data_7QFM
#
_entry.id 7QFM
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 5.397
_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
#
loop_
_database_2.database_id
_database_2.database_code
_database_2.pdbx_database_accession
_database_2.pdbx_DOI
PDB 7QFM pdb_00007qfm 10.2210/pdb7qfm/pdb
WWPDB D_1292117978 ? ?
#
loop_
_pdbx_audit_revision_history.ordinal
_pdbx_audit_revision_history.data_content_type
_pdbx_audit_revision_history.major_revision
_pdbx_audit_revision_history.minor_revision
_pdbx_audit_revision_history.revision_date
1 'Structure model' 1 0 2022-12-21
2 'Structure model' 1 1 2023-02-01
3 'Structure model' 1 2 2024-02-07
4 'Structure model' 1 3 2024-10-23
#
_pdbx_audit_revision_details.ordinal 1
_pdbx_audit_revision_details.revision_ordinal 1
_pdbx_audit_revision_details.data_content_type 'Structure model'
_pdbx_audit_revision_details.provider repository
_pdbx_audit_revision_details.type 'Initial release'
_pdbx_audit_revision_details.description ?
_pdbx_audit_revision_details.details ?
#
loop_
_pdbx_audit_revision_group.ordinal
_pdbx_audit_revision_group.revision_ordinal
_pdbx_audit_revision_group.data_content_type
_pdbx_audit_revision_group.group
1 2 'Structure model' 'Database references'
2 2 'Structure model' 'Source and taxonomy'
3 3 'Structure model' 'Data collection'
4 3 'Structure model' 'Refinement description'
5 4 'Structure model' 'Structure summary'
#
loop_
_pdbx_audit_revision_category.ordinal
_pdbx_audit_revision_category.revision_ordinal
_pdbx_audit_revision_category.data_content_type
_pdbx_audit_revision_category.category
1 2 'Structure model' citation
2 2 'Structure model' citation_author
3 2 'Structure model' entity_src_gen
4 2 'Structure model' pdbx_entity_src_syn
5 3 'Structure model' chem_comp_atom
6 3 'Structure model' chem_comp_bond
7 3 'Structure model' pdbx_initial_refinement_model
8 4 'Structure model' pdbx_entry_details
9 4 'Structure model' pdbx_modification_feature
#
loop_
_pdbx_audit_revision_item.ordinal
_pdbx_audit_revision_item.revision_ordinal
_pdbx_audit_revision_item.data_content_type
_pdbx_audit_revision_item.item
1 2 'Structure model' '_citation.country'
2 2 'Structure model' '_citation.journal_abbrev'
3 2 'Structure model' '_citation.journal_id_ASTM'
4 2 'Structure model' '_citation.journal_id_CSD'
5 2 'Structure model' '_citation.journal_id_ISSN'
6 2 'Structure model' '_citation.journal_volume'
7 2 'Structure model' '_citation.page_first'
8 2 'Structure model' '_citation.page_last'
9 2 'Structure model' '_citation.pdbx_database_id_DOI'
10 2 'Structure model' '_citation.pdbx_database_id_PubMed'
11 2 'Structure model' '_citation.title'
12 2 'Structure model' '_citation.year'
13 2 'Structure model' '_entity_src_gen.gene_src_common_name'
14 2 'Structure model' '_pdbx_entity_src_syn.organism_scientific'
15 4 'Structure model' '_pdbx_entry_details.has_protein_modification'
#
_pdbx_database_status.status_code REL
_pdbx_database_status.status_code_sf REL
_pdbx_database_status.status_code_mr ?
_pdbx_database_status.entry_id 7QFM
_pdbx_database_status.recvd_initial_deposition_date 2021-12-06
_pdbx_database_status.SG_entry N
_pdbx_database_status.deposit_site PDBE
_pdbx_database_status.process_site PDBE
_pdbx_database_status.status_code_cs ?
_pdbx_database_status.status_code_nmr_data ?
_pdbx_database_status.methods_development_category ?
_pdbx_database_status.pdb_format_compatible Y
#
_pdbx_database_related.db_name PDB
_pdbx_database_related.details '7QB2 contains the same protein complexed with another inhibitor'
_pdbx_database_related.db_id 7QB2
_pdbx_database_related.content_type unspecified
#
_pdbx_contact_author.id 2
_pdbx_contact_author.email wibke.diederich@staff.uni-marburg.de
_pdbx_contact_author.name_first Wibke
_pdbx_contact_author.name_last Diederich
_pdbx_contact_author.name_mi E.
_pdbx_contact_author.role 'principal investigator/group leader'
_pdbx_contact_author.identifier_ORCID 0000-0001-5671-6575
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
_audit_author.identifier_ORCID
'Hochban, P.M.M.' 1 0000-0003-3526-7314
'Heine, A.' 2 0000-0002-5285-4089
'Diederich, W.E.' 3 0000-0001-5671-6575
#
_citation.abstract ?
_citation.abstract_id_CAS ?
_citation.book_id_ISBN ?
_citation.book_publisher ?
_citation.book_publisher_city ?
_citation.book_title ?
_citation.coordinate_linkage ?
_citation.country FR
_citation.database_id_Medline ?
_citation.details ?
_citation.id primary
_citation.journal_abbrev Eur.J.Med.Chem.
_citation.journal_id_ASTM EJMCA5
_citation.journal_id_CSD 0493
_citation.journal_id_ISSN 0223-5234
_citation.journal_full ?
_citation.journal_issue ?
_citation.journal_volume 245
_citation.language ?
_citation.page_first 114914
_citation.page_last 114914
_citation.title
;Pose, duplicate, then elaborate: Steps towards increased affinity for inhibitors targeting the specificity surface of the Pim-1 kinase.
;
_citation.year 2023
_citation.database_id_CSD ?
_citation.pdbx_database_id_DOI 10.1016/j.ejmech.2022.114914
_citation.pdbx_database_id_PubMed 36410167
_citation.pdbx_database_id_patent ?
_citation.unpublished_flag ?
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
_citation_author.identifier_ORCID
primary 'Heyder, L.' 1 ?
primary 'Hochban, P.M.M.' 2 ?
primary 'Taylor, C.' 3 ?
primary 'Chevillard, F.' 4 ?
primary 'Siefker, C.' 5 ?
primary 'Iking, C.' 6 ?
primary 'Borchardt, H.' 7 ?
primary 'Aigner, A.' 8 ?
primary 'Klebe, G.' 9 ?
primary 'Heine, A.' 10 ?
primary 'Kolb, P.' 11 ?
primary 'Diederich, W.E.' 12 ?
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.pdbx_ec
_entity.pdbx_mutation
_entity.pdbx_fragment
_entity.details
1 polymer man 'Serine/threonine-protein kinase pim-1' 35583.398 1 2.7.11.1 R250G ? ?
2 polymer syn Pimtide 1592.850 1 ? ? ? ?
3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ?
4 non-polymer syn '4-[(~{E})-(2-oxidanylidene-1~{H}-indol-3-ylidene)methyl]benzoic acid' 265.263 1 ? ? ? ?
5 water nat water 18.015 123 ? ? ? ?
#
loop_
_entity_poly.entity_id
_entity_poly.type
_entity_poly.nstd_linkage
_entity_poly.nstd_monomer
_entity_poly.pdbx_seq_one_letter_code
_entity_poly.pdbx_seq_one_letter_code_can
_entity_poly.pdbx_strand_id
_entity_poly.pdbx_target_identifier
1 'polypeptide(L)' no yes
;MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGEL
PNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHN
CGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
;
;MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGEL
PNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHN
CGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIGGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
;
A ?
2 'polypeptide(L)' no no ARKRRRHPSGPPTA ARKRRRHPSGPPTA D ?
#
loop_
_pdbx_entity_nonpoly.entity_id
_pdbx_entity_nonpoly.name
_pdbx_entity_nonpoly.comp_id
3 GLYCEROL GOL
4 '4-[(~{E})-(2-oxidanylidene-1~{H}-indol-3-ylidene)methyl]benzoic acid' AY3
5 water HOH
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 MET n
1 2 LEU n
1 3 LEU n
1 4 SER n
1 5 LYS n
1 6 ILE n
1 7 ASN n
1 8 SER n
1 9 LEU n
1 10 ALA n
1 11 HIS n
1 12 LEU n
1 13 ARG n
1 14 ALA n
1 15 ALA n
1 16 PRO n
1 17 CYS n
1 18 ASN n
1 19 ASP n
1 20 LEU n
1 21 HIS n
1 22 ALA n
1 23 THR n
1 24 LYS n
1 25 LEU n
1 26 ALA n
1 27 PRO n
1 28 GLY n
1 29 LYS n
1 30 GLU n
1 31 LYS n
1 32 GLU n
1 33 PRO n
1 34 LEU n
1 35 GLU n
1 36 SER n
1 37 GLN n
1 38 TYR n
1 39 GLN n
1 40 VAL n
1 41 GLY n
1 42 PRO n
1 43 LEU n
1 44 LEU n
1 45 GLY n
1 46 SER n
1 47 GLY n
1 48 GLY n
1 49 PHE n
1 50 GLY n
1 51 SER n
1 52 VAL n
1 53 TYR n
1 54 SER n
1 55 GLY n
1 56 ILE n
1 57 ARG n
1 58 VAL n
1 59 SER n
1 60 ASP n
1 61 ASN n
1 62 LEU n
1 63 PRO n
1 64 VAL n
1 65 ALA n
1 66 ILE n
1 67 LYS n
1 68 HIS n
1 69 VAL n
1 70 GLU n
1 71 LYS n
1 72 ASP n
1 73 ARG n
1 74 ILE n
1 75 SER n
1 76 ASP n
1 77 TRP n
1 78 GLY n
1 79 GLU n
1 80 LEU n
1 81 PRO n
1 82 ASN n
1 83 GLY n
1 84 THR n
1 85 ARG n
1 86 VAL n
1 87 PRO n
1 88 MET n
1 89 GLU n
1 90 VAL n
1 91 VAL n
1 92 LEU n
1 93 LEU n
1 94 LYS n
1 95 LYS n
1 96 VAL n
1 97 SER n
1 98 SER n
1 99 GLY n
1 100 PHE n
1 101 SER n
1 102 GLY n
1 103 VAL n
1 104 ILE n
1 105 ARG n
1 106 LEU n
1 107 LEU n
1 108 ASP n
1 109 TRP n
1 110 PHE n
1 111 GLU n
1 112 ARG n
1 113 PRO n
1 114 ASP n
1 115 SER n
1 116 PHE n
1 117 VAL n
1 118 LEU n
1 119 ILE n
1 120 LEU n
1 121 GLU n
1 122 ARG n
1 123 PRO n
1 124 GLU n
1 125 PRO n
1 126 VAL n
1 127 GLN n
1 128 ASP n
1 129 LEU n
1 130 PHE n
1 131 ASP n
1 132 PHE n
1 133 ILE n
1 134 THR n
1 135 GLU n
1 136 ARG n
1 137 GLY n
1 138 ALA n
1 139 LEU n
1 140 GLN n
1 141 GLU n
1 142 GLU n
1 143 LEU n
1 144 ALA n
1 145 ARG n
1 146 SER n
1 147 PHE n
1 148 PHE n
1 149 TRP n
1 150 GLN n
1 151 VAL n
1 152 LEU n
1 153 GLU n
1 154 ALA n
1 155 VAL n
1 156 ARG n
1 157 HIS n
1 158 CYS n
1 159 HIS n
1 160 ASN n
1 161 CYS n
1 162 GLY n
1 163 VAL n
1 164 LEU n
1 165 HIS n
1 166 ARG n
1 167 ASP n
1 168 ILE n
1 169 LYS n
1 170 ASP n
1 171 GLU n
1 172 ASN n
1 173 ILE n
1 174 LEU n
1 175 ILE n
1 176 ASP n
1 177 LEU n
1 178 ASN n
1 179 ARG n
1 180 GLY n
1 181 GLU n
1 182 LEU n
1 183 LYS n
1 184 LEU n
1 185 ILE n
1 186 ASP n
1 187 PHE n
1 188 GLY n
1 189 SER n
1 190 GLY n
1 191 ALA n
1 192 LEU n
1 193 LEU n
1 194 LYS n
1 195 ASP n
1 196 THR n
1 197 VAL n
1 198 TYR n
1 199 THR n
1 200 ASP n
1 201 PHE n
1 202 ASP n
1 203 GLY n
1 204 THR n
1 205 ARG n
1 206 VAL n
1 207 TYR n
1 208 SER n
1 209 PRO n
1 210 PRO n
1 211 GLU n
1 212 TRP n
1 213 ILE n
1 214 ARG n
1 215 TYR n
1 216 HIS n
1 217 ARG n
1 218 TYR n
1 219 HIS n
1 220 GLY n
1 221 ARG n
1 222 SER n
1 223 ALA n
1 224 ALA n
1 225 VAL n
1 226 TRP n
1 227 SER n
1 228 LEU n
1 229 GLY n
1 230 ILE n
1 231 LEU n
1 232 LEU n
1 233 TYR n
1 234 ASP n
1 235 MET n
1 236 VAL n
1 237 CYS n
1 238 GLY n
1 239 ASP n
1 240 ILE n
1 241 PRO n
1 242 PHE n
1 243 GLU n
1 244 HIS n
1 245 ASP n
1 246 GLU n
1 247 GLU n
1 248 ILE n
1 249 ILE n
1 250 GLY n
1 251 GLY n
1 252 GLN n
1 253 VAL n
1 254 PHE n
1 255 PHE n
1 256 ARG n
1 257 GLN n
1 258 ARG n
1 259 VAL n
1 260 SER n
1 261 SEP n
1 262 GLU n
1 263 CYS n
1 264 GLN n
1 265 HIS n
1 266 LEU n
1 267 ILE n
1 268 ARG n
1 269 TRP n
1 270 CYS n
1 271 LEU n
1 272 ALA n
1 273 LEU n
1 274 ARG n
1 275 PRO n
1 276 SER n
1 277 ASP n
1 278 ARG n
1 279 PRO n
1 280 THR n
1 281 PHE n
1 282 GLU n
1 283 GLU n
1 284 ILE n
1 285 GLN n
1 286 ASN n
1 287 HIS n
1 288 PRO n
1 289 TRP n
1 290 MET n
1 291 GLN n
1 292 ASP n
1 293 VAL n
1 294 LEU n
1 295 LEU n
1 296 PRO n
1 297 GLN n
1 298 GLU n
1 299 THR n
1 300 ALA n
1 301 GLU n
1 302 ILE n
1 303 HIS n
1 304 LEU n
1 305 HIS n
1 306 SER n
1 307 LEU n
1 308 SER n
1 309 PRO n
1 310 GLY n
1 311 PRO n
1 312 SER n
2 1 ALA n
2 2 ARG n
2 3 LYS n
2 4 ARG n
2 5 ARG n
2 6 ARG n
2 7 HIS n
2 8 PRO n
2 9 SER n
2 10 GLY n
2 11 PRO n
2 12 PRO n
2 13 THR n
2 14 ALA n
#
_entity_src_gen.entity_id 1
_entity_src_gen.pdbx_src_id 1
_entity_src_gen.pdbx_alt_source_flag sample
_entity_src_gen.pdbx_seq_type 'Biological sequence'
_entity_src_gen.pdbx_beg_seq_num 1
_entity_src_gen.pdbx_end_seq_num 312
_entity_src_gen.gene_src_common_name human
_entity_src_gen.gene_src_genus ?
_entity_src_gen.pdbx_gene_src_gene PIM1
_entity_src_gen.gene_src_species ?
_entity_src_gen.gene_src_strain ?
_entity_src_gen.gene_src_tissue ?
_entity_src_gen.gene_src_tissue_fraction ?
_entity_src_gen.gene_src_details ?
_entity_src_gen.pdbx_gene_src_fragment ?
_entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens'
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606
_entity_src_gen.pdbx_gene_src_variant ?
_entity_src_gen.pdbx_gene_src_cell_line ?
_entity_src_gen.pdbx_gene_src_atcc ?
_entity_src_gen.pdbx_gene_src_organ ?
_entity_src_gen.pdbx_gene_src_organelle ?
_entity_src_gen.pdbx_gene_src_cell ?
_entity_src_gen.pdbx_gene_src_cellular_location ?
_entity_src_gen.host_org_common_name ?
_entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)'
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008
_entity_src_gen.host_org_genus ?
_entity_src_gen.pdbx_host_org_gene ?
_entity_src_gen.pdbx_host_org_organ ?
_entity_src_gen.host_org_species ?
_entity_src_gen.pdbx_host_org_tissue ?
_entity_src_gen.pdbx_host_org_tissue_fraction ?
_entity_src_gen.pdbx_host_org_strain ?
_entity_src_gen.pdbx_host_org_variant ?
_entity_src_gen.pdbx_host_org_cell_line ?
_entity_src_gen.pdbx_host_org_atcc ?
_entity_src_gen.pdbx_host_org_culture_collection ?
_entity_src_gen.pdbx_host_org_cell ?
_entity_src_gen.pdbx_host_org_organelle ?
_entity_src_gen.pdbx_host_org_cellular_location ?
_entity_src_gen.pdbx_host_org_vector_type ?
_entity_src_gen.pdbx_host_org_vector ?
_entity_src_gen.host_org_details ?
_entity_src_gen.expression_system_id ?
_entity_src_gen.plasmid_name pLIC-SGC
_entity_src_gen.plasmid_details ?
_entity_src_gen.pdbx_description ?
#
_pdbx_entity_src_syn.entity_id 2
_pdbx_entity_src_syn.pdbx_src_id 1
_pdbx_entity_src_syn.pdbx_alt_source_flag sample
_pdbx_entity_src_syn.pdbx_beg_seq_num 1
_pdbx_entity_src_syn.pdbx_end_seq_num 14
_pdbx_entity_src_syn.organism_scientific 'synthetic construct'
_pdbx_entity_src_syn.organism_common_name ?
_pdbx_entity_src_syn.ncbi_taxonomy_id 32630
_pdbx_entity_src_syn.details ?
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.mon_nstd_flag
_chem_comp.name
_chem_comp.pdbx_synonyms
_chem_comp.formula
_chem_comp.formula_weight
ALA 'L-peptide linking' y ALANINE ?
'C3 H7 N O2' 89.093
ARG 'L-peptide linking' y ARGININE ?
'C6 H15 N4 O2 1' 175.209
ASN 'L-peptide linking' y ASPARAGINE ?
'C4 H8 N2 O3' 132.118
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?
'C4 H7 N O4' 133.103
AY3 non-polymer . '4-[(~{E})-(2-oxidanylidene-1~{H}-indol-3-ylidene)methyl]benzoic acid' ?
'C16 H11 N O3' 265.263
CYS 'L-peptide linking' y CYSTEINE ?
'C3 H7 N O2 S' 121.158
GLN 'L-peptide linking' y GLUTAMINE ?
'C5 H10 N2 O3' 146.144
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?
'C5 H9 N O4' 147.129
GLY 'peptide linking' y GLYCINE ?
'C2 H5 N O2' 75.067
GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL'
'C3 H8 O3' 92.094
HIS 'L-peptide linking' y HISTIDINE ?
'C6 H10 N3 O2 1' 156.162
HOH non-polymer . WATER ?
'H2 O' 18.015
ILE 'L-peptide linking' y ISOLEUCINE ?
'C6 H13 N O2' 131.173
LEU 'L-peptide linking' y LEUCINE ?
'C6 H13 N O2' 131.173
LYS 'L-peptide linking' y LYSINE ?
'C6 H15 N2 O2 1' 147.195
MET 'L-peptide linking' y METHIONINE ?
'C5 H11 N O2 S' 149.211
PHE 'L-peptide linking' y PHENYLALANINE ?
'C9 H11 N O2' 165.189
PRO 'L-peptide linking' y PROLINE ?
'C5 H9 N O2' 115.130
SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE
'C3 H8 N O6 P' 185.072
SER 'L-peptide linking' y SERINE ?
'C3 H7 N O3' 105.093
THR 'L-peptide linking' y THREONINE ?
'C4 H9 N O3' 119.119
TRP 'L-peptide linking' y TRYPTOPHAN ?
'C11 H12 N2 O2' 204.225
TYR 'L-peptide linking' y TYROSINE ?
'C9 H11 N O3' 181.189
VAL 'L-peptide linking' y VALINE ?
'C5 H11 N O2' 117.146
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.ndb_seq_num
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
_pdbx_poly_seq_scheme.hetero
A 1 1 MET 1 1 ? ? ? A . n
A 1 2 LEU 2 2 ? ? ? A . n
A 1 3 LEU 3 3 ? ? ? A . n
A 1 4 SER 4 4 ? ? ? A . n
A 1 5 LYS 5 5 ? ? ? A . n
A 1 6 ILE 6 6 ? ? ? A . n
A 1 7 ASN 7 7 ? ? ? A . n
A 1 8 SER 8 8 ? ? ? A . n
A 1 9 LEU 9 9 ? ? ? A . n
A 1 10 ALA 10 10 ? ? ? A . n
A 1 11 HIS 11 11 ? ? ? A . n
A 1 12 LEU 12 12 ? ? ? A . n
A 1 13 ARG 13 13 ? ? ? A . n
A 1 14 ALA 14 14 ? ? ? A . n
A 1 15 ALA 15 15 ? ? ? A . n
A 1 16 PRO 16 16 ? ? ? A . n
A 1 17 CYS 17 17 ? ? ? A . n
A 1 18 ASN 18 18 ? ? ? A . n
A 1 19 ASP 19 19 ? ? ? A . n
A 1 20 LEU 20 20 ? ? ? A . n
A 1 21 HIS 21 21 ? ? ? A . n
A 1 22 ALA 22 22 ? ? ? A . n
A 1 23 THR 23 23 ? ? ? A . n
A 1 24 LYS 24 24 ? ? ? A . n
A 1 25 LEU 25 25 ? ? ? A . n
A 1 26 ALA 26 26 ? ? ? A . n
A 1 27 PRO 27 27 ? ? ? A . n
A 1 28 GLY 28 28 ? ? ? A . n
A 1 29 LYS 29 29 ? ? ? A . n
A 1 30 GLU 30 30 ? ? ? A . n
A 1 31 LYS 31 31 ? ? ? A . n
A 1 32 GLU 32 32 ? ? ? A . n
A 1 33 PRO 33 33 33 PRO PRO A . n
A 1 34 LEU 34 34 34 LEU LEU A . n
A 1 35 GLU 35 35 35 GLU GLU A . n
A 1 36 SER 36 36 36 SER SER A . n
A 1 37 GLN 37 37 37 GLN GLN A . n
A 1 38 TYR 38 38 38 TYR TYR A . n
A 1 39 GLN 39 39 39 GLN GLN A . n
A 1 40 VAL 40 40 40 VAL VAL A . n
A 1 41 GLY 41 41 41 GLY GLY A . n
A 1 42 PRO 42 42 42 PRO PRO A . n
A 1 43 LEU 43 43 43 LEU LEU A . n
A 1 44 LEU 44 44 44 LEU LEU A . n
A 1 45 GLY 45 45 45 GLY GLY A . n
A 1 46 SER 46 46 46 SER SER A . n
A 1 47 GLY 47 47 ? ? ? A . n
A 1 48 GLY 48 48 ? ? ? A . n
A 1 49 PHE 49 49 49 PHE PHE A . n
A 1 50 GLY 50 50 50 GLY GLY A . n
A 1 51 SER 51 51 51 SER SER A . n
A 1 52 VAL 52 52 52 VAL VAL A . n
A 1 53 TYR 53 53 53 TYR TYR A . n
A 1 54 SER 54 54 54 SER SER A . n
A 1 55 GLY 55 55 55 GLY GLY A . n
A 1 56 ILE 56 56 56 ILE ILE A . n
A 1 57 ARG 57 57 57 ARG ARG A . n
A 1 58 VAL 58 58 58 VAL VAL A . n
A 1 59 SER 59 59 59 SER SER A . n
A 1 60 ASP 60 60 60 ASP ASP A . n
A 1 61 ASN 61 61 61 ASN ASN A . n
A 1 62 LEU 62 62 62 LEU LEU A . n
A 1 63 PRO 63 63 63 PRO PRO A . n
A 1 64 VAL 64 64 64 VAL VAL A . n
A 1 65 ALA 65 65 65 ALA ALA A . n
A 1 66 ILE 66 66 66 ILE ILE A . n
A 1 67 LYS 67 67 67 LYS LYS A . n
A 1 68 HIS 68 68 68 HIS HIS A . n
A 1 69 VAL 69 69 69 VAL VAL A . n
A 1 70 GLU 70 70 70 GLU GLU A . n
A 1 71 LYS 71 71 71 LYS LYS A . n
A 1 72 ASP 72 72 72 ASP ASP A . n
A 1 73 ARG 73 73 73 ARG ARG A . n
A 1 74 ILE 74 74 74 ILE ILE A . n
A 1 75 SER 75 75 75 SER SER A . n
A 1 76 ASP 76 76 76 ASP ASP A . n
A 1 77 TRP 77 77 77 TRP TRP A . n
A 1 78 GLY 78 78 78 GLY GLY A . n
A 1 79 GLU 79 79 79 GLU GLU A . n
A 1 80 LEU 80 80 80 LEU LEU A . n
A 1 81 PRO 81 81 81 PRO PRO A . n
A 1 82 ASN 82 82 82 ASN ASN A . n
A 1 83 GLY 83 83 83 GLY GLY A . n
A 1 84 THR 84 84 84 THR THR A . n
A 1 85 ARG 85 85 85 ARG ARG A . n
A 1 86 VAL 86 86 86 VAL VAL A . n
A 1 87 PRO 87 87 87 PRO PRO A . n
A 1 88 MET 88 88 88 MET MET A . n
A 1 89 GLU 89 89 89 GLU GLU A . n
A 1 90 VAL 90 90 90 VAL VAL A . n
A 1 91 VAL 91 91 91 VAL VAL A . n
A 1 92 LEU 92 92 92 LEU LEU A . n
A 1 93 LEU 93 93 93 LEU LEU A . n
A 1 94 LYS 94 94 94 LYS LYS A . n
A 1 95 LYS 95 95 95 LYS LYS A . n
A 1 96 VAL 96 96 96 VAL VAL A . n
A 1 97 SER 97 97 97 SER SER A . n
A 1 98 SER 98 98 98 SER SER A . n
A 1 99 GLY 99 99 99 GLY GLY A . n
A 1 100 PHE 100 100 100 PHE PHE A . n
A 1 101 SER 101 101 101 SER SER A . n
A 1 102 GLY 102 102 102 GLY GLY A . n
A 1 103 VAL 103 103 103 VAL VAL A . n
A 1 104 ILE 104 104 104 ILE ILE A . n
A 1 105 ARG 105 105 105 ARG ARG A . n
A 1 106 LEU 106 106 106 LEU LEU A . n
A 1 107 LEU 107 107 107 LEU LEU A . n
A 1 108 ASP 108 108 108 ASP ASP A . n
A 1 109 TRP 109 109 109 TRP TRP A . n
A 1 110 PHE 110 110 110 PHE PHE A . n
A 1 111 GLU 111 111 111 GLU GLU A . n
A 1 112 ARG 112 112 112 ARG ARG A . n
A 1 113 PRO 113 113 113 PRO PRO A . n
A 1 114 ASP 114 114 114 ASP ASP A . n
A 1 115 SER 115 115 115 SER SER A . n
A 1 116 PHE 116 116 116 PHE PHE A . n
A 1 117 VAL 117 117 117 VAL VAL A . n
A 1 118 LEU 118 118 118 LEU LEU A . n
A 1 119 ILE 119 119 119 ILE ILE A . n
A 1 120 LEU 120 120 120 LEU LEU A . n
A 1 121 GLU 121 121 121 GLU GLU A . n
A 1 122 ARG 122 122 122 ARG ARG A . n
A 1 123 PRO 123 123 123 PRO PRO A . n
A 1 124 GLU 124 124 124 GLU GLU A . n
A 1 125 PRO 125 125 125 PRO PRO A . n
A 1 126 VAL 126 126 126 VAL VAL A . n
A 1 127 GLN 127 127 127 GLN GLN A . n
A 1 128 ASP 128 128 128 ASP ASP A . n
A 1 129 LEU 129 129 129 LEU LEU A . n
A 1 130 PHE 130 130 130 PHE PHE A . n
A 1 131 ASP 131 131 131 ASP ASP A . n
A 1 132 PHE 132 132 132 PHE PHE A . n
A 1 133 ILE 133 133 133 ILE ILE A . n
A 1 134 THR 134 134 134 THR THR A . n
A 1 135 GLU 135 135 135 GLU GLU A . n
A 1 136 ARG 136 136 136 ARG ARG A . n
A 1 137 GLY 137 137 137 GLY GLY A . n
A 1 138 ALA 138 138 138 ALA ALA A . n
A 1 139 LEU 139 139 139 LEU LEU A . n
A 1 140 GLN 140 140 140 GLN GLN A . n
A 1 141 GLU 141 141 141 GLU GLU A . n
A 1 142 GLU 142 142 142 GLU GLU A . n
A 1 143 LEU 143 143 143 LEU LEU A . n
A 1 144 ALA 144 144 144 ALA ALA A . n
A 1 145 ARG 145 145 145 ARG ARG A . n
A 1 146 SER 146 146 146 SER SER A . n
A 1 147 PHE 147 147 147 PHE PHE A . n
A 1 148 PHE 148 148 148 PHE PHE A . n
A 1 149 TRP 149 149 149 TRP TRP A . n
A 1 150 GLN 150 150 150 GLN GLN A . n
A 1 151 VAL 151 151 151 VAL VAL A . n
A 1 152 LEU 152 152 152 LEU LEU A . n
A 1 153 GLU 153 153 153 GLU GLU A . n
A 1 154 ALA 154 154 154 ALA ALA A . n
A 1 155 VAL 155 155 155 VAL VAL A . n
A 1 156 ARG 156 156 156 ARG ARG A . n
A 1 157 HIS 157 157 157 HIS HIS A . n
A 1 158 CYS 158 158 158 CYS CYS A . n
A 1 159 HIS 159 159 159 HIS HIS A . n
A 1 160 ASN 160 160 160 ASN ASN A . n
A 1 161 CYS 161 161 161 CYS CYS A . n
A 1 162 GLY 162 162 162 GLY GLY A . n
A 1 163 VAL 163 163 163 VAL VAL A . n
A 1 164 LEU 164 164 164 LEU LEU A . n
A 1 165 HIS 165 165 165 HIS HIS A . n
A 1 166 ARG 166 166 166 ARG ARG A . n
A 1 167 ASP 167 167 167 ASP ASP A . n
A 1 168 ILE 168 168 168 ILE ILE A . n
A 1 169 LYS 169 169 169 LYS LYS A . n
A 1 170 ASP 170 170 170 ASP ASP A . n
A 1 171 GLU 171 171 171 GLU GLU A . n
A 1 172 ASN 172 172 172 ASN ASN A . n
A 1 173 ILE 173 173 173 ILE ILE A . n
A 1 174 LEU 174 174 174 LEU LEU A . n
A 1 175 ILE 175 175 175 ILE ILE A . n
A 1 176 ASP 176 176 176 ASP ASP A . n
A 1 177 LEU 177 177 177 LEU LEU A . n
A 1 178 ASN 178 178 178 ASN ASN A . n
A 1 179 ARG 179 179 179 ARG ARG A . n
A 1 180 GLY 180 180 180 GLY GLY A . n
A 1 181 GLU 181 181 181 GLU GLU A . n
A 1 182 LEU 182 182 182 LEU LEU A . n
A 1 183 LYS 183 183 183 LYS LYS A . n
A 1 184 LEU 184 184 184 LEU LEU A . n
A 1 185 ILE 185 185 185 ILE ILE A . n
A 1 186 ASP 186 186 186 ASP ASP A . n
A 1 187 PHE 187 187 187 PHE PHE A . n
A 1 188 GLY 188 188 188 GLY GLY A . n
A 1 189 SER 189 189 189 SER SER A . n
A 1 190 GLY 190 190 190 GLY GLY A . n
A 1 191 ALA 191 191 191 ALA ALA A . n
A 1 192 LEU 192 192 192 LEU LEU A . n
A 1 193 LEU 193 193 193 LEU LEU A . n
A 1 194 LYS 194 194 194 LYS LYS A . n
A 1 195 ASP 195 195 195 ASP ASP A . n
A 1 196 THR 196 196 196 THR THR A . n
A 1 197 VAL 197 197 197 VAL VAL A . n
A 1 198 TYR 198 198 198 TYR TYR A . n
A 1 199 THR 199 199 199 THR THR A . n
A 1 200 ASP 200 200 200 ASP ASP A . n
A 1 201 PHE 201 201 201 PHE PHE A . n
A 1 202 ASP 202 202 202 ASP ASP A . n
A 1 203 GLY 203 203 203 GLY GLY A . n
A 1 204 THR 204 204 204 THR THR A . n
A 1 205 ARG 205 205 205 ARG ARG A . n
A 1 206 VAL 206 206 206 VAL VAL A . n
A 1 207 TYR 207 207 207 TYR TYR A . n
A 1 208 SER 208 208 208 SER SER A . n
A 1 209 PRO 209 209 209 PRO PRO A . n
A 1 210 PRO 210 210 210 PRO PRO A . n
A 1 211 GLU 211 211 211 GLU GLU A . n
A 1 212 TRP 212 212 212 TRP TRP A . n
A 1 213 ILE 213 213 213 ILE ILE A . n
A 1 214 ARG 214 214 214 ARG ARG A . n
A 1 215 TYR 215 215 215 TYR TYR A . n
A 1 216 HIS 216 216 216 HIS HIS A . n
A 1 217 ARG 217 217 217 ARG ARG A . n
A 1 218 TYR 218 218 218 TYR TYR A . n
A 1 219 HIS 219 219 219 HIS HIS A . n
A 1 220 GLY 220 220 220 GLY GLY A . n
A 1 221 ARG 221 221 221 ARG ARG A . n
A 1 222 SER 222 222 222 SER SER A . n
A 1 223 ALA 223 223 223 ALA ALA A . n
A 1 224 ALA 224 224 224 ALA ALA A . n
A 1 225 VAL 225 225 225 VAL VAL A . n
A 1 226 TRP 226 226 226 TRP TRP A . n
A 1 227 SER 227 227 227 SER SER A . n
A 1 228 LEU 228 228 228 LEU LEU A . n
A 1 229 GLY 229 229 229 GLY GLY A . n
A 1 230 ILE 230 230 230 ILE ILE A . n
A 1 231 LEU 231 231 231 LEU LEU A . n
A 1 232 LEU 232 232 232 LEU LEU A . n
A 1 233 TYR 233 233 233 TYR TYR A . n
A 1 234 ASP 234 234 234 ASP ASP A . n
A 1 235 MET 235 235 235 MET MET A . n
A 1 236 VAL 236 236 236 VAL VAL A . n
A 1 237 CYS 237 237 237 CYS CYS A . n
A 1 238 GLY 238 238 238 GLY GLY A . n
A 1 239 ASP 239 239 239 ASP ASP A . n
A 1 240 ILE 240 240 240 ILE ILE A . n
A 1 241 PRO 241 241 241 PRO PRO A . n
A 1 242 PHE 242 242 242 PHE PHE A . n
A 1 243 GLU 243 243 243 GLU GLU A . n
A 1 244 HIS 244 244 244 HIS HIS A . n
A 1 245 ASP 245 245 245 ASP ASP A . n
A 1 246 GLU 246 246 246 GLU GLU A . n
A 1 247 GLU 247 247 247 GLU GLU A . n
A 1 248 ILE 248 248 248 ILE ILE A . n
A 1 249 ILE 249 249 249 ILE ILE A . n
A 1 250 GLY 250 250 250 GLY GLY A . n
A 1 251 GLY 251 251 251 GLY GLY A . n
A 1 252 GLN 252 252 252 GLN GLN A . n
A 1 253 VAL 253 253 253 VAL VAL A . n
A 1 254 PHE 254 254 254 PHE PHE A . n
A 1 255 PHE 255 255 255 PHE PHE A . n
A 1 256 ARG 256 256 256 ARG ARG A . n
A 1 257 GLN 257 257 257 GLN GLN A . n
A 1 258 ARG 258 258 258 ARG ARG A . n
A 1 259 VAL 259 259 259 VAL VAL A . n
A 1 260 SER 260 260 260 SER SER A . n
A 1 261 SEP 261 261 261 SEP SEP A . n
A 1 262 GLU 262 262 262 GLU GLU A . n
A 1 263 CYS 263 263 263 CYS CYS A . n
A 1 264 GLN 264 264 264 GLN GLN A . n
A 1 265 HIS 265 265 265 HIS HIS A . n
A 1 266 LEU 266 266 266 LEU LEU A . n
A 1 267 ILE 267 267 267 ILE ILE A . n
A 1 268 ARG 268 268 268 ARG ARG A . n
A 1 269 TRP 269 269 269 TRP TRP A . n
A 1 270 CYS 270 270 270 CYS CYS A . n
A 1 271 LEU 271 271 271 LEU LEU A . n
A 1 272 ALA 272 272 272 ALA ALA A . n
A 1 273 LEU 273 273 273 LEU LEU A . n
A 1 274 ARG 274 274 274 ARG ARG A . n
A 1 275 PRO 275 275 275 PRO PRO A . n
A 1 276 SER 276 276 276 SER SER A . n
A 1 277 ASP 277 277 277 ASP ASP A . n
A 1 278 ARG 278 278 278 ARG ARG A . n
A 1 279 PRO 279 279 279 PRO PRO A . n
A 1 280 THR 280 280 280 THR THR A . n
A 1 281 PHE 281 281 281 PHE PHE A . n
A 1 282 GLU 282 282 282 GLU GLU A . n
A 1 283 GLU 283 283 283 GLU GLU A . n
A 1 284 ILE 284 284 284 ILE ILE A . n
A 1 285 GLN 285 285 285 GLN GLN A . n
A 1 286 ASN 286 286 286 ASN ASN A . n
A 1 287 HIS 287 287 287 HIS HIS A . n
A 1 288 PRO 288 288 288 PRO PRO A . n
A 1 289 TRP 289 289 289 TRP TRP A . n
A 1 290 MET 290 290 290 MET MET A . n
A 1 291 GLN 291 291 291 GLN GLN A . n
A 1 292 ASP 292 292 292 ASP ASP A . n
A 1 293 VAL 293 293 293 VAL VAL A . n
A 1 294 LEU 294 294 294 LEU LEU A . n
A 1 295 LEU 295 295 295 LEU LEU A . n
A 1 296 PRO 296 296 296 PRO PRO A . n
A 1 297 GLN 297 297 297 GLN GLN A . n
A 1 298 GLU 298 298 298 GLU GLU A . n
A 1 299 THR 299 299 299 THR THR A . n
A 1 300 ALA 300 300 300 ALA ALA A . n
A 1 301 GLU 301 301 301 GLU GLU A . n
A 1 302 ILE 302 302 302 ILE ILE A . n
A 1 303 HIS 303 303 303 HIS HIS A . n
A 1 304 LEU 304 304 304 LEU LEU A . n
A 1 305 HIS 305 305 305 HIS HIS A . n
A 1 306 SER 306 306 ? ? ? A . n
A 1 307 LEU 307 307 ? ? ? A . n
A 1 308 SER 308 308 ? ? ? A . n
A 1 309 PRO 309 309 ? ? ? A . n
A 1 310 GLY 310 310 ? ? ? A . n
A 1 311 PRO 311 311 ? ? ? A . n
A 1 312 SER 312 312 ? ? ? A . n
B 2 1 ALA 1 1 ? ? ? D . n
B 2 2 ARG 2 2 2 ARG ARG D . n
B 2 3 LYS 3 3 3 LYS LYS D . n
B 2 4 ARG 4 4 4 ARG ARG D . n
B 2 5 ARG 5 5 5 ARG ARG D . n
B 2 6 ARG 6 6 6 ARG ARG D . n
B 2 7 HIS 7 7 7 HIS HIS D . n
B 2 8 PRO 8 8 8 PRO PRO D . n
B 2 9 SER 9 9 9 SER SER D . n
B 2 10 GLY 10 10 ? ? ? D . n
B 2 11 PRO 11 11 ? ? ? D . n
B 2 12 PRO 12 12 ? ? ? D . n
B 2 13 THR 13 13 ? ? ? D . n
B 2 14 ALA 14 14 ? ? ? D . n
#
_pdbx_entity_instance_feature.ordinal 1
_pdbx_entity_instance_feature.comp_id AY3
_pdbx_entity_instance_feature.asym_id ?
_pdbx_entity_instance_feature.seq_num ?
_pdbx_entity_instance_feature.auth_comp_id AY3
_pdbx_entity_instance_feature.auth_asym_id ?
_pdbx_entity_instance_feature.auth_seq_num ?
_pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION'
_pdbx_entity_instance_feature.details ?
#
loop_
_pdbx_nonpoly_scheme.asym_id
_pdbx_nonpoly_scheme.entity_id
_pdbx_nonpoly_scheme.mon_id
_pdbx_nonpoly_scheme.ndb_seq_num
_pdbx_nonpoly_scheme.pdb_seq_num
_pdbx_nonpoly_scheme.auth_seq_num
_pdbx_nonpoly_scheme.pdb_mon_id
_pdbx_nonpoly_scheme.auth_mon_id
_pdbx_nonpoly_scheme.pdb_strand_id
_pdbx_nonpoly_scheme.pdb_ins_code
C 3 GOL 1 401 1 GOL GOL A .
D 4 AY3 1 402 1 AY3 503 A .
E 5 HOH 1 501 151 HOH HOH A .
E 5 HOH 2 502 140 HOH HOH A .
E 5 HOH 3 503 147 HOH HOH A .
E 5 HOH 4 504 36 HOH HOH A .
E 5 HOH 5 505 158 HOH HOH A .
E 5 HOH 6 506 46 HOH HOH A .
E 5 HOH 7 507 136 HOH HOH A .
E 5 HOH 8 508 59 HOH HOH A .
E 5 HOH 9 509 120 HOH HOH A .
E 5 HOH 10 510 111 HOH HOH A .
E 5 HOH 11 511 79 HOH HOH A .
E 5 HOH 12 512 74 HOH HOH A .
E 5 HOH 13 513 4 HOH HOH A .
E 5 HOH 14 514 116 HOH HOH A .
E 5 HOH 15 515 115 HOH HOH A .
E 5 HOH 16 516 9 HOH HOH A .
E 5 HOH 17 517 69 HOH HOH A .
E 5 HOH 18 518 32 HOH HOH A .
E 5 HOH 19 519 42 HOH HOH A .
E 5 HOH 20 520 25 HOH HOH A .
E 5 HOH 21 521 67 HOH HOH A .
E 5 HOH 22 522 11 HOH HOH A .
E 5 HOH 23 523 85 HOH HOH A .
E 5 HOH 24 524 130 HOH HOH A .
E 5 HOH 25 525 22 HOH HOH A .
E 5 HOH 26 526 21 HOH HOH A .
E 5 HOH 27 527 72 HOH HOH A .
E 5 HOH 28 528 37 HOH HOH A .
E 5 HOH 29 529 64 HOH HOH A .
E 5 HOH 30 530 50 HOH HOH A .
E 5 HOH 31 531 52 HOH HOH A .
E 5 HOH 32 532 142 HOH HOH A .
E 5 HOH 33 533 8 HOH HOH A .
E 5 HOH 34 534 94 HOH HOH A .
E 5 HOH 35 535 135 HOH HOH A .
E 5 HOH 36 536 20 HOH HOH A .
E 5 HOH 37 537 2 HOH HOH A .
E 5 HOH 38 538 76 HOH HOH A .
E 5 HOH 39 539 77 HOH HOH A .
E 5 HOH 40 540 26 HOH HOH A .
E 5 HOH 41 541 30 HOH HOH A .
E 5 HOH 42 542 31 HOH HOH A .
E 5 HOH 43 543 55 HOH HOH A .
E 5 HOH 44 544 47 HOH HOH A .
E 5 HOH 45 545 43 HOH HOH A .
E 5 HOH 46 546 49 HOH HOH A .
E 5 HOH 47 547 90 HOH HOH A .
E 5 HOH 48 548 38 HOH HOH A .
E 5 HOH 49 549 134 HOH HOH A .
E 5 HOH 50 550 12 HOH HOH A .
E 5 HOH 51 551 27 HOH HOH A .
E 5 HOH 52 552 35 HOH HOH A .
E 5 HOH 53 553 133 HOH HOH A .
E 5 HOH 54 554 109 HOH HOH A .
E 5 HOH 55 555 143 HOH HOH A .
E 5 HOH 56 556 117 HOH HOH A .
E 5 HOH 57 557 5 HOH HOH A .
E 5 HOH 58 558 41 HOH HOH A .
E 5 HOH 59 559 1 HOH HOH A .
E 5 HOH 60 560 13 HOH HOH A .
E 5 HOH 61 561 150 HOH HOH A .
E 5 HOH 62 562 34 HOH HOH A .
E 5 HOH 63 563 58 HOH HOH A .
E 5 HOH 64 564 63 HOH HOH A .
E 5 HOH 65 565 23 HOH HOH A .
E 5 HOH 66 566 83 HOH HOH A .
E 5 HOH 67 567 88 HOH HOH A .
E 5 HOH 68 568 113 HOH HOH A .
E 5 HOH 69 569 112 HOH HOH A .
E 5 HOH 70 570 144 HOH HOH A .
E 5 HOH 71 571 28 HOH HOH A .
E 5 HOH 72 572 14 HOH HOH A .
E 5 HOH 73 573 123 HOH HOH A .
E 5 HOH 74 574 56 HOH HOH A .
E 5 HOH 75 575 128 HOH HOH A .
E 5 HOH 76 576 93 HOH HOH A .
E 5 HOH 77 577 81 HOH HOH A .
E 5 HOH 78 578 18 HOH HOH A .
E 5 HOH 79 579 138 HOH HOH A .
E 5 HOH 80 580 101 HOH HOH A .
E 5 HOH 81 581 118 HOH HOH A .
E 5 HOH 82 582 84 HOH HOH A .
E 5 HOH 83 583 75 HOH HOH A .
E 5 HOH 84 584 122 HOH HOH A .
E 5 HOH 85 585 96 HOH HOH A .
E 5 HOH 86 586 95 HOH HOH A .
E 5 HOH 87 587 10 HOH HOH A .
E 5 HOH 88 588 44 HOH HOH A .
E 5 HOH 89 589 141 HOH HOH A .
E 5 HOH 90 590 99 HOH HOH A .
E 5 HOH 91 591 78 HOH HOH A .
E 5 HOH 92 592 15 HOH HOH A .
E 5 HOH 93 593 48 HOH HOH A .
E 5 HOH 94 594 24 HOH HOH A .
E 5 HOH 95 595 121 HOH HOH A .
E 5 HOH 96 596 19 HOH HOH A .
E 5 HOH 97 597 119 HOH HOH A .
E 5 HOH 98 598 148 HOH HOH A .
E 5 HOH 99 599 33 HOH HOH A .
E 5 HOH 100 600 145 HOH HOH A .
E 5 HOH 101 601 156 HOH HOH A .
E 5 HOH 102 602 98 HOH HOH A .
E 5 HOH 103 603 108 HOH HOH A .
E 5 HOH 104 604 89 HOH HOH A .
E 5 HOH 105 605 146 HOH HOH A .
E 5 HOH 106 606 131 HOH HOH A .
E 5 HOH 107 607 17 HOH HOH A .
E 5 HOH 108 608 155 HOH HOH A .
E 5 HOH 109 609 149 HOH HOH A .
E 5 HOH 110 610 159 HOH HOH A .
E 5 HOH 111 611 126 HOH HOH A .
E 5 HOH 112 612 16 HOH HOH A .
E 5 HOH 113 613 129 HOH HOH A .
E 5 HOH 114 614 153 HOH HOH A .
E 5 HOH 115 615 51 HOH HOH A .
E 5 HOH 116 616 152 HOH HOH A .
E 5 HOH 117 617 86 HOH HOH A .
F 5 HOH 1 101 104 HOH HOH D .
F 5 HOH 2 102 39 HOH HOH D .
F 5 HOH 3 103 40 HOH HOH D .
F 5 HOH 4 104 127 HOH HOH D .
F 5 HOH 5 105 157 HOH HOH D .
F 5 HOH 6 106 132 HOH HOH D .
#
loop_
_pdbx_unobs_or_zero_occ_atoms.id
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num
_pdbx_unobs_or_zero_occ_atoms.polymer_flag
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id
_pdbx_unobs_or_zero_occ_atoms.label_alt_id
_pdbx_unobs_or_zero_occ_atoms.label_asym_id
_pdbx_unobs_or_zero_occ_atoms.label_comp_id
_pdbx_unobs_or_zero_occ_atoms.label_seq_id
_pdbx_unobs_or_zero_occ_atoms.label_atom_id
1 1 Y 1 A PRO 33 ? CG ? A PRO 33 CG
2 1 Y 1 A PRO 33 ? CD ? A PRO 33 CD
3 1 Y 1 A LEU 34 ? CG ? A LEU 34 CG
4 1 Y 1 A LEU 34 ? CD1 ? A LEU 34 CD1
5 1 Y 1 A LEU 34 ? CD2 ? A LEU 34 CD2
6 1 Y 1 A GLU 35 ? CG ? A GLU 35 CG
7 1 Y 1 A GLU 35 ? CD ? A GLU 35 CD
8 1 Y 1 A GLU 35 ? OE1 ? A GLU 35 OE1
9 1 Y 1 A GLU 35 ? OE2 ? A GLU 35 OE2
10 1 Y 1 A GLN 39 ? CG ? A GLN 39 CG
11 1 Y 1 A GLN 39 ? CD ? A GLN 39 CD
12 1 Y 1 A GLN 39 ? OE1 ? A GLN 39 OE1
13 1 Y 1 A GLN 39 ? NE2 ? A GLN 39 NE2
14 1 Y 1 A SER 46 ? OG ? A SER 46 OG
15 1 Y 1 A PHE 49 ? CG ? A PHE 49 CG
16 1 Y 1 A PHE 49 ? CD1 ? A PHE 49 CD1
17 1 Y 1 A PHE 49 ? CD2 ? A PHE 49 CD2
18 1 Y 1 A PHE 49 ? CE1 ? A PHE 49 CE1
19 1 Y 1 A PHE 49 ? CE2 ? A PHE 49 CE2
20 1 Y 1 A PHE 49 ? CZ ? A PHE 49 CZ
21 1 Y 1 A ILE 56 ? CG2 ? A ILE 56 CG2
22 1 Y 1 A ILE 56 ? CD1 ? A ILE 56 CD1
23 1 Y 1 A VAL 58 ? CG1 ? A VAL 58 CG1
24 1 Y 1 A SER 59 ? OG ? A SER 59 OG
25 1 Y 1 A ASN 61 ? OD1 ? A ASN 61 OD1
26 1 Y 1 A ASN 61 ? ND2 ? A ASN 61 ND2
27 1 Y 1 A ASP 72 ? OD1 ? A ASP 72 OD1
28 1 Y 1 A ASP 72 ? OD2 ? A ASP 72 OD2
29 1 Y 1 A ARG 73 ? NH1 ? A ARG 73 NH1
30 1 Y 1 A SER 75 ? OG ? A SER 75 OG
31 1 Y 1 A GLU 79 ? CG ? A GLU 79 CG
32 1 Y 1 A GLU 79 ? CD ? A GLU 79 CD
33 1 Y 1 A GLU 79 ? OE1 ? A GLU 79 OE1
34 1 Y 1 A GLU 79 ? OE2 ? A GLU 79 OE2
35 1 Y 1 A LEU 80 ? CD1 ? A LEU 80 CD1
36 1 Y 1 A LEU 80 ? CD2 ? A LEU 80 CD2
37 1 Y 1 A PRO 81 ? CG ? A PRO 81 CG
38 1 Y 1 A PRO 81 ? CD ? A PRO 81 CD
39 1 Y 1 A ASN 82 ? CG ? A ASN 82 CG
40 1 Y 1 A ASN 82 ? OD1 ? A ASN 82 OD1
41 1 Y 1 A ASN 82 ? ND2 ? A ASN 82 ND2
42 1 Y 1 A THR 84 ? OG1 ? A THR 84 OG1
43 1 Y 1 A THR 84 ? CG2 ? A THR 84 CG2
44 1 Y 1 A ARG 85 ? CG ? A ARG 85 CG
45 1 Y 1 A ARG 85 ? CD ? A ARG 85 CD
46 1 Y 1 A ARG 85 ? NE ? A ARG 85 NE
47 1 Y 1 A ARG 85 ? CZ ? A ARG 85 CZ
48 1 Y 1 A ARG 85 ? NH1 ? A ARG 85 NH1
49 1 Y 1 A ARG 85 ? NH2 ? A ARG 85 NH2
50 1 Y 1 A LYS 94 ? CE ? A LYS 94 CE
51 1 Y 1 A LYS 94 ? NZ ? A LYS 94 NZ
52 1 Y 1 A SER 101 ? OG ? A SER 101 OG
53 1 Y 1 A ARG 105 ? NE ? A ARG 105 NE
54 1 Y 1 A ARG 105 ? CZ ? A ARG 105 CZ
55 1 Y 1 A ARG 105 ? NH1 ? A ARG 105 NH1
56 1 Y 1 A ARG 105 ? NH2 ? A ARG 105 NH2
57 1 Y 1 A ASP 114 ? OD1 ? A ASP 114 OD1
58 1 Y 1 A GLU 124 ? CD ? A GLU 124 CD
59 1 Y 1 A GLU 124 ? OE1 ? A GLU 124 OE1
60 1 Y 1 A GLU 124 ? OE2 ? A GLU 124 OE2
61 1 Y 1 A ARG 179 ? CZ ? A ARG 179 CZ
62 1 Y 1 A ARG 179 ? NH1 ? A ARG 179 NH1
63 1 Y 1 A ARG 179 ? NH2 ? A ARG 179 NH2
64 1 Y 1 A ARG 214 ? NH1 ? A ARG 214 NH1
65 1 Y 1 A HIS 216 ? CG ? A HIS 216 CG
66 1 Y 1 A HIS 216 ? ND1 ? A HIS 216 ND1
67 1 Y 1 A HIS 216 ? CD2 ? A HIS 216 CD2
68 1 Y 1 A HIS 216 ? CE1 ? A HIS 216 CE1
69 1 Y 1 A HIS 216 ? NE2 ? A HIS 216 NE2
70 1 Y 1 A ARG 217 ? CD ? A ARG 217 CD
71 1 Y 1 A ARG 217 ? NE ? A ARG 217 NE
72 1 Y 1 A ARG 217 ? CZ ? A ARG 217 CZ
73 1 Y 1 A ARG 217 ? NH1 ? A ARG 217 NH1
74 1 Y 1 A ARG 217 ? NH2 ? A ARG 217 NH2
75 1 Y 1 A GLU 246 ? OE2 ? A GLU 246 OE2
76 1 Y 1 A ILE 249 ? CD1 ? A ILE 249 CD1
77 1 Y 1 A GLN 252 ? OE1 ? A GLN 252 OE1
78 1 Y 1 A GLU 262 ? OE2 ? A GLU 262 OE2
79 1 Y 1 A ARG 274 ? CG ? A ARG 274 CG
80 1 Y 1 A ARG 274 ? CD ? A ARG 274 CD
81 1 Y 1 A ARG 274 ? NE ? A ARG 274 NE
82 1 Y 1 A ARG 274 ? CZ ? A ARG 274 CZ
83 1 Y 1 A ARG 274 ? NH1 ? A ARG 274 NH1
84 1 Y 1 A ARG 274 ? NH2 ? A ARG 274 NH2
85 1 Y 1 A GLN 297 ? CG ? A GLN 297 CG
86 1 Y 1 A GLN 297 ? CD ? A GLN 297 CD
87 1 Y 1 A GLN 297 ? OE1 ? A GLN 297 OE1
88 1 Y 1 A GLN 297 ? NE2 ? A GLN 297 NE2
89 1 Y 1 D LYS 3 ? CG ? B LYS 3 CG
90 1 Y 1 D LYS 3 ? CD ? B LYS 3 CD
91 1 Y 1 D LYS 3 ? CE ? B LYS 3 CE
92 1 Y 1 D LYS 3 ? NZ ? B LYS 3 NZ
93 1 Y 1 D ARG 5 ? NH2 ? B ARG 5 NH2
#
loop_
_software.citation_id
_software.classification
_software.compiler_name
_software.compiler_version
_software.contact_author
_software.contact_author_email
_software.date
_software.description
_software.dependencies
_software.hardware
_software.language
_software.location
_software.mods
_software.name
_software.os
_software.os_version
_software.type
_software.version
_software.pdbx_ordinal
? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MxCuBE ? ? ? . 2
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 1.02 3
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 1.02 4
? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.7.1 5
? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 6
#
_cell.angle_alpha 90.000
_cell.angle_alpha_esd ?
_cell.angle_beta 90.000
_cell.angle_beta_esd ?
_cell.angle_gamma 120.000
_cell.angle_gamma_esd ?
_cell.entry_id 7QFM
_cell.details ?
_cell.formula_units_Z ?
_cell.length_a 96.818
_cell.length_a_esd ?
_cell.length_b 96.818
_cell.length_b_esd ?
_cell.length_c 80.147
_cell.length_c_esd ?
_cell.volume 650624.056
_cell.volume_esd ?
_cell.Z_PDB 6
_cell.reciprocal_angle_alpha ?
_cell.reciprocal_angle_beta ?
_cell.reciprocal_angle_gamma ?
_cell.reciprocal_angle_alpha_esd ?
_cell.reciprocal_angle_beta_esd ?
_cell.reciprocal_angle_gamma_esd ?
_cell.reciprocal_length_a ?
_cell.reciprocal_length_b ?
_cell.reciprocal_length_c ?
_cell.reciprocal_length_a_esd ?
_cell.reciprocal_length_b_esd ?
_cell.reciprocal_length_c_esd ?
_cell.pdbx_unique_axis ?
#
_symmetry.entry_id 7QFM
_symmetry.cell_setting ?
_symmetry.Int_Tables_number 170
_symmetry.space_group_name_Hall 'P 65'
_symmetry.space_group_name_H-M 'P 65'
_symmetry.pdbx_full_space_group_name_H-M ?
#
_exptl.absorpt_coefficient_mu ?
_exptl.absorpt_correction_T_max ?
_exptl.absorpt_correction_T_min ?
_exptl.absorpt_correction_type ?
_exptl.absorpt_process_details ?
_exptl.entry_id 7QFM
_exptl.crystals_number 1
_exptl.details ?
_exptl.method 'X-RAY DIFFRACTION'
_exptl.method_details ?
#
_exptl_crystal.colour ?
_exptl_crystal.density_diffrn ?
_exptl_crystal.density_Matthews 3.1
_exptl_crystal.density_method ?
_exptl_crystal.density_percent_sol 59.7
_exptl_crystal.description ?
_exptl_crystal.F_000 ?
_exptl_crystal.id 1
_exptl_crystal.preparation ?
_exptl_crystal.size_max ?
_exptl_crystal.size_mid ?
_exptl_crystal.size_min ?
_exptl_crystal.size_rad ?
_exptl_crystal.colour_lustre ?
_exptl_crystal.colour_modifier ?
_exptl_crystal.colour_primary ?
_exptl_crystal.density_meas ?
_exptl_crystal.density_meas_esd ?
_exptl_crystal.density_meas_gt ?
_exptl_crystal.density_meas_lt ?
_exptl_crystal.density_meas_temp ?
_exptl_crystal.density_meas_temp_esd ?
_exptl_crystal.density_meas_temp_gt ?
_exptl_crystal.density_meas_temp_lt ?
_exptl_crystal.pdbx_crystal_image_url ?
_exptl_crystal.pdbx_crystal_image_format ?
_exptl_crystal.pdbx_mosaicity ?
_exptl_crystal.pdbx_mosaicity_esd ?
#
_exptl_crystal_grow.apparatus ?
_exptl_crystal_grow.atmosphere ?
_exptl_crystal_grow.crystal_id 1
_exptl_crystal_grow.details ?
_exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP'
_exptl_crystal_grow.method_ref ?
_exptl_crystal_grow.pH 7.0
_exptl_crystal_grow.pressure ?
_exptl_crystal_grow.pressure_esd ?
_exptl_crystal_grow.seeding ?
_exptl_crystal_grow.seeding_ref ?
_exptl_crystal_grow.temp 291.15
_exptl_crystal_grow.temp_details ?
_exptl_crystal_grow.temp_esd ?
_exptl_crystal_grow.time ?
_exptl_crystal_grow.pdbx_details '100 mM bis-tris propane (pH 7.0), 10% ethylene glycol, 0.3% DMSO, 20% PEG3350, 200 mM MgOAc'
_exptl_crystal_grow.pdbx_pH_range '6.8 - 7.2'
#
_diffrn.ambient_environment ?
_diffrn.ambient_temp 100
_diffrn.ambient_temp_details ?
_diffrn.ambient_temp_esd ?
_diffrn.crystal_id 1
_diffrn.crystal_support ?
_diffrn.crystal_treatment ?
_diffrn.details ?
_diffrn.id 1
_diffrn.ambient_pressure ?
_diffrn.ambient_pressure_esd ?
_diffrn.ambient_pressure_gt ?
_diffrn.ambient_pressure_lt ?
_diffrn.ambient_temp_gt ?
_diffrn.ambient_temp_lt ?
_diffrn.pdbx_serial_crystal_experiment N
#
_diffrn_detector.details 'Sagitally bended Si111-crystal'
_diffrn_detector.detector PIXEL
_diffrn_detector.diffrn_id 1
_diffrn_detector.type 'DECTRIS PILATUS 6M'
_diffrn_detector.area_resol_mean ?
_diffrn_detector.dtime ?
_diffrn_detector.pdbx_frames_total ?
_diffrn_detector.pdbx_collection_time_total ?
_diffrn_detector.pdbx_collection_date 2020-10-23
_diffrn_detector.pdbx_frequency ?
#
_diffrn_radiation.collimation ?
_diffrn_radiation.diffrn_id 1
_diffrn_radiation.filter_edge ?
_diffrn_radiation.inhomogeneity ?
_diffrn_radiation.monochromator 'Double crystal'
_diffrn_radiation.polarisn_norm ?
_diffrn_radiation.polarisn_ratio ?
_diffrn_radiation.probe ?
_diffrn_radiation.type ?
_diffrn_radiation.xray_symbol ?
_diffrn_radiation.wavelength_id 1
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l M
_diffrn_radiation.pdbx_wavelength_list ?
_diffrn_radiation.pdbx_wavelength ?
_diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH'
_diffrn_radiation.pdbx_analyzer ?
_diffrn_radiation.pdbx_scattering_type x-ray
#
_diffrn_radiation_wavelength.id 1
_diffrn_radiation_wavelength.wavelength 0.9184
_diffrn_radiation_wavelength.wt 1.0
#
_diffrn_source.current ?
_diffrn_source.details ?
_diffrn_source.diffrn_id 1
_diffrn_source.power ?
_diffrn_source.size ?
_diffrn_source.source SYNCHROTRON
_diffrn_source.target ?
_diffrn_source.type 'BESSY BEAMLINE 14.1'
_diffrn_source.voltage ?
_diffrn_source.take-off_angle ?
_diffrn_source.pdbx_wavelength_list 0.9184
_diffrn_source.pdbx_wavelength ?
_diffrn_source.pdbx_synchrotron_beamline 14.1
_diffrn_source.pdbx_synchrotron_site BESSY
#
_reflns.B_iso_Wilson_estimate 34.91
_reflns.entry_id 7QFM
_reflns.data_reduction_details ?
_reflns.data_reduction_method ?
_reflns.d_resolution_high 1.95
_reflns.d_resolution_low 48.409
_reflns.details ?
_reflns.limit_h_max ?
_reflns.limit_h_min ?
_reflns.limit_k_max ?
_reflns.limit_k_min ?
_reflns.limit_l_max ?
_reflns.limit_l_min ?
_reflns.number_all ?
_reflns.number_obs 31177
_reflns.observed_criterion ?
_reflns.observed_criterion_F_max ?
_reflns.observed_criterion_F_min ?
_reflns.observed_criterion_I_max ?
_reflns.observed_criterion_I_min ?
_reflns.observed_criterion_sigma_F ?
_reflns.observed_criterion_sigma_I ?
_reflns.percent_possible_obs 99.7
_reflns.R_free_details ?
_reflns.Rmerge_F_all ?
_reflns.Rmerge_F_obs ?
_reflns.Friedel_coverage ?
_reflns.number_gt ?
_reflns.threshold_expression ?
_reflns.pdbx_redundancy 20.7
_reflns.pdbx_Rmerge_I_obs ?
_reflns.pdbx_Rmerge_I_all ?
_reflns.pdbx_Rsym_value 0.038
_reflns.pdbx_netI_over_av_sigmaI ?
_reflns.pdbx_netI_over_sigmaI 50.0
_reflns.pdbx_res_netI_over_av_sigmaI_2 ?
_reflns.pdbx_res_netI_over_sigmaI_2 ?
_reflns.pdbx_chi_squared ?
_reflns.pdbx_scaling_rejects ?
_reflns.pdbx_d_res_high_opt ?
_reflns.pdbx_d_res_low_opt ?
_reflns.pdbx_d_res_opt_method ?
_reflns.phase_calculation_details ?
_reflns.pdbx_Rrim_I_all ?
_reflns.pdbx_Rpim_I_all ?
_reflns.pdbx_d_opt ?
_reflns.pdbx_number_measured_all ?
_reflns.pdbx_diffrn_id 1
_reflns.pdbx_ordinal 1
_reflns.pdbx_CC_half 1.0
_reflns.pdbx_CC_star ?
_reflns.pdbx_R_split ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_1 ?
_reflns.pdbx_aniso_diffraction_limit_2 ?
_reflns.pdbx_aniso_diffraction_limit_3 ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_1 ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_2 ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_3 ?
_reflns.pdbx_orthogonalization_convention ?
_reflns.pdbx_percent_possible_ellipsoidal ?
_reflns.pdbx_percent_possible_spherical ?
_reflns.pdbx_percent_possible_ellipsoidal_anomalous ?
_reflns.pdbx_percent_possible_spherical_anomalous ?
_reflns.pdbx_redundancy_anomalous ?
_reflns.pdbx_CC_half_anomalous ?
_reflns.pdbx_absDiff_over_sigma_anomalous ?
_reflns.pdbx_percent_possible_anomalous ?
_reflns.pdbx_observed_signal_threshold ?
_reflns.pdbx_signal_type ?
_reflns.pdbx_signal_details ?
_reflns.pdbx_signal_software_id ?
#
_reflns_shell.d_res_high 1.95
_reflns_shell.d_res_low 2.07
_reflns_shell.meanI_over_sigI_all ?
_reflns_shell.meanI_over_sigI_obs 7.8
_reflns_shell.number_measured_all ?
_reflns_shell.number_measured_obs ?
_reflns_shell.number_possible ?
_reflns_shell.number_unique_all ?
_reflns_shell.number_unique_obs 4980
_reflns_shell.percent_possible_all 99.0
_reflns_shell.percent_possible_obs ?
_reflns_shell.Rmerge_F_all ?
_reflns_shell.Rmerge_F_obs ?
_reflns_shell.Rmerge_I_all ?
_reflns_shell.Rmerge_I_obs ?
_reflns_shell.meanI_over_sigI_gt ?
_reflns_shell.meanI_over_uI_all ?
_reflns_shell.meanI_over_uI_gt ?
_reflns_shell.number_measured_gt ?
_reflns_shell.number_unique_gt ?
_reflns_shell.percent_possible_gt ?
_reflns_shell.Rmerge_F_gt ?
_reflns_shell.Rmerge_I_gt ?
_reflns_shell.pdbx_redundancy 21.0
_reflns_shell.pdbx_Rsym_value 0.44
_reflns_shell.pdbx_chi_squared ?
_reflns_shell.pdbx_netI_over_sigmaI_all ?
_reflns_shell.pdbx_netI_over_sigmaI_obs ?
_reflns_shell.pdbx_Rrim_I_all ?
_reflns_shell.pdbx_Rpim_I_all ?
_reflns_shell.pdbx_rejects ?
_reflns_shell.pdbx_ordinal 1
_reflns_shell.pdbx_diffrn_id 1
_reflns_shell.pdbx_CC_half 1.0
_reflns_shell.pdbx_CC_star ?
_reflns_shell.pdbx_R_split ?
_reflns_shell.pdbx_percent_possible_ellipsoidal ?
_reflns_shell.pdbx_percent_possible_spherical ?
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ?
_reflns_shell.pdbx_percent_possible_spherical_anomalous ?
_reflns_shell.pdbx_redundancy_anomalous ?
_reflns_shell.pdbx_CC_half_anomalous ?
_reflns_shell.pdbx_absDiff_over_sigma_anomalous ?
_reflns_shell.pdbx_percent_possible_anomalous ?
#
_refine.aniso_B[1][1] ?
_refine.aniso_B[1][2] ?
_refine.aniso_B[1][3] ?
_refine.aniso_B[2][2] ?
_refine.aniso_B[2][3] ?
_refine.aniso_B[3][3] ?
_refine.B_iso_max ?
_refine.B_iso_mean 43.25
_refine.B_iso_min ?
_refine.correlation_coeff_Fo_to_Fc ?
_refine.correlation_coeff_Fo_to_Fc_free ?
_refine.details ?
_refine.diff_density_max ?
_refine.diff_density_max_esd ?
_refine.diff_density_min ?
_refine.diff_density_min_esd ?
_refine.diff_density_rms ?
_refine.diff_density_rms_esd ?
_refine.entry_id 7QFM
_refine.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine.ls_abs_structure_details ?
_refine.ls_abs_structure_Flack ?
_refine.ls_abs_structure_Flack_esd ?
_refine.ls_abs_structure_Rogers ?
_refine.ls_abs_structure_Rogers_esd ?
_refine.ls_d_res_high 1.95
_refine.ls_d_res_low 41.92
_refine.ls_extinction_coef ?
_refine.ls_extinction_coef_esd ?
_refine.ls_extinction_expression ?
_refine.ls_extinction_method ?
_refine.ls_goodness_of_fit_all ?
_refine.ls_goodness_of_fit_all_esd ?
_refine.ls_goodness_of_fit_obs ?
_refine.ls_goodness_of_fit_obs_esd ?
_refine.ls_hydrogen_treatment ?
_refine.ls_matrix_type ?
_refine.ls_number_constraints ?
_refine.ls_number_parameters ?
_refine.ls_number_reflns_all ?
_refine.ls_number_reflns_obs 31152
_refine.ls_number_reflns_R_free 1556
_refine.ls_number_reflns_R_work 29596
_refine.ls_number_restraints ?
_refine.ls_percent_reflns_obs 99.62
_refine.ls_percent_reflns_R_free 4.99
_refine.ls_R_factor_all ?
_refine.ls_R_factor_obs 0.1593
_refine.ls_R_factor_R_free 0.1779
_refine.ls_R_factor_R_free_error ?
_refine.ls_R_factor_R_free_error_details ?
_refine.ls_R_factor_R_work 0.1583
_refine.ls_R_Fsqd_factor_obs ?
_refine.ls_R_I_factor_obs ?
_refine.ls_redundancy_reflns_all ?
_refine.ls_redundancy_reflns_obs ?
_refine.ls_restrained_S_all ?
_refine.ls_restrained_S_obs ?
_refine.ls_shift_over_esd_max ?
_refine.ls_shift_over_esd_mean ?
_refine.ls_structure_factor_coef ?
_refine.ls_weighting_details ?
_refine.ls_weighting_scheme ?
_refine.ls_wR_factor_all ?
_refine.ls_wR_factor_obs ?
_refine.ls_wR_factor_R_free ?
_refine.ls_wR_factor_R_work ?
_refine.occupancy_max ?
_refine.occupancy_min ?
_refine.solvent_model_details 'FLAT BULK SOLVENT MODEL'
_refine.solvent_model_param_bsol ?
_refine.solvent_model_param_ksol ?
_refine.pdbx_R_complete ?
_refine.ls_R_factor_gt ?
_refine.ls_goodness_of_fit_gt ?
_refine.ls_goodness_of_fit_ref ?
_refine.ls_shift_over_su_max ?
_refine.ls_shift_over_su_max_lt ?
_refine.ls_shift_over_su_mean ?
_refine.ls_shift_over_su_mean_lt ?
_refine.pdbx_ls_sigma_I ?
_refine.pdbx_ls_sigma_F 1.38
_refine.pdbx_ls_sigma_Fsqd ?
_refine.pdbx_data_cutoff_high_absF ?
_refine.pdbx_data_cutoff_high_rms_absF ?
_refine.pdbx_data_cutoff_low_absF ?
_refine.pdbx_isotropic_thermal_model ?
_refine.pdbx_ls_cross_valid_method 'FREE R-VALUE'
_refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT'
_refine.pdbx_starting_model 5NDT
_refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2'
_refine.pdbx_R_Free_selection_details ?
_refine.pdbx_stereochem_target_val_spec_case ?
_refine.pdbx_overall_ESU_R ?
_refine.pdbx_overall_ESU_R_Free ?
_refine.pdbx_solvent_vdw_probe_radii 1.1100
_refine.pdbx_solvent_ion_probe_radii ?
_refine.pdbx_solvent_shrinkage_radii 0.9000
_refine.pdbx_real_space_R ?
_refine.pdbx_density_correlation ?
_refine.pdbx_pd_number_of_powder_patterns ?
_refine.pdbx_pd_number_of_points ?
_refine.pdbx_pd_meas_number_of_points ?
_refine.pdbx_pd_proc_ls_prof_R_factor ?
_refine.pdbx_pd_proc_ls_prof_wR_factor ?
_refine.pdbx_pd_Marquardt_correlation_coeff ?
_refine.pdbx_pd_Fsqrd_R_factor ?
_refine.pdbx_pd_ls_matrix_band_width ?
_refine.pdbx_overall_phase_error 17.2189
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI ?
_refine.pdbx_overall_SU_R_free_Blow_DPI ?
_refine.pdbx_overall_SU_R_Blow_DPI ?
_refine.pdbx_TLS_residual_ADP_flag ?
_refine.pdbx_diffrn_id 1
_refine.overall_SU_B ?
_refine.overall_SU_ML 0.1450
_refine.overall_SU_R_Cruickshank_DPI ?
_refine.overall_SU_R_free ?
_refine.overall_FOM_free_R_set ?
_refine.overall_FOM_work_R_set ?
_refine.pdbx_average_fsc_overall ?
_refine.pdbx_average_fsc_work ?
_refine.pdbx_average_fsc_free ?
#
_refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_hist.cycle_id LAST
_refine_hist.details ?
_refine_hist.d_res_high 1.95
_refine_hist.d_res_low 41.92
_refine_hist.number_atoms_solvent 123
_refine_hist.number_atoms_total 2345
_refine_hist.number_reflns_all ?
_refine_hist.number_reflns_obs ?
_refine_hist.number_reflns_R_free ?
_refine_hist.number_reflns_R_work ?
_refine_hist.R_factor_all ?
_refine_hist.R_factor_obs ?
_refine_hist.R_factor_R_free ?
_refine_hist.R_factor_R_work ?
_refine_hist.pdbx_number_residues_total ?
_refine_hist.pdbx_B_iso_mean_ligand ?
_refine_hist.pdbx_B_iso_mean_solvent ?
_refine_hist.pdbx_number_atoms_protein 2196
_refine_hist.pdbx_number_atoms_nucleic_acid 0
_refine_hist.pdbx_number_atoms_ligand 26
_refine_hist.pdbx_number_atoms_lipid ?
_refine_hist.pdbx_number_atoms_carb ?
_refine_hist.pdbx_pseudo_atom_details ?
#
loop_
_refine_ls_restr.pdbx_refine_id
_refine_ls_restr.criterion
_refine_ls_restr.dev_ideal
_refine_ls_restr.dev_ideal_target
_refine_ls_restr.number
_refine_ls_restr.rejects
_refine_ls_restr.type
_refine_ls_restr.weight
_refine_ls_restr.pdbx_restraint_function
'X-RAY DIFFRACTION' ? 0.0067 ? 2316 ? f_bond_d ? ?
'X-RAY DIFFRACTION' ? 0.7850 ? 3147 ? f_angle_d ? ?
'X-RAY DIFFRACTION' ? 0.0539 ? 339 ? f_chiral_restr ? ?
'X-RAY DIFFRACTION' ? 0.0050 ? 428 ? f_plane_restr ? ?
'X-RAY DIFFRACTION' ? 21.2391 ? 1373 ? f_dihedral_angle_d ? ?
#
loop_
_refine_ls_shell.pdbx_refine_id
_refine_ls_shell.d_res_high
_refine_ls_shell.d_res_low
_refine_ls_shell.number_reflns_all
_refine_ls_shell.number_reflns_obs
_refine_ls_shell.number_reflns_R_free
_refine_ls_shell.number_reflns_R_work
_refine_ls_shell.percent_reflns_obs
_refine_ls_shell.percent_reflns_R_free
_refine_ls_shell.R_factor_all
_refine_ls_shell.R_factor_obs
_refine_ls_shell.R_factor_R_free
_refine_ls_shell.R_factor_R_free_error
_refine_ls_shell.R_factor_R_work
_refine_ls_shell.redundancy_reflns_all
_refine_ls_shell.redundancy_reflns_obs
_refine_ls_shell.wR_factor_all
_refine_ls_shell.wR_factor_obs
_refine_ls_shell.wR_factor_R_free
_refine_ls_shell.wR_factor_R_work
_refine_ls_shell.pdbx_R_complete
_refine_ls_shell.pdbx_total_number_of_bins_used
_refine_ls_shell.pdbx_phase_error
_refine_ls_shell.pdbx_fsc_work
_refine_ls_shell.pdbx_fsc_free
'X-RAY DIFFRACTION' 1.95 2.01 . . 138 2638 98.37 . . . 0.1870 . 0.1605 . . . . . . . . . . .
'X-RAY DIFFRACTION' 2.01 2.08 . . 140 2671 99.61 . . . 0.1743 . 0.1461 . . . . . . . . . . .
'X-RAY DIFFRACTION' 2.08 2.17 . . 141 2681 99.72 . . . 0.1797 . 0.1482 . . . . . . . . . . .
'X-RAY DIFFRACTION' 2.17 2.26 . . 141 2686 99.93 . . . 0.1785 . 0.1580 . . . . . . . . . . .
'X-RAY DIFFRACTION' 2.26 2.38 . . 141 2673 99.54 . . . 0.1599 . 0.1518 . . . . . . . . . . .
'X-RAY DIFFRACTION' 2.38 2.53 . . 141 2701 99.93 . . . 0.2012 . 0.1613 . . . . . . . . . . .
'X-RAY DIFFRACTION' 2.53 2.73 . . 142 2687 99.96 . . . 0.1884 . 0.1707 . . . . . . . . . . .
'X-RAY DIFFRACTION' 2.73 3.00 . . 142 2704 100.00 . . . 0.1810 . 0.1675 . . . . . . . . . . .
'X-RAY DIFFRACTION' 3.00 3.44 . . 142 2698 99.65 . . . 0.1862 . 0.1621 . . . . . . . . . . .
'X-RAY DIFFRACTION' 3.44 4.33 . . 143 2711 99.93 . . . 0.1672 . 0.1507 . . . . . . . . . . .
'X-RAY DIFFRACTION' 4.33 41.92 . . 145 2746 99.42 . . . 0.1768 . 0.1595 . . . . . . . . . . .
#
_struct.entry_id 7QFM
_struct.title 'Pim1 in complex with (E)-4-((2-oxoindolin-3-ylidene)methyl)benzoic acid and Pimtide'
_struct.pdbx_model_details ?
_struct.pdbx_formula_weight ?
_struct.pdbx_formula_weight_method ?
_struct.pdbx_model_type_details ?
_struct.pdbx_CASP_flag N
#
_struct_keywords.entry_id 7QFM
_struct_keywords.text
;SERINE KINASE, KINASE, COMPLEX, PIM1, PIM, PIM-1, INHIBITOR, TUMORIGENISIS, CANCER, PIMTIDE, PROTO ONCOGEN, ATP, PHOSPHORYLATION, APOPTOSIS, CELL CYCLE, TRANSFERASE
;
_struct_keywords.pdbx_keywords TRANSFERASE
#
loop_
_struct_asym.id
_struct_asym.pdbx_blank_PDB_chainid_flag
_struct_asym.pdbx_modified
_struct_asym.entity_id
_struct_asym.details
A N N 1 ?
B N N 2 ?
C N N 3 ?
D N N 4 ?
E N N 5 ?
F N N 5 ?
#
loop_
_struct_ref.id
_struct_ref.db_name
_struct_ref.db_code
_struct_ref.pdbx_db_accession
_struct_ref.pdbx_db_isoform
_struct_ref.entity_id
_struct_ref.pdbx_seq_one_letter_code
_struct_ref.pdbx_align_begin
1 UNP PIM1_HUMAN P11309 ? 1
;MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGEL
PNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHN
CGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
;
1
2 PDB 7QFM 7QFM ? 2 ? 1
#
loop_
_struct_ref_seq.align_id
_struct_ref_seq.ref_id
_struct_ref_seq.pdbx_PDB_id_code
_struct_ref_seq.pdbx_strand_id
_struct_ref_seq.seq_align_beg
_struct_ref_seq.pdbx_seq_align_beg_ins_code
_struct_ref_seq.seq_align_end
_struct_ref_seq.pdbx_seq_align_end_ins_code
_struct_ref_seq.pdbx_db_accession
_struct_ref_seq.db_align_beg
_struct_ref_seq.pdbx_db_align_beg_ins_code
_struct_ref_seq.db_align_end
_struct_ref_seq.pdbx_db_align_end_ins_code
_struct_ref_seq.pdbx_auth_seq_align_beg
_struct_ref_seq.pdbx_auth_seq_align_end
1 1 7QFM A 1 ? 312 ? P11309 1 ? 312 ? 1 312
2 2 7QFM D 1 ? 14 ? 7QFM 1 ? 14 ? 1 14
#
_struct_ref_seq_dif.align_id 1
_struct_ref_seq_dif.pdbx_pdb_id_code 7QFM
_struct_ref_seq_dif.mon_id GLY
_struct_ref_seq_dif.pdbx_pdb_strand_id A
_struct_ref_seq_dif.seq_num 250
_struct_ref_seq_dif.pdbx_pdb_ins_code ?
_struct_ref_seq_dif.pdbx_seq_db_name UNP
_struct_ref_seq_dif.pdbx_seq_db_accession_code P11309
_struct_ref_seq_dif.db_mon_id ARG
_struct_ref_seq_dif.pdbx_seq_db_seq_num 250
_struct_ref_seq_dif.details 'engineered mutation'
_struct_ref_seq_dif.pdbx_auth_seq_num 250
_struct_ref_seq_dif.pdbx_ordinal 1
#
_pdbx_struct_assembly.id 1
_pdbx_struct_assembly.details author_defined_assembly
_pdbx_struct_assembly.method_details ?
_pdbx_struct_assembly.oligomeric_details dimeric
_pdbx_struct_assembly.oligomeric_count 2
#
loop_
_pdbx_struct_assembly_prop.biol_id
_pdbx_struct_assembly_prop.type
_pdbx_struct_assembly_prop.value
_pdbx_struct_assembly_prop.details
1 'ABSA (A^2)' 1380 ?
1 MORE 3 ?
1 'SSA (A^2)' 12620 ?
#
_pdbx_struct_assembly_gen.assembly_id 1
_pdbx_struct_assembly_gen.oper_expression 1
_pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F
#
_pdbx_struct_assembly_auth_evidence.id 1
_pdbx_struct_assembly_auth_evidence.assembly_id 1
_pdbx_struct_assembly_auth_evidence.experimental_support none
_pdbx_struct_assembly_auth_evidence.details ?
#
_pdbx_struct_oper_list.id 1
_pdbx_struct_oper_list.type 'identity operation'
_pdbx_struct_oper_list.name 1_555
_pdbx_struct_oper_list.symmetry_operation x,y,z
_pdbx_struct_oper_list.matrix[1][1] 1.0000000000
_pdbx_struct_oper_list.matrix[1][2] 0.0000000000
_pdbx_struct_oper_list.matrix[1][3] 0.0000000000
_pdbx_struct_oper_list.vector[1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][2] 1.0000000000
_pdbx_struct_oper_list.matrix[2][3] 0.0000000000
_pdbx_struct_oper_list.vector[2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][1] 0.0000000000
_pdbx_struct_oper_list.matrix[3][2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][3] 1.0000000000
_pdbx_struct_oper_list.vector[3] 0.0000000000
#
loop_
_struct_conf.conf_type_id
_struct_conf.id
_struct_conf.pdbx_PDB_helix_id
_struct_conf.beg_label_comp_id
_struct_conf.beg_label_asym_id
_struct_conf.beg_label_seq_id
_struct_conf.pdbx_beg_PDB_ins_code
_struct_conf.end_label_comp_id
_struct_conf.end_label_asym_id
_struct_conf.end_label_seq_id
_struct_conf.pdbx_end_PDB_ins_code
_struct_conf.beg_auth_comp_id
_struct_conf.beg_auth_asym_id
_struct_conf.beg_auth_seq_id
_struct_conf.end_auth_comp_id
_struct_conf.end_auth_asym_id
_struct_conf.end_auth_seq_id
_struct_conf.pdbx_PDB_helix_class
_struct_conf.details
_struct_conf.pdbx_PDB_helix_length
HELX_P HELX_P1 AA1 PRO A 33 ? GLN A 37 ? PRO A 33 GLN A 37 1 ? 5
HELX_P HELX_P2 AA2 ASP A 72 ? ILE A 74 ? ASP A 72 ILE A 74 5 ? 3
HELX_P HELX_P3 AA3 MET A 88 ? SER A 97 ? MET A 88 SER A 97 1 ? 10
HELX_P HELX_P4 AA4 LEU A 129 ? GLY A 137 ? LEU A 129 GLY A 137 1 ? 9
HELX_P HELX_P5 AA5 GLN A 140 ? CYS A 161 ? GLN A 140 CYS A 161 1 ? 22
HELX_P HELX_P6 AA6 LYS A 169 ? GLU A 171 ? LYS A 169 GLU A 171 5 ? 3
HELX_P HELX_P7 AA7 THR A 204 ? SER A 208 ? THR A 204 SER A 208 5 ? 5
HELX_P HELX_P8 AA8 PRO A 209 ? HIS A 216 ? PRO A 209 HIS A 216 1 ? 8
HELX_P HELX_P9 AA9 HIS A 219 ? GLY A 238 ? HIS A 219 GLY A 238 1 ? 20
HELX_P HELX_P10 AB1 HIS A 244 ? GLY A 251 ? HIS A 244 GLY A 251 1 ? 8
HELX_P HELX_P11 AB2 SER A 260 ? LEU A 271 ? SER A 260 LEU A 271 1 ? 12
HELX_P HELX_P12 AB3 ARG A 274 ? ARG A 278 ? ARG A 274 ARG A 278 5 ? 5
HELX_P HELX_P13 AB4 THR A 280 ? ASN A 286 ? THR A 280 ASN A 286 1 ? 7
HELX_P HELX_P14 AB5 HIS A 287 ? GLN A 291 ? HIS A 287 GLN A 291 5 ? 5
HELX_P HELX_P15 AB6 LEU A 295 ? LEU A 304 ? LEU A 295 LEU A 304 1 ? 10
#
_struct_conf_type.id HELX_P
_struct_conf_type.criteria ?
_struct_conf_type.reference ?
#
loop_
_struct_conn.id
_struct_conn.conn_type_id
_struct_conn.pdbx_leaving_atom_flag
_struct_conn.pdbx_PDB_id
_struct_conn.ptnr1_label_asym_id
_struct_conn.ptnr1_label_comp_id
_struct_conn.ptnr1_label_seq_id
_struct_conn.ptnr1_label_atom_id
_struct_conn.pdbx_ptnr1_label_alt_id
_struct_conn.pdbx_ptnr1_PDB_ins_code
_struct_conn.pdbx_ptnr1_standard_comp_id
_struct_conn.ptnr1_symmetry
_struct_conn.ptnr2_label_asym_id
_struct_conn.ptnr2_label_comp_id
_struct_conn.ptnr2_label_seq_id
_struct_conn.ptnr2_label_atom_id
_struct_conn.pdbx_ptnr2_label_alt_id
_struct_conn.pdbx_ptnr2_PDB_ins_code
_struct_conn.ptnr1_auth_asym_id
_struct_conn.ptnr1_auth_comp_id
_struct_conn.ptnr1_auth_seq_id
_struct_conn.ptnr2_auth_asym_id
_struct_conn.ptnr2_auth_comp_id
_struct_conn.ptnr2_auth_seq_id
_struct_conn.ptnr2_symmetry
_struct_conn.pdbx_ptnr3_label_atom_id
_struct_conn.pdbx_ptnr3_label_seq_id
_struct_conn.pdbx_ptnr3_label_comp_id
_struct_conn.pdbx_ptnr3_label_asym_id
_struct_conn.pdbx_ptnr3_label_alt_id
_struct_conn.pdbx_ptnr3_PDB_ins_code
_struct_conn.details
_struct_conn.pdbx_dist_value
_struct_conn.pdbx_value_order
_struct_conn.pdbx_role
covale1 covale both ? A SER 260 C ? ? ? 1_555 A SEP 261 N ? ? A SER 260 A SEP 261 1_555 ? ? ? ? ? ? ? 1.327 ? ?
covale2 covale both ? A SEP 261 C ? ? ? 1_555 A GLU 262 N ? ? A SEP 261 A GLU 262 1_555 ? ? ? ? ? ? ? 1.328 ? ?
#
_struct_conn_type.id covale
_struct_conn_type.criteria ?
_struct_conn_type.reference ?
#
_pdbx_modification_feature.ordinal 1
_pdbx_modification_feature.label_comp_id SEP
_pdbx_modification_feature.label_asym_id A
_pdbx_modification_feature.label_seq_id 261
_pdbx_modification_feature.label_alt_id ?
_pdbx_modification_feature.modified_residue_label_comp_id .
_pdbx_modification_feature.modified_residue_label_asym_id .
_pdbx_modification_feature.modified_residue_label_seq_id .
_pdbx_modification_feature.modified_residue_label_alt_id .
_pdbx_modification_feature.auth_comp_id SEP
_pdbx_modification_feature.auth_asym_id A
_pdbx_modification_feature.auth_seq_id 261
_pdbx_modification_feature.PDB_ins_code ?
_pdbx_modification_feature.symmetry 1_555
_pdbx_modification_feature.modified_residue_auth_comp_id .
_pdbx_modification_feature.modified_residue_auth_asym_id .
_pdbx_modification_feature.modified_residue_auth_seq_id .
_pdbx_modification_feature.modified_residue_PDB_ins_code .
_pdbx_modification_feature.modified_residue_symmetry .
_pdbx_modification_feature.comp_id_linking_atom .
_pdbx_modification_feature.modified_residue_id_linking_atom .
_pdbx_modification_feature.modified_residue_id SER
_pdbx_modification_feature.ref_pcm_id 1
_pdbx_modification_feature.ref_comp_id SEP
_pdbx_modification_feature.type Phosphorylation
_pdbx_modification_feature.category 'Named protein modification'
#
_struct_mon_prot_cis.pdbx_id 1
_struct_mon_prot_cis.label_comp_id GLU
_struct_mon_prot_cis.label_seq_id 124
_struct_mon_prot_cis.label_asym_id A
_struct_mon_prot_cis.label_alt_id .
_struct_mon_prot_cis.pdbx_PDB_ins_code ?
_struct_mon_prot_cis.auth_comp_id GLU
_struct_mon_prot_cis.auth_seq_id 124
_struct_mon_prot_cis.auth_asym_id A
_struct_mon_prot_cis.pdbx_label_comp_id_2 PRO
_struct_mon_prot_cis.pdbx_label_seq_id_2 125
_struct_mon_prot_cis.pdbx_label_asym_id_2 A
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 ?
_struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO
_struct_mon_prot_cis.pdbx_auth_seq_id_2 125
_struct_mon_prot_cis.pdbx_auth_asym_id_2 A
_struct_mon_prot_cis.pdbx_PDB_model_num 1
_struct_mon_prot_cis.pdbx_omega_angle -0.13
#
loop_
_struct_sheet.id
_struct_sheet.type
_struct_sheet.number_strands
_struct_sheet.details
AA1 ? 5 ?
AA2 ? 2 ?
AA3 ? 3 ?
AA4 ? 2 ?
#
loop_
_struct_sheet_order.sheet_id
_struct_sheet_order.range_id_1
_struct_sheet_order.range_id_2
_struct_sheet_order.offset
_struct_sheet_order.sense
AA1 1 2 ? anti-parallel
AA1 2 3 ? anti-parallel
AA1 3 4 ? anti-parallel
AA1 4 5 ? anti-parallel
AA2 1 2 ? anti-parallel
AA3 1 2 ? anti-parallel
AA3 2 3 ? anti-parallel
AA4 1 2 ? anti-parallel
#
loop_
_struct_sheet_range.sheet_id
_struct_sheet_range.id
_struct_sheet_range.beg_label_comp_id
_struct_sheet_range.beg_label_asym_id
_struct_sheet_range.beg_label_seq_id
_struct_sheet_range.pdbx_beg_PDB_ins_code
_struct_sheet_range.end_label_comp_id
_struct_sheet_range.end_label_asym_id
_struct_sheet_range.end_label_seq_id
_struct_sheet_range.pdbx_end_PDB_ins_code
_struct_sheet_range.beg_auth_comp_id
_struct_sheet_range.beg_auth_asym_id
_struct_sheet_range.beg_auth_seq_id
_struct_sheet_range.end_auth_comp_id
_struct_sheet_range.end_auth_asym_id
_struct_sheet_range.end_auth_seq_id
AA1 1 TYR A 38 ? LEU A 44 ? TYR A 38 LEU A 44
AA1 2 VAL A 52 ? ARG A 57 ? VAL A 52 ARG A 57
AA1 3 PRO A 63 ? GLU A 70 ? PRO A 63 GLU A 70
AA1 4 SER A 115 ? GLU A 121 ? SER A 115 GLU A 121
AA1 5 LEU A 106 ? GLU A 111 ? LEU A 106 GLU A 111
AA2 1 TRP A 77 ? GLU A 79 ? TRP A 77 GLU A 79
AA2 2 ARG A 85 ? PRO A 87 ? ARG A 85 PRO A 87
AA3 1 VAL A 126 ? ASP A 128 ? VAL A 126 ASP A 128
AA3 2 ILE A 173 ? ASP A 176 ? ILE A 173 ASP A 176
AA3 3 GLU A 181 ? LEU A 184 ? GLU A 181 LEU A 184
AA4 1 VAL A 163 ? LEU A 164 ? VAL A 163 LEU A 164
AA4 2 ALA A 191 ? LEU A 192 ? ALA A 191 LEU A 192
#
loop_
_pdbx_struct_sheet_hbond.sheet_id
_pdbx_struct_sheet_hbond.range_id_1
_pdbx_struct_sheet_hbond.range_id_2
_pdbx_struct_sheet_hbond.range_1_label_atom_id
_pdbx_struct_sheet_hbond.range_1_label_comp_id
_pdbx_struct_sheet_hbond.range_1_label_asym_id
_pdbx_struct_sheet_hbond.range_1_label_seq_id
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code
_pdbx_struct_sheet_hbond.range_1_auth_atom_id
_pdbx_struct_sheet_hbond.range_1_auth_comp_id
_pdbx_struct_sheet_hbond.range_1_auth_asym_id
_pdbx_struct_sheet_hbond.range_1_auth_seq_id
_pdbx_struct_sheet_hbond.range_2_label_atom_id
_pdbx_struct_sheet_hbond.range_2_label_comp_id
_pdbx_struct_sheet_hbond.range_2_label_asym_id
_pdbx_struct_sheet_hbond.range_2_label_seq_id
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code
_pdbx_struct_sheet_hbond.range_2_auth_atom_id
_pdbx_struct_sheet_hbond.range_2_auth_comp_id
_pdbx_struct_sheet_hbond.range_2_auth_asym_id
_pdbx_struct_sheet_hbond.range_2_auth_seq_id
AA1 1 2 N GLY A 41 ? N GLY A 41 O SER A 54 ? O SER A 54
AA1 2 3 N TYR A 53 ? N TYR A 53 O ILE A 66 ? O ILE A 66
AA1 3 4 N LYS A 67 ? N LYS A 67 O LEU A 118 ? O LEU A 118
AA1 4 5 O ILE A 119 ? O ILE A 119 N LEU A 107 ? N LEU A 107
AA2 1 2 N GLY A 78 ? N GLY A 78 O VAL A 86 ? O VAL A 86
AA3 1 2 N GLN A 127 ? N GLN A 127 O ILE A 175 ? O ILE A 175
AA3 2 3 N ASP A 176 ? N ASP A 176 O GLU A 181 ? O GLU A 181
AA4 1 2 N LEU A 164 ? N LEU A 164 O ALA A 191 ? O ALA A 191
#
_pdbx_entry_details.entry_id 7QFM
_pdbx_entry_details.has_ligand_of_interest Y
_pdbx_entry_details.compound_details ?
_pdbx_entry_details.source_details ?
_pdbx_entry_details.nonpolymer_details ?
_pdbx_entry_details.sequence_details ?
_pdbx_entry_details.has_protein_modification Y
#
loop_
_pdbx_validate_torsion.id
_pdbx_validate_torsion.PDB_model_num
_pdbx_validate_torsion.auth_comp_id
_pdbx_validate_torsion.auth_asym_id
_pdbx_validate_torsion.auth_seq_id
_pdbx_validate_torsion.PDB_ins_code
_pdbx_validate_torsion.label_alt_id
_pdbx_validate_torsion.phi
_pdbx_validate_torsion.psi
1 1 ASP A 60 ? ? -152.87 21.46
2 1 SER A 97 ? ? -77.40 29.12
3 1 ASP A 167 ? ? -147.14 42.82
4 1 ASP A 186 ? ? 57.14 79.43
#
_pdbx_struct_mod_residue.id 1
_pdbx_struct_mod_residue.label_asym_id A
_pdbx_struct_mod_residue.label_comp_id SEP
_pdbx_struct_mod_residue.label_seq_id 261
_pdbx_struct_mod_residue.auth_asym_id A
_pdbx_struct_mod_residue.auth_comp_id SEP
_pdbx_struct_mod_residue.auth_seq_id 261
_pdbx_struct_mod_residue.PDB_ins_code ?
_pdbx_struct_mod_residue.parent_comp_id SER
_pdbx_struct_mod_residue.details 'modified residue'
#
loop_
_space_group_symop.id
_space_group_symop.operation_xyz
1 x,y,z
2 x-y,x,z+5/6
3 y,-x+y,z+1/6
4 -y,x-y,z+2/3
5 -x+y,-x,z+1/3
6 -x,-y,z+1/2
#
loop_
_pdbx_refine_tls.id
_pdbx_refine_tls.pdbx_refine_id
_pdbx_refine_tls.details
_pdbx_refine_tls.method
_pdbx_refine_tls.origin_x
_pdbx_refine_tls.origin_y
_pdbx_refine_tls.origin_z
_pdbx_refine_tls.T[1][1]
_pdbx_refine_tls.T[1][1]_esd
_pdbx_refine_tls.T[1][2]
_pdbx_refine_tls.T[1][2]_esd
_pdbx_refine_tls.T[1][3]
_pdbx_refine_tls.T[1][3]_esd
_pdbx_refine_tls.T[2][2]
_pdbx_refine_tls.T[2][2]_esd
_pdbx_refine_tls.T[2][3]
_pdbx_refine_tls.T[2][3]_esd
_pdbx_refine_tls.T[3][3]
_pdbx_refine_tls.T[3][3]_esd
_pdbx_refine_tls.L[1][1]
_pdbx_refine_tls.L[1][1]_esd
_pdbx_refine_tls.L[1][2]
_pdbx_refine_tls.L[1][2]_esd
_pdbx_refine_tls.L[1][3]
_pdbx_refine_tls.L[1][3]_esd
_pdbx_refine_tls.L[2][2]
_pdbx_refine_tls.L[2][2]_esd
_pdbx_refine_tls.L[2][3]
_pdbx_refine_tls.L[2][3]_esd
_pdbx_refine_tls.L[3][3]
_pdbx_refine_tls.L[3][3]_esd
_pdbx_refine_tls.S[1][1]
_pdbx_refine_tls.S[1][1]_esd
_pdbx_refine_tls.S[1][2]
_pdbx_refine_tls.S[1][2]_esd
_pdbx_refine_tls.S[1][3]
_pdbx_refine_tls.S[1][3]_esd
_pdbx_refine_tls.S[2][1]
_pdbx_refine_tls.S[2][1]_esd
_pdbx_refine_tls.S[2][2]
_pdbx_refine_tls.S[2][2]_esd
_pdbx_refine_tls.S[2][3]
_pdbx_refine_tls.S[2][3]_esd
_pdbx_refine_tls.S[3][1]
_pdbx_refine_tls.S[3][1]_esd
_pdbx_refine_tls.S[3][2]
_pdbx_refine_tls.S[3][2]_esd
_pdbx_refine_tls.S[3][3]
_pdbx_refine_tls.S[3][3]_esd
1 'X-RAY DIFFRACTION' ? refined -111.907906765 201.102242541 -8.57846559787 0.380252986699 ? -0.107211201118 ? 0.0184651721646 ?
0.468447006176 ? -0.0298422175826 ? 0.477885022199 ? 0.865217238223 ? 0.0422226583294 ? 0.21093588017 ? 0.241390367441 ?
-0.0985244230492 ? 0.492829268112 ? -0.150617225873 ? 0.547168299505 ? -0.0500016634972 ? -0.0385869412946 ? 0.22274528165 ?
-0.306653817663 ? -0.169095694546 ? 0.404956225105 ? 0.00014400943184 ?
2 'X-RAY DIFFRACTION' ? refined -121.039892326 203.173365297 -3.3136298864 0.354425024653 ? -0.0657630490927 ? 0.00682052408436 ?
0.314558976863 ? -0.0145918933138 ? 0.344287018066 ? 0.8222882518 ? 0.197762286833 ? 0.655157172869 ? 0.284197404932 ?
-0.123976412371 ? 0.856543495992 ? 0.130413046262 ? -0.0129383716616 ? 0.36917673483 ? 0.182814302586 ? 0.0285232788645 ?
-0.114119543413 ? -0.402938466913 ? 0.272531193432 ? 0.0070451693807 ?
3 'X-RAY DIFFRACTION' ? refined -134.161464307 191.146477324 0.750284015915 0.241023465946 ? -0.0341414522863 ? -0.0244050493414 ?
0.160461962501 ? -0.00718902353114 ? 0.198967813345 ? 1.68741758815 ? 0.161437291373 ? -0.453600457417 ? 0.799630202425 ?
0.189114997052 ? 2.40321695575 ? -0.0129520338311 ? -0.0437729931992 ? -0.0207477823868 ? 0.0668295070997 ? 0.0540551606524 ?
-0.026641964566 ? 0.111307453036 ? -0.0752957725109 ? 0.000126059300387 ?
4 'X-RAY DIFFRACTION' ? refined -123.65150589 192.792189574 12.8723187049 0.429120657107 ? -0.0386425060188 ? -0.102234897627 ?
0.577954072229 ? -0.0334697568262 ? 0.379593173987 ? 0.250280592357 ? -0.227199914557 ? -0.366357878094 ? 1.61837108507 ?
-0.246751094584 ? 0.773986223364 ? 0.0343281944168 ? -0.342460547965 ? -0.311539561008 ? 0.854901447402 ? 0.301526643703 ?
0.00878811897854 ? 0.513880744297 ? 0.323475703062 ? 0.0149536624517 ?
#
loop_
_pdbx_refine_tls_group.id
_pdbx_refine_tls_group.pdbx_refine_id
_pdbx_refine_tls_group.refine_tls_id
_pdbx_refine_tls_group.beg_label_asym_id
_pdbx_refine_tls_group.beg_label_seq_id
_pdbx_refine_tls_group.beg_auth_asym_id
_pdbx_refine_tls_group.beg_auth_seq_id
_pdbx_refine_tls_group.beg_PDB_ins_code
_pdbx_refine_tls_group.end_label_asym_id
_pdbx_refine_tls_group.end_label_seq_id
_pdbx_refine_tls_group.end_auth_asym_id
_pdbx_refine_tls_group.end_auth_seq_id
_pdbx_refine_tls_group.end_PDB_ins_code
_pdbx_refine_tls_group.selection
_pdbx_refine_tls_group.selection_details
1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ?
;chain 'A' and (resid 33 through 96 )
;
2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ?
;chain 'A' and (resid 97 through 140 )
;
3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ?
;chain 'A' and (resid 141 through 305 )
;
4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ?
;chain 'D' and (resid 2 through 9 )
;
#
loop_
_pdbx_unobs_or_zero_occ_residues.id
_pdbx_unobs_or_zero_occ_residues.PDB_model_num
_pdbx_unobs_or_zero_occ_residues.polymer_flag
_pdbx_unobs_or_zero_occ_residues.occupancy_flag
_pdbx_unobs_or_zero_occ_residues.auth_asym_id
_pdbx_unobs_or_zero_occ_residues.auth_comp_id
_pdbx_unobs_or_zero_occ_residues.auth_seq_id
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code
_pdbx_unobs_or_zero_occ_residues.label_asym_id
_pdbx_unobs_or_zero_occ_residues.label_comp_id
_pdbx_unobs_or_zero_occ_residues.label_seq_id
1 1 Y 1 A MET 1 ? A MET 1
2 1 Y 1 A LEU 2 ? A LEU 2
3 1 Y 1 A LEU 3 ? A LEU 3
4 1 Y 1 A SER 4 ? A SER 4
5 1 Y 1 A LYS 5 ? A LYS 5
6 1 Y 1 A ILE 6 ? A ILE 6
7 1 Y 1 A ASN 7 ? A ASN 7
8 1 Y 1 A SER 8 ? A SER 8
9 1 Y 1 A LEU 9 ? A LEU 9
10 1 Y 1 A ALA 10 ? A ALA 10
11 1 Y 1 A HIS 11 ? A HIS 11
12 1 Y 1 A LEU 12 ? A LEU 12
13 1 Y 1 A ARG 13 ? A ARG 13
14 1 Y 1 A ALA 14 ? A ALA 14
15 1 Y 1 A ALA 15 ? A ALA 15
16 1 Y 1 A PRO 16 ? A PRO 16
17 1 Y 1 A CYS 17 ? A CYS 17
18 1 Y 1 A ASN 18 ? A ASN 18
19 1 Y 1 A ASP 19 ? A ASP 19
20 1 Y 1 A LEU 20 ? A LEU 20
21 1 Y 1 A HIS 21 ? A HIS 21
22 1 Y 1 A ALA 22 ? A ALA 22
23 1 Y 1 A THR 23 ? A THR 23
24 1 Y 1 A LYS 24 ? A LYS 24
25 1 Y 1 A LEU 25 ? A LEU 25
26 1 Y 1 A ALA 26 ? A ALA 26
27 1 Y 1 A PRO 27 ? A PRO 27
28 1 Y 1 A GLY 28 ? A GLY 28
29 1 Y 1 A LYS 29 ? A LYS 29
30 1 Y 1 A GLU 30 ? A GLU 30
31 1 Y 1 A LYS 31 ? A LYS 31
32 1 Y 1 A GLU 32 ? A GLU 32
33 1 Y 1 A GLY 47 ? A GLY 47
34 1 Y 1 A GLY 48 ? A GLY 48
35 1 Y 1 A SER 306 ? A SER 306
36 1 Y 1 A LEU 307 ? A LEU 307
37 1 Y 1 A SER 308 ? A SER 308
38 1 Y 1 A PRO 309 ? A PRO 309
39 1 Y 1 A GLY 310 ? A GLY 310
40 1 Y 1 A PRO 311 ? A PRO 311
41 1 Y 1 A SER 312 ? A SER 312
42 1 Y 1 D ALA 1 ? B ALA 1
43 1 Y 1 D GLY 10 ? B GLY 10
44 1 Y 1 D PRO 11 ? B PRO 11
45 1 Y 1 D PRO 12 ? B PRO 12
46 1 Y 1 D THR 13 ? B THR 13
47 1 Y 1 D ALA 14 ? B ALA 14
48 1 N 0 A GOL 401 ? C GOL ?
#
loop_
_chem_comp_atom.comp_id
_chem_comp_atom.atom_id
_chem_comp_atom.type_symbol
_chem_comp_atom.pdbx_aromatic_flag
_chem_comp_atom.pdbx_stereo_config
_chem_comp_atom.pdbx_ordinal
ALA N N N N 1
ALA CA C N S 2
ALA C C N N 3
ALA O O N N 4
ALA CB C N N 5
ALA OXT O N N 6
ALA H H N N 7
ALA H2 H N N 8
ALA HA H N N 9
ALA HB1 H N N 10
ALA HB2 H N N 11
ALA HB3 H N N 12
ALA HXT H N N 13
ARG N N N N 14
ARG CA C N S 15
ARG C C N N 16
ARG O O N N 17
ARG CB C N N 18
ARG CG C N N 19
ARG CD C N N 20
ARG NE N N N 21
ARG CZ C N N 22
ARG NH1 N N N 23
ARG NH2 N N N 24
ARG OXT O N N 25
ARG H H N N 26
ARG H2 H N N 27
ARG HA H N N 28
ARG HB2 H N N 29
ARG HB3 H N N 30
ARG HG2 H N N 31
ARG HG3 H N N 32
ARG HD2 H N N 33
ARG HD3 H N N 34
ARG HE H N N 35
ARG HH11 H N N 36
ARG HH12 H N N 37
ARG HH21 H N N 38
ARG HH22 H N N 39
ARG HXT H N N 40
ASN N N N N 41
ASN CA C N S 42
ASN C C N N 43
ASN O O N N 44
ASN CB C N N 45
ASN CG C N N 46
ASN OD1 O N N 47
ASN ND2 N N N 48
ASN OXT O N N 49
ASN H H N N 50
ASN H2 H N N 51
ASN HA H N N 52
ASN HB2 H N N 53
ASN HB3 H N N 54
ASN HD21 H N N 55
ASN HD22 H N N 56
ASN HXT H N N 57
ASP N N N N 58
ASP CA C N S 59
ASP C C N N 60
ASP O O N N 61
ASP CB C N N 62
ASP CG C N N 63
ASP OD1 O N N 64
ASP OD2 O N N 65
ASP OXT O N N 66
ASP H H N N 67
ASP H2 H N N 68
ASP HA H N N 69
ASP HB2 H N N 70
ASP HB3 H N N 71
ASP HD2 H N N 72
ASP HXT H N N 73
AY3 C15 C Y N 74
AY3 C14 C Y N 75
AY3 C13 C N N 76
AY3 C12 C Y N 77
AY3 C11 C Y N 78
AY3 C10 C Y N 79
AY3 O2 O N N 80
AY3 C9 C Y N 81
AY3 O1 O N N 82
AY3 C8 C N N 83
AY3 C1 C N N 84
AY3 O O N N 85
AY3 C C N N 86
AY3 C7 C Y N 87
AY3 C2 C Y N 88
AY3 N N N N 89
AY3 C6 C Y N 90
AY3 C5 C Y N 91
AY3 C4 C Y N 92
AY3 C3 C Y N 93
AY3 H1 H N N 94
AY3 H2 H N N 95
AY3 H3 H N N 96
AY3 H4 H N N 97
AY3 H5 H N N 98
AY3 H6 H N N 99
AY3 H7 H N N 100
AY3 H8 H N N 101
AY3 H9 H N N 102
AY3 H10 H N N 103
AY3 H11 H N N 104
CYS N N N N 105
CYS CA C N R 106
CYS C C N N 107
CYS O O N N 108
CYS CB C N N 109
CYS SG S N N 110
CYS OXT O N N 111
CYS H H N N 112
CYS H2 H N N 113
CYS HA H N N 114
CYS HB2 H N N 115
CYS HB3 H N N 116
CYS HG H N N 117
CYS HXT H N N 118
GLN N N N N 119
GLN CA C N S 120
GLN C C N N 121
GLN O O N N 122
GLN CB C N N 123
GLN CG C N N 124
GLN CD C N N 125
GLN OE1 O N N 126
GLN NE2 N N N 127
GLN OXT O N N 128
GLN H H N N 129
GLN H2 H N N 130
GLN HA H N N 131
GLN HB2 H N N 132
GLN HB3 H N N 133
GLN HG2 H N N 134
GLN HG3 H N N 135
GLN HE21 H N N 136
GLN HE22 H N N 137
GLN HXT H N N 138
GLU N N N N 139
GLU CA C N S 140
GLU C C N N 141
GLU O O N N 142
GLU CB C N N 143
GLU CG C N N 144
GLU CD C N N 145
GLU OE1 O N N 146
GLU OE2 O N N 147
GLU OXT O N N 148
GLU H H N N 149
GLU H2 H N N 150
GLU HA H N N 151
GLU HB2 H N N 152
GLU HB3 H N N 153
GLU HG2 H N N 154
GLU HG3 H N N 155
GLU HE2 H N N 156
GLU HXT H N N 157
GLY N N N N 158
GLY CA C N N 159
GLY C C N N 160
GLY O O N N 161
GLY OXT O N N 162
GLY H H N N 163
GLY H2 H N N 164
GLY HA2 H N N 165
GLY HA3 H N N 166
GLY HXT H N N 167
GOL C1 C N N 168
GOL O1 O N N 169
GOL C2 C N N 170
GOL O2 O N N 171
GOL C3 C N N 172
GOL O3 O N N 173
GOL H11 H N N 174
GOL H12 H N N 175
GOL HO1 H N N 176
GOL H2 H N N 177
GOL HO2 H N N 178
GOL H31 H N N 179
GOL H32 H N N 180
GOL HO3 H N N 181
HIS N N N N 182
HIS CA C N S 183
HIS C C N N 184
HIS O O N N 185
HIS CB C N N 186
HIS CG C Y N 187
HIS ND1 N Y N 188
HIS CD2 C Y N 189
HIS CE1 C Y N 190
HIS NE2 N Y N 191
HIS OXT O N N 192
HIS H H N N 193
HIS H2 H N N 194
HIS HA H N N 195
HIS HB2 H N N 196
HIS HB3 H N N 197
HIS HD1 H N N 198
HIS HD2 H N N 199
HIS HE1 H N N 200
HIS HE2 H N N 201
HIS HXT H N N 202
HOH O O N N 203
HOH H1 H N N 204
HOH H2 H N N 205
ILE N N N N 206
ILE CA C N S 207
ILE C C N N 208
ILE O O N N 209
ILE CB C N S 210
ILE CG1 C N N 211
ILE CG2 C N N 212
ILE CD1 C N N 213
ILE OXT O N N 214
ILE H H N N 215
ILE H2 H N N 216
ILE HA H N N 217
ILE HB H N N 218
ILE HG12 H N N 219
ILE HG13 H N N 220
ILE HG21 H N N 221
ILE HG22 H N N 222
ILE HG23 H N N 223
ILE HD11 H N N 224
ILE HD12 H N N 225
ILE HD13 H N N 226
ILE HXT H N N 227
LEU N N N N 228
LEU CA C N S 229
LEU C C N N 230
LEU O O N N 231
LEU CB C N N 232
LEU CG C N N 233
LEU CD1 C N N 234
LEU CD2 C N N 235
LEU OXT O N N 236
LEU H H N N 237
LEU H2 H N N 238
LEU HA H N N 239
LEU HB2 H N N 240
LEU HB3 H N N 241
LEU HG H N N 242
LEU HD11 H N N 243
LEU HD12 H N N 244
LEU HD13 H N N 245
LEU HD21 H N N 246
LEU HD22 H N N 247
LEU HD23 H N N 248
LEU HXT H N N 249
LYS N N N N 250
LYS CA C N S 251
LYS C C N N 252
LYS O O N N 253
LYS CB C N N 254
LYS CG C N N 255
LYS CD C N N 256
LYS CE C N N 257
LYS NZ N N N 258
LYS OXT O N N 259
LYS H H N N 260
LYS H2 H N N 261
LYS HA H N N 262
LYS HB2 H N N 263
LYS HB3 H N N 264
LYS HG2 H N N 265
LYS HG3 H N N 266
LYS HD2 H N N 267
LYS HD3 H N N 268
LYS HE2 H N N 269
LYS HE3 H N N 270
LYS HZ1 H N N 271
LYS HZ2 H N N 272
LYS HZ3 H N N 273
LYS HXT H N N 274
MET N N N N 275
MET CA C N S 276
MET C C N N 277
MET O O N N 278
MET CB C N N 279
MET CG C N N 280
MET SD S N N 281
MET CE C N N 282
MET OXT O N N 283
MET H H N N 284
MET H2 H N N 285
MET HA H N N 286
MET HB2 H N N 287
MET HB3 H N N 288
MET HG2 H N N 289
MET HG3 H N N 290
MET HE1 H N N 291
MET HE2 H N N 292
MET HE3 H N N 293
MET HXT H N N 294
PHE N N N N 295
PHE CA C N S 296
PHE C C N N 297
PHE O O N N 298
PHE CB C N N 299
PHE CG C Y N 300
PHE CD1 C Y N 301
PHE CD2 C Y N 302
PHE CE1 C Y N 303
PHE CE2 C Y N 304
PHE CZ C Y N 305
PHE OXT O N N 306
PHE H H N N 307
PHE H2 H N N 308
PHE HA H N N 309
PHE HB2 H N N 310
PHE HB3 H N N 311
PHE HD1 H N N 312
PHE HD2 H N N 313
PHE HE1 H N N 314
PHE HE2 H N N 315
PHE HZ H N N 316
PHE HXT H N N 317
PRO N N N N 318
PRO CA C N S 319
PRO C C N N 320
PRO O O N N 321
PRO CB C N N 322
PRO CG C N N 323
PRO CD C N N 324
PRO OXT O N N 325
PRO H H N N 326
PRO HA H N N 327
PRO HB2 H N N 328
PRO HB3 H N N 329
PRO HG2 H N N 330
PRO HG3 H N N 331
PRO HD2 H N N 332
PRO HD3 H N N 333
PRO HXT H N N 334
SEP N N N N 335
SEP CA C N S 336
SEP CB C N N 337
SEP OG O N N 338
SEP C C N N 339
SEP O O N N 340
SEP OXT O N N 341
SEP P P N N 342
SEP O1P O N N 343
SEP O2P O N N 344
SEP O3P O N N 345
SEP H H N N 346
SEP H2 H N N 347
SEP HA H N N 348
SEP HB2 H N N 349
SEP HB3 H N N 350
SEP HXT H N N 351
SEP HOP2 H N N 352
SEP HOP3 H N N 353
SER N N N N 354
SER CA C N S 355
SER C C N N 356
SER O O N N 357
SER CB C N N 358
SER OG O N N 359
SER OXT O N N 360
SER H H N N 361
SER H2 H N N 362
SER HA H N N 363
SER HB2 H N N 364
SER HB3 H N N 365
SER HG H N N 366
SER HXT H N N 367
THR N N N N 368
THR CA C N S 369
THR C C N N 370
THR O O N N 371
THR CB C N R 372
THR OG1 O N N 373
THR CG2 C N N 374
THR OXT O N N 375
THR H H N N 376
THR H2 H N N 377
THR HA H N N 378
THR HB H N N 379
THR HG1 H N N 380
THR HG21 H N N 381
THR HG22 H N N 382
THR HG23 H N N 383
THR HXT H N N 384
TRP N N N N 385
TRP CA C N S 386
TRP C C N N 387
TRP O O N N 388
TRP CB C N N 389
TRP CG C Y N 390
TRP CD1 C Y N 391
TRP CD2 C Y N 392
TRP NE1 N Y N 393
TRP CE2 C Y N 394
TRP CE3 C Y N 395
TRP CZ2 C Y N 396
TRP CZ3 C Y N 397
TRP CH2 C Y N 398
TRP OXT O N N 399
TRP H H N N 400
TRP H2 H N N 401
TRP HA H N N 402
TRP HB2 H N N 403
TRP HB3 H N N 404
TRP HD1 H N N 405
TRP HE1 H N N 406
TRP HE3 H N N 407
TRP HZ2 H N N 408
TRP HZ3 H N N 409
TRP HH2 H N N 410
TRP HXT H N N 411
TYR N N N N 412
TYR CA C N S 413
TYR C C N N 414
TYR O O N N 415
TYR CB C N N 416
TYR CG C Y N 417
TYR CD1 C Y N 418
TYR CD2 C Y N 419
TYR CE1 C Y N 420
TYR CE2 C Y N 421
TYR CZ C Y N 422
TYR OH O N N 423
TYR OXT O N N 424
TYR H H N N 425
TYR H2 H N N 426
TYR HA H N N 427
TYR HB2 H N N 428
TYR HB3 H N N 429
TYR HD1 H N N 430
TYR HD2 H N N 431
TYR HE1 H N N 432
TYR HE2 H N N 433
TYR HH H N N 434
TYR HXT H N N 435
VAL N N N N 436
VAL CA C N S 437
VAL C C N N 438
VAL O O N N 439
VAL CB C N N 440
VAL CG1 C N N 441
VAL CG2 C N N 442
VAL OXT O N N 443
VAL H H N N 444
VAL H2 H N N 445
VAL HA H N N 446
VAL HB H N N 447
VAL HG11 H N N 448
VAL HG12 H N N 449
VAL HG13 H N N 450
VAL HG21 H N N 451
VAL HG22 H N N 452
VAL HG23 H N N 453
VAL HXT H N N 454
#
loop_
_chem_comp_bond.comp_id
_chem_comp_bond.atom_id_1
_chem_comp_bond.atom_id_2
_chem_comp_bond.value_order
_chem_comp_bond.pdbx_aromatic_flag
_chem_comp_bond.pdbx_stereo_config
_chem_comp_bond.pdbx_ordinal
ALA N CA sing N N 1
ALA N H sing N N 2
ALA N H2 sing N N 3
ALA CA C sing N N 4
ALA CA CB sing N N 5
ALA CA HA sing N N 6
ALA C O doub N N 7
ALA C OXT sing N N 8
ALA CB HB1 sing N N 9
ALA CB HB2 sing N N 10
ALA CB HB3 sing N N 11
ALA OXT HXT sing N N 12
ARG N CA sing N N 13
ARG N H sing N N 14
ARG N H2 sing N N 15
ARG CA C sing N N 16
ARG CA CB sing N N 17
ARG CA HA sing N N 18
ARG C O doub N N 19
ARG C OXT sing N N 20
ARG CB CG sing N N 21
ARG CB HB2 sing N N 22
ARG CB HB3 sing N N 23
ARG CG CD sing N N 24
ARG CG HG2 sing N N 25
ARG CG HG3 sing N N 26
ARG CD NE sing N N 27
ARG CD HD2 sing N N 28
ARG CD HD3 sing N N 29
ARG NE CZ sing N N 30
ARG NE HE sing N N 31
ARG CZ NH1 sing N N 32
ARG CZ NH2 doub N N 33
ARG NH1 HH11 sing N N 34
ARG NH1 HH12 sing N N 35
ARG NH2 HH21 sing N N 36
ARG NH2 HH22 sing N N 37
ARG OXT HXT sing N N 38
ASN N CA sing N N 39
ASN N H sing N N 40
ASN N H2 sing N N 41
ASN CA C sing N N 42
ASN CA CB sing N N 43
ASN CA HA sing N N 44
ASN C O doub N N 45
ASN C OXT sing N N 46
ASN CB CG sing N N 47
ASN CB HB2 sing N N 48
ASN CB HB3 sing N N 49
ASN CG OD1 doub N N 50
ASN CG ND2 sing N N 51
ASN ND2 HD21 sing N N 52
ASN ND2 HD22 sing N N 53
ASN OXT HXT sing N N 54
ASP N CA sing N N 55
ASP N H sing N N 56
ASP N H2 sing N N 57
ASP CA C sing N N 58
ASP CA CB sing N N 59
ASP CA HA sing N N 60
ASP C O doub N N 61
ASP C OXT sing N N 62
ASP CB CG sing N N 63
ASP CB HB2 sing N N 64
ASP CB HB3 sing N N 65
ASP CG OD1 doub N N 66
ASP CG OD2 sing N N 67
ASP OD2 HD2 sing N N 68
ASP OXT HXT sing N N 69
AY3 O2 C13 doub N N 70
AY3 C13 C12 sing N N 71
AY3 C13 O1 sing N N 72
AY3 C14 C15 doub Y N 73
AY3 C14 C12 sing Y N 74
AY3 C15 C9 sing Y N 75
AY3 C12 C11 doub Y N 76
AY3 C9 C8 sing N N 77
AY3 C9 C10 doub Y N 78
AY3 C11 C10 sing Y N 79
AY3 C8 C1 doub N E 80
AY3 O C doub N N 81
AY3 C1 C sing N N 82
AY3 C1 C2 sing N N 83
AY3 C N sing N N 84
AY3 C2 C7 doub Y N 85
AY3 C2 C3 sing Y N 86
AY3 C7 C6 sing Y N 87
AY3 N C3 sing N N 88
AY3 C3 C4 doub Y N 89
AY3 C6 C5 doub Y N 90
AY3 C4 C5 sing Y N 91
AY3 C15 H1 sing N N 92
AY3 C14 H2 sing N N 93
AY3 C11 H3 sing N N 94
AY3 C10 H4 sing N N 95
AY3 O1 H5 sing N N 96
AY3 C8 H6 sing N N 97
AY3 C7 H7 sing N N 98
AY3 N H8 sing N N 99
AY3 C6 H9 sing N N 100
AY3 C5 H10 sing N N 101
AY3 C4 H11 sing N N 102
CYS N CA sing N N 103
CYS N H sing N N 104
CYS N H2 sing N N 105
CYS CA C sing N N 106
CYS CA CB sing N N 107
CYS CA HA sing N N 108
CYS C O doub N N 109
CYS C OXT sing N N 110
CYS CB SG sing N N 111
CYS CB HB2 sing N N 112
CYS CB HB3 sing N N 113
CYS SG HG sing N N 114
CYS OXT HXT sing N N 115
GLN N CA sing N N 116
GLN N H sing N N 117
GLN N H2 sing N N 118
GLN CA C sing N N 119
GLN CA CB sing N N 120
GLN CA HA sing N N 121
GLN C O doub N N 122
GLN C OXT sing N N 123
GLN CB CG sing N N 124
GLN CB HB2 sing N N 125
GLN CB HB3 sing N N 126
GLN CG CD sing N N 127
GLN CG HG2 sing N N 128
GLN CG HG3 sing N N 129
GLN CD OE1 doub N N 130
GLN CD NE2 sing N N 131
GLN NE2 HE21 sing N N 132
GLN NE2 HE22 sing N N 133
GLN OXT HXT sing N N 134
GLU N CA sing N N 135
GLU N H sing N N 136
GLU N H2 sing N N 137
GLU CA C sing N N 138
GLU CA CB sing N N 139
GLU CA HA sing N N 140
GLU C O doub N N 141
GLU C OXT sing N N 142
GLU CB CG sing N N 143
GLU CB HB2 sing N N 144
GLU CB HB3 sing N N 145
GLU CG CD sing N N 146
GLU CG HG2 sing N N 147
GLU CG HG3 sing N N 148
GLU CD OE1 doub N N 149
GLU CD OE2 sing N N 150
GLU OE2 HE2 sing N N 151
GLU OXT HXT sing N N 152
GLY N CA sing N N 153
GLY N H sing N N 154
GLY N H2 sing N N 155
GLY CA C sing N N 156
GLY CA HA2 sing N N 157
GLY CA HA3 sing N N 158
GLY C O doub N N 159
GLY C OXT sing N N 160
GLY OXT HXT sing N N 161
GOL C1 O1 sing N N 162
GOL C1 C2 sing N N 163
GOL C1 H11 sing N N 164
GOL C1 H12 sing N N 165
GOL O1 HO1 sing N N 166
GOL C2 O2 sing N N 167
GOL C2 C3 sing N N 168
GOL C2 H2 sing N N 169
GOL O2 HO2 sing N N 170
GOL C3 O3 sing N N 171
GOL C3 H31 sing N N 172
GOL C3 H32 sing N N 173
GOL O3 HO3 sing N N 174
HIS N CA sing N N 175
HIS N H sing N N 176
HIS N H2 sing N N 177
HIS CA C sing N N 178
HIS CA CB sing N N 179
HIS CA HA sing N N 180
HIS C O doub N N 181
HIS C OXT sing N N 182
HIS CB CG sing N N 183
HIS CB HB2 sing N N 184
HIS CB HB3 sing N N 185
HIS CG ND1 sing Y N 186
HIS CG CD2 doub Y N 187
HIS ND1 CE1 doub Y N 188
HIS ND1 HD1 sing N N 189
HIS CD2 NE2 sing Y N 190
HIS CD2 HD2 sing N N 191
HIS CE1 NE2 sing Y N 192
HIS CE1 HE1 sing N N 193
HIS NE2 HE2 sing N N 194
HIS OXT HXT sing N N 195
HOH O H1 sing N N 196
HOH O H2 sing N N 197
ILE N CA sing N N 198
ILE N H sing N N 199
ILE N H2 sing N N 200
ILE CA C sing N N 201
ILE CA CB sing N N 202
ILE CA HA sing N N 203
ILE C O doub N N 204
ILE C OXT sing N N 205
ILE CB CG1 sing N N 206
ILE CB CG2 sing N N 207
ILE CB HB sing N N 208
ILE CG1 CD1 sing N N 209
ILE CG1 HG12 sing N N 210
ILE CG1 HG13 sing N N 211
ILE CG2 HG21 sing N N 212
ILE CG2 HG22 sing N N 213
ILE CG2 HG23 sing N N 214
ILE CD1 HD11 sing N N 215
ILE CD1 HD12 sing N N 216
ILE CD1 HD13 sing N N 217
ILE OXT HXT sing N N 218
LEU N CA sing N N 219
LEU N H sing N N 220
LEU N H2 sing N N 221
LEU CA C sing N N 222
LEU CA CB sing N N 223
LEU CA HA sing N N 224
LEU C O doub N N 225
LEU C OXT sing N N 226
LEU CB CG sing N N 227
LEU CB HB2 sing N N 228
LEU CB HB3 sing N N 229
LEU CG CD1 sing N N 230
LEU CG CD2 sing N N 231
LEU CG HG sing N N 232
LEU CD1 HD11 sing N N 233
LEU CD1 HD12 sing N N 234
LEU CD1 HD13 sing N N 235
LEU CD2 HD21 sing N N 236
LEU CD2 HD22 sing N N 237
LEU CD2 HD23 sing N N 238
LEU OXT HXT sing N N 239
LYS N CA sing N N 240
LYS N H sing N N 241
LYS N H2 sing N N 242
LYS CA C sing N N 243
LYS CA CB sing N N 244
LYS CA HA sing N N 245
LYS C O doub N N 246
LYS C OXT sing N N 247
LYS CB CG sing N N 248
LYS CB HB2 sing N N 249
LYS CB HB3 sing N N 250
LYS CG CD sing N N 251
LYS CG HG2 sing N N 252
LYS CG HG3 sing N N 253
LYS CD CE sing N N 254
LYS CD HD2 sing N N 255
LYS CD HD3 sing N N 256
LYS CE NZ sing N N 257
LYS CE HE2 sing N N 258
LYS CE HE3 sing N N 259
LYS NZ HZ1 sing N N 260
LYS NZ HZ2 sing N N 261
LYS NZ HZ3 sing N N 262
LYS OXT HXT sing N N 263
MET N CA sing N N 264
MET N H sing N N 265
MET N H2 sing N N 266
MET CA C sing N N 267
MET CA CB sing N N 268
MET CA HA sing N N 269
MET C O doub N N 270
MET C OXT sing N N 271
MET CB CG sing N N 272
MET CB HB2 sing N N 273
MET CB HB3 sing N N 274
MET CG SD sing N N 275
MET CG HG2 sing N N 276
MET CG HG3 sing N N 277
MET SD CE sing N N 278
MET CE HE1 sing N N 279
MET CE HE2 sing N N 280
MET CE HE3 sing N N 281
MET OXT HXT sing N N 282
PHE N CA sing N N 283
PHE N H sing N N 284
PHE N H2 sing N N 285
PHE CA C sing N N 286
PHE CA CB sing N N 287
PHE CA HA sing N N 288
PHE C O doub N N 289
PHE C OXT sing N N 290
PHE CB CG sing N N 291
PHE CB HB2 sing N N 292
PHE CB HB3 sing N N 293
PHE CG CD1 doub Y N 294
PHE CG CD2 sing Y N 295
PHE CD1 CE1 sing Y N 296
PHE CD1 HD1 sing N N 297
PHE CD2 CE2 doub Y N 298
PHE CD2 HD2 sing N N 299
PHE CE1 CZ doub Y N 300
PHE CE1 HE1 sing N N 301
PHE CE2 CZ sing Y N 302
PHE CE2 HE2 sing N N 303
PHE CZ HZ sing N N 304
PHE OXT HXT sing N N 305
PRO N CA sing N N 306
PRO N CD sing N N 307
PRO N H sing N N 308
PRO CA C sing N N 309
PRO CA CB sing N N 310
PRO CA HA sing N N 311
PRO C O doub N N 312
PRO C OXT sing N N 313
PRO CB CG sing N N 314
PRO CB HB2 sing N N 315
PRO CB HB3 sing N N 316
PRO CG CD sing N N 317
PRO CG HG2 sing N N 318
PRO CG HG3 sing N N 319
PRO CD HD2 sing N N 320
PRO CD HD3 sing N N 321
PRO OXT HXT sing N N 322
SEP N CA sing N N 323
SEP N H sing N N 324
SEP N H2 sing N N 325
SEP CA CB sing N N 326
SEP CA C sing N N 327
SEP CA HA sing N N 328
SEP CB OG sing N N 329
SEP CB HB2 sing N N 330
SEP CB HB3 sing N N 331
SEP OG P sing N N 332
SEP C O doub N N 333
SEP C OXT sing N N 334
SEP OXT HXT sing N N 335
SEP P O1P doub N N 336
SEP P O2P sing N N 337
SEP P O3P sing N N 338
SEP O2P HOP2 sing N N 339
SEP O3P HOP3 sing N N 340
SER N CA sing N N 341
SER N H sing N N 342
SER N H2 sing N N 343
SER CA C sing N N 344
SER CA CB sing N N 345
SER CA HA sing N N 346
SER C O doub N N 347
SER C OXT sing N N 348
SER CB OG sing N N 349
SER CB HB2 sing N N 350
SER CB HB3 sing N N 351
SER OG HG sing N N 352
SER OXT HXT sing N N 353
THR N CA sing N N 354
THR N H sing N N 355
THR N H2 sing N N 356
THR CA C sing N N 357
THR CA CB sing N N 358
THR CA HA sing N N 359
THR C O doub N N 360
THR C OXT sing N N 361
THR CB OG1 sing N N 362
THR CB CG2 sing N N 363
THR CB HB sing N N 364
THR OG1 HG1 sing N N 365
THR CG2 HG21 sing N N 366
THR CG2 HG22 sing N N 367
THR CG2 HG23 sing N N 368
THR OXT HXT sing N N 369
TRP N CA sing N N 370
TRP N H sing N N 371
TRP N H2 sing N N 372
TRP CA C sing N N 373
TRP CA CB sing N N 374
TRP CA HA sing N N 375
TRP C O doub N N 376
TRP C OXT sing N N 377
TRP CB CG sing N N 378
TRP CB HB2 sing N N 379
TRP CB HB3 sing N N 380
TRP CG CD1 doub Y N 381
TRP CG CD2 sing Y N 382
TRP CD1 NE1 sing Y N 383
TRP CD1 HD1 sing N N 384
TRP CD2 CE2 doub Y N 385
TRP CD2 CE3 sing Y N 386
TRP NE1 CE2 sing Y N 387
TRP NE1 HE1 sing N N 388
TRP CE2 CZ2 sing Y N 389
TRP CE3 CZ3 doub Y N 390
TRP CE3 HE3 sing N N 391
TRP CZ2 CH2 doub Y N 392
TRP CZ2 HZ2 sing N N 393
TRP CZ3 CH2 sing Y N 394
TRP CZ3 HZ3 sing N N 395
TRP CH2 HH2 sing N N 396
TRP OXT HXT sing N N 397
TYR N CA sing N N 398
TYR N H sing N N 399
TYR N H2 sing N N 400
TYR CA C sing N N 401
TYR CA CB sing N N 402
TYR CA HA sing N N 403
TYR C O doub N N 404
TYR C OXT sing N N 405
TYR CB CG sing N N 406
TYR CB HB2 sing N N 407
TYR CB HB3 sing N N 408
TYR CG CD1 doub Y N 409
TYR CG CD2 sing Y N 410
TYR CD1 CE1 sing Y N 411
TYR CD1 HD1 sing N N 412
TYR CD2 CE2 doub Y N 413
TYR CD2 HD2 sing N N 414
TYR CE1 CZ doub Y N 415
TYR CE1 HE1 sing N N 416
TYR CE2 CZ sing Y N 417
TYR CE2 HE2 sing N N 418
TYR CZ OH sing N N 419
TYR OH HH sing N N 420
TYR OXT HXT sing N N 421
VAL N CA sing N N 422
VAL N H sing N N 423
VAL N H2 sing N N 424
VAL CA C sing N N 425
VAL CA CB sing N N 426
VAL CA HA sing N N 427
VAL C O doub N N 428
VAL C OXT sing N N 429
VAL CB CG1 sing N N 430
VAL CB CG2 sing N N 431
VAL CB HB sing N N 432
VAL CG1 HG11 sing N N 433
VAL CG1 HG12 sing N N 434
VAL CG1 HG13 sing N N 435
VAL CG2 HG21 sing N N 436
VAL CG2 HG22 sing N N 437
VAL CG2 HG23 sing N N 438
VAL OXT HXT sing N N 439
#
_pdbx_audit_support.funding_organization 'Not funded'
_pdbx_audit_support.country Germany
_pdbx_audit_support.grant_number ?
_pdbx_audit_support.ordinal 1
#
_pdbx_initial_refinement_model.id 1
_pdbx_initial_refinement_model.entity_id_list ?
_pdbx_initial_refinement_model.type 'experimental model'
_pdbx_initial_refinement_model.source_name PDB
_pdbx_initial_refinement_model.accession_code 5NDT
_pdbx_initial_refinement_model.details ?
#
_space_group.name_H-M_alt 'P 65'
_space_group.name_Hall 'P 65'
_space_group.IT_number 170
_space_group.crystal_system hexagonal
_space_group.id 1
#
_atom_sites.entry_id 7QFM
_atom_sites.Cartn_transf_matrix[1][1] ?
_atom_sites.Cartn_transf_matrix[1][2] ?
_atom_sites.Cartn_transf_matrix[1][3] ?
_atom_sites.Cartn_transf_matrix[2][1] ?
_atom_sites.Cartn_transf_matrix[2][2] ?
_atom_sites.Cartn_transf_matrix[2][3] ?
_atom_sites.Cartn_transf_matrix[3][1] ?
_atom_sites.Cartn_transf_matrix[3][2] ?
_atom_sites.Cartn_transf_matrix[3][3] ?
_atom_sites.Cartn_transf_vector[1] ?
_atom_sites.Cartn_transf_vector[2] ?
_atom_sites.Cartn_transf_vector[3] ?
_atom_sites.fract_transf_matrix[1][1] 0.010329
_atom_sites.fract_transf_matrix[1][2] 0.005963
_atom_sites.fract_transf_matrix[1][3] 0.000000
_atom_sites.fract_transf_matrix[2][1] 0.000000
_atom_sites.fract_transf_matrix[2][2] 0.011927
_atom_sites.fract_transf_matrix[2][3] 0.000000
_atom_sites.fract_transf_matrix[3][1] 0.000000
_atom_sites.fract_transf_matrix[3][2] 0.000000
_atom_sites.fract_transf_matrix[3][3] 0.012477
_atom_sites.fract_transf_vector[1] 0.00000
_atom_sites.fract_transf_vector[2] 0.00000
_atom_sites.fract_transf_vector[3] 0.00000
_atom_sites.solution_primary ?
_atom_sites.solution_secondary ?
_atom_sites.solution_hydrogens ?
_atom_sites.special_details ?
#
loop_
_atom_type.symbol
_atom_type.scat_dispersion_real
_atom_type.scat_dispersion_imag
_atom_type.scat_Cromer_Mann_a1
_atom_type.scat_Cromer_Mann_a2
_atom_type.scat_Cromer_Mann_a3
_atom_type.scat_Cromer_Mann_a4
_atom_type.scat_Cromer_Mann_b1
_atom_type.scat_Cromer_Mann_b2
_atom_type.scat_Cromer_Mann_b3
_atom_type.scat_Cromer_Mann_b4
_atom_type.scat_Cromer_Mann_c
_atom_type.scat_source
_atom_type.scat_dispersion_source
C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
?
N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
?
O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
?
P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
?
S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
?
#
loop_