141 461 ? ? ? A . n A 1 142 HIS 142 462 ? ? ? A . n A 1 143 HIS 143 463 ? ? ? A . n A 1 144 HIS 144 464 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PO4 1 501 1 PO4 PO4 A . C 3 HOH 1 601 73 HOH HOH A . C 3 HOH 2 602 52 HOH HOH A . C 3 HOH 3 603 67 HOH HOH A . C 3 HOH 4 604 63 HOH HOH A . C 3 HOH 5 605 50 HOH HOH A . C 3 HOH 6 606 39 HOH HOH A . C 3 HOH 7 607 47 HOH HOH A . C 3 HOH 8 608 54 HOH HOH A . C 3 HOH 9 609 36 HOH HOH A . C 3 HOH 10 610 11 HOH HOH A . C 3 HOH 11 611 20 HOH HOH A . C 3 HOH 12 612 19 HOH HOH A . C 3 HOH 13 613 14 HOH HOH A . C 3 HOH 14 614 71 HOH HOH A . C 3 HOH 15 615 22 HOH HOH A . C 3 HOH 16 616 3 HOH HOH A . C 3 HOH 17 617 65 HOH HOH A . C 3 HOH 18 618 23 HOH HOH A . C 3 HOH 19 619 25 HOH HOH A . C 3 HOH 20 620 49 HOH HOH A . C 3 HOH 21 621 27 HOH HOH A . C 3 HOH 22 622 66 HOH HOH A . C 3 HOH 23 623 13 HOH HOH A . C 3 HOH 24 624 21 HOH HOH A . C 3 HOH 25 625 68 HOH HOH A . C 3 HOH 26 626 6 HOH HOH A . C 3 HOH 27 627 26 HOH HOH A . C 3 HOH 28 628 9 HOH HOH A . C 3 HOH 29 629 84 HOH HOH A . C 3 HOH 30 630 4 HOH HOH A . C 3 HOH 31 631 43 HOH HOH A . C 3 HOH 32 632 7 HOH HOH A . C 3 HOH 33 633 30 HOH HOH A . C 3 HOH 34 634 28 HOH HOH A . C 3 HOH 35 635 5 HOH HOH A . C 3 HOH 36 636 48 HOH HOH A . C 3 HOH 37 637 18 HOH HOH A . C 3 HOH 38 638 64 HOH HOH A . C 3 HOH 39 639 12 HOH HOH A . C 3 HOH 40 640 55 HOH HOH A . C 3 HOH 41 641 10 HOH HOH A . C 3 HOH 42 642 29 HOH HOH A . C 3 HOH 43 643 34 HOH HOH A . C 3 HOH 44 644 17 HOH HOH A . C 3 HOH 45 645 24 HOH HOH A . C 3 HOH 46 646 45 HOH HOH A . C 3 HOH 47 647 56 HOH HOH A . C 3 HOH 48 648 37 HOH HOH A . C 3 HOH 49 649 58 HOH HOH A . C 3 HOH 50 650 41 HOH HOH A . C 3 HOH 51 651 33 HOH HOH A . C 3 HOH 52 652 61 HOH HOH A . C 3 HOH 53 653 83 HOH HOH A . C 3 HOH 54 654 31 HOH HOH A . C 3 HOH 55 655 40 HOH HOH A . C 3 HOH 56 656 51 HOH HOH A . C 3 HOH 57 657 15 HOH HOH A . C 3 HOH 58 658 46 HOH HOH A . C 3 HOH 59 659 38 HOH HOH A . C 3 HOH 60 660 32 HOH HOH A . C 3 HOH 61 661 85 HOH HOH A . C 3 HOH 62 662 74 HOH HOH A . C 3 HOH 63 663 2 HOH HOH A . C 3 HOH 64 664 60 HOH HOH A . C 3 HOH 65 665 42 HOH HOH A . C 3 HOH 66 666 35 HOH HOH A . C 3 HOH 67 667 80 HOH HOH A . C 3 HOH 68 668 81 HOH HOH A . C 3 HOH 69 669 86 HOH HOH A . C 3 HOH 70 670 82 HOH HOH A . C 3 HOH 71 671 62 HOH HOH A . C 3 HOH 72 672 44 HOH HOH A . C 3 HOH 73 673 72 HOH HOH A . C 3 HOH 74 674 57 HOH HOH A . C 3 HOH 75 675 69 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELXCD ? ? ? . 2 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? SHELXE ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7QEH _cell.details ? _cell.formula_units_Z ? _cell.length_a 30.561 _cell.length_a_esd ? _cell.length_b 43.481 _cell.length_b_esd ? _cell.length_c 89.107 _cell.length_c_esd ? _cell.volume 118407.417 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7QEH _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7QEH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.83 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 32.75 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Morpheus screen condition #2-29 (20 mM of each carboxylic acid (sodium formate, ammonium acetate, sodium citrate tribasic dehydrate, sodium potassium tartrate tetrahydrate, and sodium oxamate), 0.1 M sodium HEPES- MOPS pH 7.5 with 20 % v/v PEG 500 MME and 10 % w/v PEG 20000). A protein stock solution of 20 mg/mL in 10 mM HEPES pH 7 and 100 mM NaCl was used. 1uL drop with 1:1 ration protein to reservoir solution. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-03-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9789 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9789 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 18.71 _reflns.entry_id 7QEH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.67 _reflns.d_resolution_low 39.08 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 26186 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.39 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.2 _reflns.pdbx_Rmerge_I_obs 0.109 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.84 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.114 _reflns.pdbx_Rpim_I_all 0.032 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star 1 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.67 _reflns_shell.d_res_low 1.734 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1361 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.86 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.316 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.805 _reflns_shell.pdbx_CC_star 0.947 _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 24.47 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7QEH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.67 _refine.ls_d_res_low 39.08 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 26185 _refine.ls_number_reflns_R_free 2612 _refine.ls_number_reflns_R_work 23573 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.16 _refine.ls_percent_reflns_R_free 9.98 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1655 _refine.ls_R_factor_R_free 0.1904 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1626 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 17.8422 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1598 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.67 _refine_hist.d_res_low 39.08 _refine_hist.number_atoms_solvent 75 _refine_hist.number_atoms_total 1045 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 965 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0091 ? 994 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9983 ? 1336 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0666 ? 150 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0056 ? 164 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.9280 ? 603 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.67 1.71 . . 123 1079 85.31 . . . 0.2756 . 0.2752 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.71 1.74 . . 143 1235 99.93 . . . 0.2084 . 0.1992 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.74 1.77 . . 136 1253 99.86 . . . 0.2359 . 0.1911 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.77 1.81 . . 141 1236 99.78 . . . 0.2263 . 0.1752 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.81 1.85 . . 135 1237 100.00 . . . 0.2454 . 0.1755 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.85 1.90 . . 145 1273 100.00 . . . 0.2197 . 0.1661 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.90 1.95 . . 133 1231 100.00 . . . 0.2429 . 0.1596 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.95 2.01 . . 142 1263 100.00 . . . 0.1684 . 0.1627 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.01 2.07 . . 131 1266 100.00 . . . 0.1802 . 0.1479 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.07 2.15 . . 134 1247 99.93 . . . 0.2461 . 0.1645 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.15 2.23 . . 135 1249 99.93 . . . 0.1880 . 0.1476 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.23 2.34 . . 140 1259 100.00 . . . 0.1825 . 0.1603 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.34 2.46 . . 142 1233 100.00 . . . 0.2030 . 0.1587 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.46 2.61 . . 138 1254 100.00 . . . 0.1985 . 0.1766 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.61 2.81 . . 141 1265 100.00 . . . 0.1885 . 0.1691 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.81 3.10 . . 140 1255 100.00 . . . 0.1911 . 0.1716 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.10 3.55 . . 130 1241 99.71 . . . 0.1816 . 0.1504 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.55 4.47 . . 141 1264 99.93 . . . 0.1559 . 0.1410 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.47 39.08 . . 142 1233 100.00 . . . 0.1783 . 0.1676 . . . . . . . . . . . # _struct.entry_id 7QEH _struct.title 'LTA-binding domain of SlpA, the S-layer protein from Lactobacillus amylovorus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7QEH _struct_keywords.text 's-layer, LTA-binding, lactobacillus amylovorus, polymer binding, CELL ADHESION' _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code E4SK47_LACAR _struct_ref.pdbx_db_accession E4SK47 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VSVANAAQTPAAQETTKNVTIMHISTIYDKTGKATNEPALRAYDTVSVVSDPVTINNAKFYKLAGKDQYIKVGNVDGTSR TLKHNSYVYKSSGKRANKKTLKKGSSVTTYGKSFMIAGHQMYRIGKNQYVKKANF ; _struct_ref.pdbx_align_begin 322 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7QEH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 136 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession E4SK47 _struct_ref_seq.db_align_beg 322 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 456 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 322 _struct_ref_seq.pdbx_auth_seq_align_end 456 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7QEH MSE A 1 ? UNP E4SK47 ? ? 'initiating methionine' 321 1 1 7QEH LEU A 137 ? UNP E4SK47 ? ? 'expression tag' 457 2 1 7QEH GLU A 138 ? UNP E4SK47 ? ? 'expression tag' 458 3 1 7QEH HIS A 139 ? UNP E4SK47 ? ? 'expression tag' 459 4 1 7QEH HIS A 140 ? UNP E4SK47 ? ? 'expression tag' 460 5 1 7QEH HIS A 141 ? UNP E4SK47 ? ? 'expression tag' 461 6 1 7QEH HIS A 142 ? UNP E4SK47 ? ? 'expression tag' 462 7 1 7QEH HIS A 143 ? UNP E4SK47 ? ? 'expression tag' 463 8 1 7QEH HIS A 144 ? UNP E4SK47 ? ? 'expression tag' 464 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 74 ? VAL A 76 ? GLY A 394 VAL A 396 5 ? 3 HELX_P HELX_P2 AA2 ALA A 134 ? PHE A 136 ? ALA A 454 PHE A 456 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ILE 22 C ? ? ? 1_555 A MSE 23 N ? ? A ILE 342 A MSE 343 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? A MSE 23 C ? ? ? 1_555 A HIS 24 N ? ? A MSE 343 A HIS 344 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale3 covale both ? A PHE 115 C ? ? ? 1_555 A MSE 116 N A ? A PHE 435 A MSE 436 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale4 covale both ? A PHE 115 C ? ? ? 1_555 A MSE 116 N B ? A PHE 435 A MSE 436 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale5 covale both ? A MSE 116 C A ? ? 1_555 A ILE 117 N ? ? A MSE 436 A ILE 437 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale6 covale both ? A MSE 116 C B ? ? 1_555 A ILE 117 N ? ? A MSE 436 A ILE 437 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale7 covale both ? A GLN 121 C ? ? ? 1_555 A MSE 122 N ? ? A GLN 441 A MSE 442 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale8 covale both ? A MSE 122 C ? ? ? 1_555 A TYR 123 N ? ? A MSE 442 A TYR 443 1_555 ? ? ? ? ? ? ? 1.333 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? AA3 ? 4 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 17 ? THR A 21 ? THR A 337 THR A 341 AA1 2 THR A 46 ? VAL A 50 ? THR A 366 VAL A 370 AA2 1 VAL A 54 ? ILE A 56 ? VAL A 374 ILE A 376 AA2 2 ALA A 59 ? LYS A 63 ? ALA A 379 LYS A 383 AA2 3 TYR A 70 ? LYS A 72 ? TYR A 390 LYS A 392 AA3 1 THR A 79 ? THR A 82 ? THR A 399 THR A 402 AA3 2 SER A 107 ? ILE A 117 ? SER A 427 ILE A 437 AA3 3 HIS A 120 ? GLY A 126 ? HIS A 440 GLY A 446 AA3 4 GLN A 129 ? LYS A 132 ? GLN A 449 LYS A 452 AA4 1 SER A 87 ? TYR A 90 ? SER A 407 TYR A 410 AA4 2 ARG A 96 ? LEU A 102 ? ARG A 416 LEU A 422 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 18 ? N LYS A 338 O VAL A 49 ? O VAL A 369 AA2 1 2 N ILE A 56 ? N ILE A 376 O ALA A 59 ? O ALA A 379 AA2 2 3 N TYR A 62 ? N TYR A 382 O ILE A 71 ? O ILE A 391 AA3 1 2 N ARG A 81 ? N ARG A 401 O VAL A 108 ? O VAL A 428 AA3 2 3 N PHE A 115 ? N PHE A 435 O MSE A 122 ? O MSE A 442 AA3 3 4 N TYR A 123 ? N TYR A 443 O VAL A 131 ? O VAL A 451 AA4 1 2 N SER A 87 ? N SER A 407 O LEU A 102 ? O LEU A 422 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 629 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 653 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_456 _pdbx_validate_symm_contact.dist 2.10 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 378 ? ? 59.76 12.76 2 1 VAL A 396 ? ? -122.65 -60.19 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 23 A MSE 343 ? MET 'modified residue' 2 A MSE 116 A MSE 436 ? MET 'modified residue' 3 A MSE 122 A MSE 442 ? MET 'modified residue' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # _pdbx_entry_details.entry_id 7QEH _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 321 ? A MSE 1 2 1 Y 1 A VAL 322 ? A VAL 2 3 1 Y 1 A SER 323 ? A SER 3 4 1 Y 1 A VAL 324 ? A VAL 4 5 1 Y 1 A ALA 325 ? A ALA 5 6 1 Y 1 A ASN 326 ? A ASN 6 7 1 Y 1 A ALA 327 ? A ALA 7 8 1 Y 1 A ALA 328 ? A ALA 8 9 1 Y 1 A GLN 329 ? A GLN 9 10 1 Y 1 A THR 330 ? A THR 10 11 1 Y 1 A PRO 331 ? A PRO 11 12 1 Y 1 A ALA 332 ? A ALA 12 13 1 Y 1 A ALA 333 ? A ALA 13 14 1 Y 1 A GLN 334 ? A GLN 14 15 1 Y 1 A GLU 458 ? A GLU 138 16 1 Y 1 A HIS 459 ? A HIS 139 17 1 Y 1 A HIS 460 ? A HIS 140 18 1 Y 1 A HIS 461 ? A HIS 141 19 1 Y 1 A HIS 462 ? A HIS 142 20 1 Y 1 A HIS 463 ? A HIS 143 21 1 Y 1 A HIS 464 ? A HIS 144 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MSE N N N N 216 MSE CA C N S 217 MSE C C N N 218 MSE O O N N 219 MSE OXT O N N 220 MSE CB C N N 221 MSE CG C N N 222 MSE SE SE N N 223 MSE CE C N N 224 MSE H H N N 225 MSE H2 H N N 226 MSE HA H N N 227 MSE HXT H N N 228 MSE HB2 H N N 229 MSE HB3 H N N 230 MSE HG2 H N N 231 MSE HG3 H N N 232 MSE HE1 H N N 233 MSE HE2 H N N 234 MSE HE3 H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PO4 P P N N 259 PO4 O1 O N N 260 PO4 O2 O N N 261 PO4 O3 O N N 262 PO4 O4 O N N 263 PRO N N N N 264 PRO CA C N S 265 PRO C C N N 266 PRO O O N N 267 PRO CB C N N 268 PRO CG C N N 269 PRO CD C N N 270 PRO OXT O N N 271 PRO H H N N 272 PRO HA H N N 273 PRO HB2 H N N 274 PRO HB3 H N N 275 PRO HG2 H N N 276 PRO HG3 H N N 277 PRO HD2 H N N 278 PRO HD3 H N N 279 PRO HXT H N N 280 SER N N N N 281 SER CA C N S 282 SER C C N N 283 SER O O N N 284 SER CB C N N 285 SER OG O N N 286 SER OXT O N N 287 SER H H N N 288 SER H2 H N N 289 SER HA H N N 290 SER HB2 H N N 291 SER HB3 H N N 292 SER HG H N N 293 SER HXT H N N 294 THR N N N N 295 THR CA C N S 296 THR C C N N 297 THR O O N N 298 THR CB C N R 299 THR OG1 O N N 300 THR CG2 C N N 301 THR OXT O N N 302 THR H H N N 303 THR H2 H N N 304 THR HA H N N 305 THR HB H N N 306 THR HG1 H N N 307 THR HG21 H N N 308 THR HG22 H N N 309 THR HG23 H N N 310 THR HXT H N N 311 TYR N N N N 312 TYR CA C N S 313 TYR C C N N 314 TYR O O N N 315 TYR CB C N N 316 TYR CG C Y N 317 TYR CD1 C Y N 318 TYR CD2 C Y N 319 TYR CE1 C Y N 320 TYR CE2 C Y N 321 TYR CZ C Y N 322 TYR OH O N N 323 TYR OXT O N N 324 TYR H H N N 325 TYR H2 H N N 326 TYR HA H N N 327 TYR HB2 H N N 328 TYR HB3 H N N 329 TYR HD1 H N N 330 TYR HD2 H N N 331 TYR HE1 H N N 332 TYR HE2 H N N 333 TYR HH H N N 334 TYR HXT H N N 335 VAL N N N N 336 VAL CA C N S 337 VAL C C N N 338 VAL O O N N 339 VAL CB C N N 340 VAL CG1 C N N 341 VAL CG2 C N N 342 VAL OXT O N N 343 VAL H H N N 344 VAL H2 H N N 345 VAL HA H N N 346 VAL HB H N N 347 VAL HG11 H N N 348 VAL HG12 H N N 349 VAL HG13 H N N 350 VAL HG21 H N N 351 VAL HG22 H N N 352 VAL HG23 H N N 353 VAL HXT H N N 354 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MSE N CA sing N N 205 MSE N H sing N N 206 MSE N H2 sing N N 207 MSE CA C sing N N 208 MSE CA CB sing N N 209 MSE CA HA sing N N 210 MSE C O doub N N 211 MSE C OXT sing N N 212 MSE OXT HXT sing N N 213 MSE CB CG sing N N 214 MSE CB HB2 sing N N 215 MSE CB HB3 sing N N 216 MSE CG SE sing N N 217 MSE CG HG2 sing N N 218 MSE CG HG3 sing N N 219 MSE SE CE sing N N 220 MSE CE HE1 sing N N 221 MSE CE HE2 sing N N 222 MSE CE HE3 sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PO4 P O1 doub N N 247 PO4 P O2 sing N N 248 PO4 P O3 sing N N 249 PO4 P O4 sing N N 250 PRO N CA sing N N 251 PRO N CD sing N N 252 PRO N H sing N N 253 PRO CA C sing N N 254 PRO CA CB sing N N 255 PRO CA HA sing N N 256 PRO C O doub N N 257 PRO C OXT sing N N 258 PRO CB CG sing N N 259 PRO CB HB2 sing N N 260 PRO CB HB3 sing N N 261 PRO CG CD sing N N 262 PRO CG HG2 sing N N 263 PRO CG HG3 sing N N 264 PRO CD HD2 sing N N 265 PRO CD HD3 sing N N 266 PRO OXT HXT sing N N 267 SER N CA sing N N 268 SER N H sing N N 269 SER N H2 sing N N 270 SER CA C sing N N 271 SER CA CB sing N N 272 SER CA HA sing N N 273 SER C O doub N N 274 SER C OXT sing N N 275 SER CB OG sing N N 276 SER CB HB2 sing N N 277 SER CB HB3 sing N N 278 SER OG HG sing N N 279 SER OXT HXT sing N N 280 THR N CA sing N N 281 THR N H sing N N 282 THR N H2 sing N N 283 THR CA C sing N N 284 THR CA CB sing N N 285 THR CA HA sing N N 286 THR C O doub N N 287 THR C OXT sing N N 288 THR CB OG1 sing N N 289 THR CB CG2 sing N N 290 THR CB HB sing N N 291 THR OG1 HG1 sing N N 292 THR CG2 HG21 sing N N 293 THR CG2 HG22 sing N N 294 THR CG2 HG23 sing N N 295 THR OXT HXT sing N N 296 TYR N CA sing N N 297 TYR N H sing N N 298 TYR N H2 sing N N 299 TYR CA C sing N N 300 TYR CA CB sing N N 301 TYR CA HA sing N N 302 TYR C O doub N N 303 TYR C OXT sing N N 304 TYR CB CG sing N N 305 TYR CB HB2 sing N N 306 TYR CB HB3 sing N N 307 TYR CG CD1 doub Y N 308 TYR CG CD2 sing Y N 309 TYR CD1 CE1 sing Y N 310 TYR CD1 HD1 sing N N 311 TYR CD2 CE2 doub Y N 312 TYR CD2 HD2 sing N N 313 TYR CE1 CZ doub Y N 314 TYR CE1 HE1 sing N N 315 TYR CE2 CZ sing Y N 316 TYR CE2 HE2 sing N N 317 TYR CZ OH sing N N 318 TYR OH HH sing N N 319 TYR OXT HXT sing N N 320 VAL N CA sing N N 321 VAL N H sing N N 322 VAL N H2 sing N N 323 VAL CA C sing N N 324 VAL CA CB sing N N 325 VAL CA HA sing N N 326 VAL C O doub N N 327 VAL C OXT sing N N 328 VAL CB CG1 sing N N 329 VAL CB CG2 sing N N 330 VAL CB HB sing N N 331 VAL CG1 HG11 sing N N 332 VAL CG1 HG12 sing N N 333 VAL CG1 HG13 sing N N 334 VAL CG2 HG21 sing N N 335 VAL CG2 HG22 sing N N 336 VAL CG2 HG23 sing N N 337 VAL OXT HXT sing N N 338 # _pdbx_audit_support.funding_organization 'Austrian Science Fund' _pdbx_audit_support.country Austria _pdbx_audit_support.grant_number P29432 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id PO4 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id PO4 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 7QEH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.032721 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022999 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011222 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? SE ? ? 26.02326 7.89457 ? ? 1.54240 29.12501 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_