data_7QUW
#
_entry.id 7QUW
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 5.397
_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
#
loop_
_database_2.database_id
_database_2.database_code
_database_2.pdbx_database_accession
_database_2.pdbx_DOI
PDB 7QUW pdb_00007quw 10.2210/pdb7quw/pdb
WWPDB D_1292120327 ? ?
#
loop_
_pdbx_audit_revision_history.ordinal
_pdbx_audit_revision_history.data_content_type
_pdbx_audit_revision_history.major_revision
_pdbx_audit_revision_history.minor_revision
_pdbx_audit_revision_history.revision_date
1 'Structure model' 1 0 2022-03-09
2 'Structure model' 1 1 2022-10-05
3 'Structure model' 1 2 2024-01-31
4 'Structure model' 1 3 2024-10-16
#
_pdbx_audit_revision_details.ordinal 1
_pdbx_audit_revision_details.revision_ordinal 1
_pdbx_audit_revision_details.data_content_type 'Structure model'
_pdbx_audit_revision_details.provider repository
_pdbx_audit_revision_details.type 'Initial release'
_pdbx_audit_revision_details.description ?
_pdbx_audit_revision_details.details ?
#
loop_
_pdbx_audit_revision_group.ordinal
_pdbx_audit_revision_group.revision_ordinal
_pdbx_audit_revision_group.data_content_type
_pdbx_audit_revision_group.group
1 2 'Structure model' 'Database references'
2 2 'Structure model' 'Derived calculations'
3 3 'Structure model' 'Data collection'
4 3 'Structure model' 'Refinement description'
5 4 'Structure model' 'Structure summary'
#
loop_
_pdbx_audit_revision_category.ordinal
_pdbx_audit_revision_category.revision_ordinal
_pdbx_audit_revision_category.data_content_type
_pdbx_audit_revision_category.category
1 2 'Structure model' atom_type
2 2 'Structure model' citation
3 2 'Structure model' citation_author
4 3 'Structure model' chem_comp_atom
5 3 'Structure model' chem_comp_bond
6 3 'Structure model' pdbx_initial_refinement_model
7 4 'Structure model' pdbx_entry_details
8 4 'Structure model' pdbx_modification_feature
#
loop_
_pdbx_audit_revision_item.ordinal
_pdbx_audit_revision_item.revision_ordinal
_pdbx_audit_revision_item.data_content_type
_pdbx_audit_revision_item.item
1 2 'Structure model' '_atom_type.pdbx_N_electrons'
2 2 'Structure model' '_atom_type.pdbx_scat_Z'
3 2 'Structure model' '_citation.country'
4 2 'Structure model' '_citation.journal_abbrev'
5 2 'Structure model' '_citation.journal_id_CSD'
6 2 'Structure model' '_citation.journal_id_ISSN'
7 2 'Structure model' '_citation.journal_volume'
8 2 'Structure model' '_citation.pdbx_database_id_DOI'
9 2 'Structure model' '_citation.pdbx_database_id_PubMed'
10 2 'Structure model' '_citation.title'
11 2 'Structure model' '_citation.year'
12 4 'Structure model' '_pdbx_entry_details.has_protein_modification'
#
_pdbx_database_status.status_code REL
_pdbx_database_status.status_code_sf REL
_pdbx_database_status.status_code_mr ?
_pdbx_database_status.entry_id 7QUW
_pdbx_database_status.recvd_initial_deposition_date 2022-01-19
_pdbx_database_status.SG_entry N
_pdbx_database_status.deposit_site PDBE
_pdbx_database_status.process_site PDBE
_pdbx_database_status.status_code_cs ?
_pdbx_database_status.status_code_nmr_data ?
_pdbx_database_status.methods_development_category ?
_pdbx_database_status.pdb_format_compatible N
#
_pdbx_contact_author.id 2
_pdbx_contact_author.email rolf.hilgenfeld@uni-luebeck.de
_pdbx_contact_author.name_first Rolf
_pdbx_contact_author.name_last 'Prof. Dr. Dr. Hilgenfeld'
_pdbx_contact_author.name_mi ?
_pdbx_contact_author.role 'principal investigator/group leader'
_pdbx_contact_author.identifier_ORCID 0000-0001-8850-2977
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
_audit_author.identifier_ORCID
'Zhang, L.' 1 0000-0003-4084-3582
'Hilgenfeld, R.' 2 0000-0001-8850-2977
#
_citation.abstract ?
_citation.abstract_id_CAS ?
_citation.book_id_ISBN ?
_citation.book_publisher ?
_citation.book_publisher_city ?
_citation.book_title ?
_citation.coordinate_linkage ?
_citation.country CH
_citation.database_id_Medline ?
_citation.details ?
_citation.id primary
_citation.journal_abbrev Molecules
_citation.journal_id_ASTM ?
_citation.journal_id_CSD ?
_citation.journal_id_ISSN 1420-3049
_citation.journal_full ?
_citation.journal_issue ?
_citation.journal_volume 27
_citation.language ?
_citation.page_first ?
_citation.page_last ?
_citation.title
'From Repurposing to Redesign: Optimization of Boceprevir to Highly Potent Inhibitors of the SARS-CoV-2 Main Protease.'
_citation.year 2022
_citation.database_id_CSD ?
_citation.pdbx_database_id_DOI 10.3390/molecules27134292
_citation.pdbx_database_id_PubMed 35807537
_citation.pdbx_database_id_patent ?
_citation.unpublished_flag ?
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
_citation_author.identifier_ORCID
primary 'Gohl, M.' 1 ?
primary 'Zhang, L.' 2 ?
primary 'El Kilani, H.' 3 ?
primary 'Sun, X.' 4 ?
primary 'Zhang, K.' 5 ?
primary 'Bronstrup, M.' 6 0000-0002-8971-7045
primary 'Hilgenfeld, R.' 7 0000-0001-8850-2977
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.pdbx_ec
_entity.pdbx_mutation
_entity.pdbx_fragment
_entity.details
1 polymer man 'Protease 3C' 19925.961 1 3.4.22.28 ? ? ?
2 non-polymer syn
;(1R,2S,5S)-N-{(2S,3R)-4-amino-3-hydroxy-4-oxo-1-[(3S)-2-oxopyrrolidin-3-yl]butan-2-yl}-3-[N-(tert-butylcarbamoyl)-3-methyl-L-valyl]-6,6-dimethyl-3-azabicyclo[3.1.0]hexane-2-carboxamide
;
550.691 1 ? ? ? ?
3 water nat water 18.015 52 ? ? ? ?
#
_entity_name_com.entity_id 1
_entity_name_com.name 'Picornain 3C,P3C'
#
_entity_poly.entity_id 1
_entity_poly.type 'polypeptide(L)'
_entity_poly.nstd_linkage no
_entity_poly.nstd_monomer no
_entity_poly.pdbx_seq_one_letter_code
;GPAFEFAVAMMKRNSSTVKTEYGEFTMLGIYDRWAVLPRHAKPGPTILMNDQEVGVLDAKELVDKDGTNLELTLLKLNRN
EKFRDIRGFLAKEEVEVNEAVLAINTSKFPNMYIPVGQVTEYGFLNLGGTPTKRMLMYNFPTRAGQCGGVLMSTGKVLGI
HVGGNGHQGFSAALLKHYFN
;
_entity_poly.pdbx_seq_one_letter_code_can
;GPAFEFAVAMMKRNSSTVKTEYGEFTMLGIYDRWAVLPRHAKPGPTILMNDQEVGVLDAKELVDKDGTNLELTLLKLNRN
EKFRDIRGFLAKEEVEVNEAVLAINTSKFPNMYIPVGQVTEYGFLNLGGTPTKRMLMYNFPTRAGQCGGVLMSTGKVLGI
HVGGNGHQGFSAALLKHYFN
;
_entity_poly.pdbx_strand_id AAA
_entity_poly.pdbx_target_identifier ?
#
loop_
_pdbx_entity_nonpoly.entity_id
_pdbx_entity_nonpoly.name
_pdbx_entity_nonpoly.comp_id
2
;(1R,2S,5S)-N-{(2S,3R)-4-amino-3-hydroxy-4-oxo-1-[(3S)-2-oxopyrrolidin-3-yl]butan-2-yl}-3-[N-(tert-butylcarbamoyl)-3-methyl-L-valyl]-6,6-dimethyl-3-azabicyclo[3.1.0]hexane-2-carboxamide
;
I70
3 water HOH
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 GLY n
1 2 PRO n
1 3 ALA n
1 4 PHE n
1 5 GLU n
1 6 PHE n
1 7 ALA n
1 8 VAL n
1 9 ALA n
1 10 MET n
1 11 MET n
1 12 LYS n
1 13 ARG n
1 14 ASN n
1 15 SER n
1 16 SER n
1 17 THR n
1 18 VAL n
1 19 LYS n
1 20 THR n
1 21 GLU n
1 22 TYR n
1 23 GLY n
1 24 GLU n
1 25 PHE n
1 26 THR n
1 27 MET n
1 28 LEU n
1 29 GLY n
1 30 ILE n
1 31 TYR n
1 32 ASP n
1 33 ARG n
1 34 TRP n
1 35 ALA n
1 36 VAL n
1 37 LEU n
1 38 PRO n
1 39 ARG n
1 40 HIS n
1 41 ALA n
1 42 LYS n
1 43 PRO n
1 44 GLY n
1 45 PRO n
1 46 THR n
1 47 ILE n
1 48 LEU n
1 49 MET n
1 50 ASN n
1 51 ASP n
1 52 GLN n
1 53 GLU n
1 54 VAL n
1 55 GLY n
1 56 VAL n
1 57 LEU n
1 58 ASP n
1 59 ALA n
1 60 LYS n
1 61 GLU n
1 62 LEU n
1 63 VAL n
1 64 ASP n
1 65 LYS n
1 66 ASP n
1 67 GLY n
1 68 THR n
1 69 ASN n
1 70 LEU n
1 71 GLU n
1 72 LEU n
1 73 THR n
1 74 LEU n
1 75 LEU n
1 76 LYS n
1 77 LEU n
1 78 ASN n
1 79 ARG n
1 80 ASN n
1 81 GLU n
1 82 LYS n
1 83 PHE n
1 84 ARG n
1 85 ASP n
1 86 ILE n
1 87 ARG n
1 88 GLY n
1 89 PHE n
1 90 LEU n
1 91 ALA n
1 92 LYS n
1 93 GLU n
1 94 GLU n
1 95 VAL n
1 96 GLU n
1 97 VAL n
1 98 ASN n
1 99 GLU n
1 100 ALA n
1 101 VAL n
1 102 LEU n
1 103 ALA n
1 104 ILE n
1 105 ASN n
1 106 THR n
1 107 SER n
1 108 LYS n
1 109 PHE n
1 110 PRO n
1 111 ASN n
1 112 MET n
1 113 TYR n
1 114 ILE n
1 115 PRO n
1 116 VAL n
1 117 GLY n
1 118 GLN n
1 119 VAL n
1 120 THR n
1 121 GLU n
1 122 TYR n
1 123 GLY n
1 124 PHE n
1 125 LEU n
1 126 ASN n
1 127 LEU n
1 128 GLY n
1 129 GLY n
1 130 THR n
1 131 PRO n
1 132 THR n
1 133 LYS n
1 134 ARG n
1 135 MET n
1 136 LEU n
1 137 MET n
1 138 TYR n
1 139 ASN n
1 140 PHE n
1 141 PRO n
1 142 THR n
1 143 ARG n
1 144 ALA n
1 145 GLY n
1 146 GLN n
1 147 CYS n
1 148 GLY n
1 149 GLY n
1 150 VAL n
1 151 LEU n
1 152 MET n
1 153 SER n
1 154 THR n
1 155 GLY n
1 156 LYS n
1 157 VAL n
1 158 LEU n
1 159 GLY n
1 160 ILE n
1 161 HIS n
1 162 VAL n
1 163 GLY n
1 164 GLY n
1 165 ASN n
1 166 GLY n
1 167 HIS n
1 168 GLN n
1 169 GLY n
1 170 PHE n
1 171 SER n
1 172 ALA n
1 173 ALA n
1 174 LEU n
1 175 LEU n
1 176 LYS n
1 177 HIS n
1 178 TYR n
1 179 PHE n
1 180 ASN n
#
_entity_src_gen.entity_id 1
_entity_src_gen.pdbx_src_id 1
_entity_src_gen.pdbx_alt_source_flag sample
_entity_src_gen.pdbx_seq_type 'Biological sequence'
_entity_src_gen.pdbx_beg_seq_num 1
_entity_src_gen.pdbx_end_seq_num 180
_entity_src_gen.gene_src_common_name ?
_entity_src_gen.gene_src_genus ?
_entity_src_gen.pdbx_gene_src_gene ?
_entity_src_gen.gene_src_species ?
_entity_src_gen.gene_src_strain ?
_entity_src_gen.gene_src_tissue ?
_entity_src_gen.gene_src_tissue_fraction ?
_entity_src_gen.gene_src_details ?
_entity_src_gen.pdbx_gene_src_fragment ?
_entity_src_gen.pdbx_gene_src_scientific_name 'Coxsackievirus B3'
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 12072
_entity_src_gen.pdbx_gene_src_variant ?
_entity_src_gen.pdbx_gene_src_cell_line ?
_entity_src_gen.pdbx_gene_src_atcc ?
_entity_src_gen.pdbx_gene_src_organ ?
_entity_src_gen.pdbx_gene_src_organelle ?
_entity_src_gen.pdbx_gene_src_cell ?
_entity_src_gen.pdbx_gene_src_cellular_location ?
_entity_src_gen.host_org_common_name ?
_entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)'
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008
_entity_src_gen.host_org_genus ?
_entity_src_gen.pdbx_host_org_gene ?
_entity_src_gen.pdbx_host_org_organ ?
_entity_src_gen.host_org_species ?
_entity_src_gen.pdbx_host_org_tissue ?
_entity_src_gen.pdbx_host_org_tissue_fraction ?
_entity_src_gen.pdbx_host_org_strain ?
_entity_src_gen.pdbx_host_org_variant ?
_entity_src_gen.pdbx_host_org_cell_line ?
_entity_src_gen.pdbx_host_org_atcc ?
_entity_src_gen.pdbx_host_org_culture_collection ?
_entity_src_gen.pdbx_host_org_cell ?
_entity_src_gen.pdbx_host_org_organelle ?
_entity_src_gen.pdbx_host_org_cellular_location ?
_entity_src_gen.pdbx_host_org_vector_type ?
_entity_src_gen.pdbx_host_org_vector ?
_entity_src_gen.host_org_details ?
_entity_src_gen.expression_system_id ?
_entity_src_gen.plasmid_name ?
_entity_src_gen.plasmid_details ?
_entity_src_gen.pdbx_description ?
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.mon_nstd_flag
_chem_comp.name
_chem_comp.pdbx_synonyms
_chem_comp.formula
_chem_comp.formula_weight
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129
GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162
HOH non-polymer . WATER ? 'H2 O' 18.015
I70 non-polymer .
;(1R,2S,5S)-N-{(2S,3R)-4-amino-3-hydroxy-4-oxo-1-[(3S)-2-oxopyrrolidin-3-yl]butan-2-yl}-3-[N-(tert-butylcarbamoyl)-3-methyl-L-valyl]-6,6-dimethyl-3-azabicyclo[3.1.0]hexane-2-carboxamide
;
? 'C27 H46 N6 O6' 550.691
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.ndb_seq_num
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
_pdbx_poly_seq_scheme.hetero
A 1 1 GLY 1 1 1 GLY GLY AAA . n
A 1 2 PRO 2 2 2 PRO PRO AAA . n
A 1 3 ALA 3 3 3 ALA ALA AAA . n
A 1 4 PHE 4 4 4 PHE PHE AAA . n
A 1 5 GLU 5 5 5 GLU GLU AAA . n
A 1 6 PHE 6 6 6 PHE PHE AAA . n
A 1 7 ALA 7 7 7 ALA ALA AAA . n
A 1 8 VAL 8 8 8 VAL VAL AAA . n
A 1 9 ALA 9 9 9 ALA ALA AAA . n
A 1 10 MET 10 10 10 MET MET AAA . n
A 1 11 MET 11 11 11 MET MET AAA . n
A 1 12 LYS 12 12 12 LYS LYS AAA . n
A 1 13 ARG 13 13 13 ARG ARG AAA . n
A 1 14 ASN 14 14 14 ASN ASN AAA . n
A 1 15 SER 15 15 15 SER SER AAA . n
A 1 16 SER 16 16 16 SER SER AAA . n
A 1 17 THR 17 17 17 THR THR AAA . n
A 1 18 VAL 18 18 18 VAL VAL AAA . n
A 1 19 LYS 19 19 19 LYS LYS AAA . n
A 1 20 THR 20 20 20 THR THR AAA . n
A 1 21 GLU 21 21 21 GLU GLU AAA . n
A 1 22 TYR 22 22 22 TYR TYR AAA . n
A 1 23 GLY 23 23 23 GLY GLY AAA . n
A 1 24 GLU 24 24 24 GLU GLU AAA . n
A 1 25 PHE 25 25 25 PHE PHE AAA . n
A 1 26 THR 26 26 26 THR THR AAA . n
A 1 27 MET 27 27 27 MET MET AAA . n
A 1 28 LEU 28 28 28 LEU LEU AAA . n
A 1 29 GLY 29 29 29 GLY GLY AAA . n
A 1 30 ILE 30 30 30 ILE ILE AAA . n
A 1 31 TYR 31 31 31 TYR TYR AAA . n
A 1 32 ASP 32 32 32 ASP ASP AAA . n
A 1 33 ARG 33 33 33 ARG ARG AAA . n
A 1 34 TRP 34 34 34 TRP TRP AAA . n
A 1 35 ALA 35 35 35 ALA ALA AAA . n
A 1 36 VAL 36 36 36 VAL VAL AAA . n
A 1 37 LEU 37 37 37 LEU LEU AAA . n
A 1 38 PRO 38 38 38 PRO PRO AAA . n
A 1 39 ARG 39 39 39 ARG ARG AAA . n
A 1 40 HIS 40 40 40 HIS HIS AAA . n
A 1 41 ALA 41 41 41 ALA ALA AAA . n
A 1 42 LYS 42 42 42 LYS LYS AAA . n
A 1 43 PRO 43 43 43 PRO PRO AAA . n
A 1 44 GLY 44 44 44 GLY GLY AAA . n
A 1 45 PRO 45 45 45 PRO PRO AAA . n
A 1 46 THR 46 46 46 THR THR AAA . n
A 1 47 ILE 47 47 47 ILE ILE AAA . n
A 1 48 LEU 48 48 48 LEU LEU AAA . n
A 1 49 MET 49 49 49 MET MET AAA . n
A 1 50 ASN 50 50 50 ASN ASN AAA . n
A 1 51 ASP 51 51 51 ASP ASP AAA . n
A 1 52 GLN 52 52 52 GLN GLN AAA . n
A 1 53 GLU 53 53 53 GLU GLU AAA . n
A 1 54 VAL 54 54 54 VAL VAL AAA . n
A 1 55 GLY 55 55 55 GLY GLY AAA . n
A 1 56 VAL 56 56 56 VAL VAL AAA . n
A 1 57 LEU 57 57 57 LEU LEU AAA . n
A 1 58 ASP 58 58 58 ASP ASP AAA . n
A 1 59 ALA 59 59 59 ALA ALA AAA . n
A 1 60 LYS 60 60 60 LYS LYS AAA . n
A 1 61 GLU 61 61 61 GLU GLU AAA . n
A 1 62 LEU 62 62 62 LEU LEU AAA . n
A 1 63 VAL 63 63 63 VAL VAL AAA . n
A 1 64 ASP 64 64 64 ASP ASP AAA . n
A 1 65 LYS 65 65 65 LYS LYS AAA . n
A 1 66 ASP 66 66 66 ASP ASP AAA . n
A 1 67 GLY 67 67 67 GLY GLY AAA . n
A 1 68 THR 68 68 68 THR THR AAA . n
A 1 69 ASN 69 69 69 ASN ASN AAA . n
A 1 70 LEU 70 70 70 LEU LEU AAA . n
A 1 71 GLU 71 71 71 GLU GLU AAA . n
A 1 72 LEU 72 72 72 LEU LEU AAA . n
A 1 73 THR 73 73 73 THR THR AAA . n
A 1 74 LEU 74 74 74 LEU LEU AAA . n
A 1 75 LEU 75 75 75 LEU LEU AAA . n
A 1 76 LYS 76 76 76 LYS LYS AAA . n
A 1 77 LEU 77 77 77 LEU LEU AAA . n
A 1 78 ASN 78 78 78 ASN ASN AAA . n
A 1 79 ARG 79 79 79 ARG ARG AAA . n
A 1 80 ASN 80 80 80 ASN ASN AAA . n
A 1 81 GLU 81 81 81 GLU GLU AAA . n
A 1 82 LYS 82 82 82 LYS LYS AAA . n
A 1 83 PHE 83 83 83 PHE PHE AAA . n
A 1 84 ARG 84 84 84 ARG ARG AAA . n
A 1 85 ASP 85 85 85 ASP ASP AAA . n
A 1 86 ILE 86 86 86 ILE ILE AAA . n
A 1 87 ARG 87 87 87 ARG ARG AAA . n
A 1 88 GLY 88 88 88 GLY GLY AAA . n
A 1 89 PHE 89 89 89 PHE PHE AAA . n
A 1 90 LEU 90 90 90 LEU LEU AAA . n
A 1 91 ALA 91 91 91 ALA ALA AAA . n
A 1 92 LYS 92 92 92 LYS LYS AAA . n
A 1 93 GLU 93 93 93 GLU GLU AAA . n
A 1 94 GLU 94 94 94 GLU GLU AAA . n
A 1 95 VAL 95 95 95 VAL VAL AAA . n
A 1 96 GLU 96 96 96 GLU GLU AAA . n
A 1 97 VAL 97 97 97 VAL VAL AAA . n
A 1 98 ASN 98 98 98 ASN ASN AAA . n
A 1 99 GLU 99 99 99 GLU GLU AAA . n
A 1 100 ALA 100 100 100 ALA ALA AAA . n
A 1 101 VAL 101 101 101 VAL VAL AAA . n
A 1 102 LEU 102 102 102 LEU LEU AAA . n
A 1 103 ALA 103 103 103 ALA ALA AAA . n
A 1 104 ILE 104 104 104 ILE ILE AAA . n
A 1 105 ASN 105 105 105 ASN ASN AAA . n
A 1 106 THR 106 106 106 THR THR AAA . n
A 1 107 SER 107 107 107 SER SER AAA . n
A 1 108 LYS 108 108 108 LYS LYS AAA . n
A 1 109 PHE 109 109 109 PHE PHE AAA . n
A 1 110 PRO 110 110 110 PRO PRO AAA . n
A 1 111 ASN 111 111 111 ASN ASN AAA . n
A 1 112 MET 112 112 112 MET MET AAA . n
A 1 113 TYR 113 113 113 TYR TYR AAA . n
A 1 114 ILE 114 114 114 ILE ILE AAA . n
A 1 115 PRO 115 115 115 PRO PRO AAA . n
A 1 116 VAL 116 116 116 VAL VAL AAA . n
A 1 117 GLY 117 117 117 GLY GLY AAA . n
A 1 118 GLN 118 118 118 GLN GLN AAA . n
A 1 119 VAL 119 119 119 VAL VAL AAA . n
A 1 120 THR 120 120 120 THR THR AAA . n
A 1 121 GLU 121 121 121 GLU GLU AAA . n
A 1 122 TYR 122 122 122 TYR TYR AAA . n
A 1 123 GLY 123 123 123 GLY GLY AAA . n
A 1 124 PHE 124 124 124 PHE PHE AAA . n
A 1 125 LEU 125 125 125 LEU LEU AAA . n
A 1 126 ASN 126 126 126 ASN ASN AAA . n
A 1 127 LEU 127 127 127 LEU LEU AAA . n
A 1 128 GLY 128 128 128 GLY GLY AAA . n
A 1 129 GLY 129 129 129 GLY GLY AAA . n
A 1 130 THR 130 130 130 THR THR AAA . n
A 1 131 PRO 131 131 131 PRO PRO AAA . n
A 1 132 THR 132 132 132 THR THR AAA . n
A 1 133 LYS 133 133 133 LYS LYS AAA . n
A 1 134 ARG 134 134 134 ARG ARG AAA . n
A 1 135 MET 135 135 135 MET MET AAA . n
A 1 136 LEU 136 136 136 LEU LEU AAA . n
A 1 137 MET 137 137 137 MET MET AAA . n
A 1 138 TYR 138 138 138 TYR TYR AAA . n
A 1 139 ASN 139 139 139 ASN ASN AAA . n
A 1 140 PHE 140 140 140 PHE PHE AAA . n
A 1 141 PRO 141 141 141 PRO PRO AAA . n
A 1 142 THR 142 142 142 THR THR AAA . n
A 1 143 ARG 143 143 143 ARG ARG AAA . n
A 1 144 ALA 144 144 144 ALA ALA AAA . n
A 1 145 GLY 145 145 145 GLY GLY AAA . n
A 1 146 GLN 146 146 146 GLN GLN AAA . n
A 1 147 CYS 147 147 147 CYS CYS AAA . n
A 1 148 GLY 148 148 148 GLY GLY AAA . n
A 1 149 GLY 149 149 149 GLY GLY AAA . n
A 1 150 VAL 150 150 150 VAL VAL AAA . n
A 1 151 LEU 151 151 151 LEU LEU AAA . n
A 1 152 MET 152 152 152 MET MET AAA . n
A 1 153 SER 153 153 153 SER SER AAA . n
A 1 154 THR 154 154 154 THR THR AAA . n
A 1 155 GLY 155 155 155 GLY GLY AAA . n
A 1 156 LYS 156 156 156 LYS LYS AAA . n
A 1 157 VAL 157 157 157 VAL VAL AAA . n
A 1 158 LEU 158 158 158 LEU LEU AAA . n
A 1 159 GLY 159 159 159 GLY GLY AAA . n
A 1 160 ILE 160 160 160 ILE ILE AAA . n
A 1 161 HIS 161 161 161 HIS HIS AAA . n
A 1 162 VAL 162 162 162 VAL VAL AAA . n
A 1 163 GLY 163 163 163 GLY GLY AAA . n
A 1 164 GLY 164 164 164 GLY GLY AAA . n
A 1 165 ASN 165 165 165 ASN ASN AAA . n
A 1 166 GLY 166 166 166 GLY GLY AAA . n
A 1 167 HIS 167 167 167 HIS HIS AAA . n
A 1 168 GLN 168 168 168 GLN GLN AAA . n
A 1 169 GLY 169 169 169 GLY GLY AAA . n
A 1 170 PHE 170 170 170 PHE PHE AAA . n
A 1 171 SER 171 171 171 SER SER AAA . n
A 1 172 ALA 172 172 172 ALA ALA AAA . n
A 1 173 ALA 173 173 173 ALA ALA AAA . n
A 1 174 LEU 174 174 174 LEU LEU AAA . n
A 1 175 LEU 175 175 175 LEU LEU AAA . n
A 1 176 LYS 176 176 176 LYS LYS AAA . n
A 1 177 HIS 177 177 177 HIS HIS AAA . n
A 1 178 TYR 178 178 178 TYR TYR AAA . n
A 1 179 PHE 179 179 179 PHE PHE AAA . n
A 1 180 ASN 180 180 180 ASN ASN AAA . n
#
loop_
_pdbx_nonpoly_scheme.asym_id
_pdbx_nonpoly_scheme.entity_id
_pdbx_nonpoly_scheme.mon_id
_pdbx_nonpoly_scheme.ndb_seq_num
_pdbx_nonpoly_scheme.pdb_seq_num
_pdbx_nonpoly_scheme.auth_seq_num
_pdbx_nonpoly_scheme.pdb_mon_id
_pdbx_nonpoly_scheme.auth_mon_id
_pdbx_nonpoly_scheme.pdb_strand_id
_pdbx_nonpoly_scheme.pdb_ins_code
B 2 I70 1 201 201 I70 G87 AAA .
C 3 HOH 1 301 7 HOH HOH AAA .
C 3 HOH 2 302 13 HOH HOH AAA .
C 3 HOH 3 303 56 HOH HOH AAA .
C 3 HOH 4 304 57 HOH HOH AAA .
C 3 HOH 5 305 36 HOH HOH AAA .
C 3 HOH 6 306 17 HOH HOH AAA .
C 3 HOH 7 307 44 HOH HOH AAA .
C 3 HOH 8 308 43 HOH HOH AAA .
C 3 HOH 9 309 31 HOH HOH AAA .
C 3 HOH 10 310 2 HOH HOH AAA .
C 3 HOH 11 311 59 HOH HOH AAA .
C 3 HOH 12 312 8 HOH HOH AAA .
C 3 HOH 13 313 54 HOH HOH AAA .
C 3 HOH 14 314 3 HOH HOH AAA .
C 3 HOH 15 315 52 HOH HOH AAA .
C 3 HOH 16 316 46 HOH HOH AAA .
C 3 HOH 17 317 39 HOH HOH AAA .
C 3 HOH 18 318 12 HOH HOH AAA .
C 3 HOH 19 319 5 HOH HOH AAA .
C 3 HOH 20 320 16 HOH HOH AAA .
C 3 HOH 21 321 1 HOH HOH AAA .
C 3 HOH 22 322 48 HOH HOH AAA .
C 3 HOH 23 323 34 HOH HOH AAA .
C 3 HOH 24 324 37 HOH HOH AAA .
C 3 HOH 25 325 6 HOH HOH AAA .
C 3 HOH 26 326 23 HOH HOH AAA .
C 3 HOH 27 327 10 HOH HOH AAA .
C 3 HOH 28 328 50 HOH HOH AAA .
C 3 HOH 29 329 14 HOH HOH AAA .
C 3 HOH 30 330 4 HOH HOH AAA .
C 3 HOH 31 331 51 HOH HOH AAA .
C 3 HOH 32 332 55 HOH HOH AAA .
C 3 HOH 33 333 40 HOH HOH AAA .
C 3 HOH 34 334 58 HOH HOH AAA .
C 3 HOH 35 335 53 HOH HOH AAA .
C 3 HOH 36 336 9 HOH HOH AAA .
C 3 HOH 37 337 35 HOH HOH AAA .
C 3 HOH 38 338 47 HOH HOH AAA .
C 3 HOH 39 339 32 HOH HOH AAA .
C 3 HOH 40 340 49 HOH HOH AAA .
C 3 HOH 41 341 22 HOH HOH AAA .
C 3 HOH 42 342 33 HOH HOH AAA .
C 3 HOH 43 343 42 HOH HOH AAA .
C 3 HOH 44 344 26 HOH HOH AAA .
C 3 HOH 45 345 30 HOH HOH AAA .
C 3 HOH 46 346 18 HOH HOH AAA .
C 3 HOH 47 347 24 HOH HOH AAA .
C 3 HOH 48 348 27 HOH HOH AAA .
C 3 HOH 49 349 25 HOH HOH AAA .
C 3 HOH 50 350 38 HOH HOH AAA .
C 3 HOH 51 351 19 HOH HOH AAA .
C 3 HOH 52 352 41 HOH HOH AAA .
#
loop_
_pdbx_unobs_or_zero_occ_atoms.id
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num
_pdbx_unobs_or_zero_occ_atoms.polymer_flag
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id
_pdbx_unobs_or_zero_occ_atoms.label_alt_id
_pdbx_unobs_or_zero_occ_atoms.label_asym_id
_pdbx_unobs_or_zero_occ_atoms.label_comp_id
_pdbx_unobs_or_zero_occ_atoms.label_seq_id
_pdbx_unobs_or_zero_occ_atoms.label_atom_id
1 1 Y 1 AAA PHE 124 ? CG ? A PHE 124 CG
2 1 Y 1 AAA PHE 124 ? CD1 ? A PHE 124 CD1
3 1 Y 1 AAA PHE 124 ? CD2 ? A PHE 124 CD2
4 1 Y 1 AAA PHE 124 ? CE1 ? A PHE 124 CE1
5 1 Y 1 AAA PHE 124 ? CE2 ? A PHE 124 CE2
6 1 Y 1 AAA PHE 124 ? CZ ? A PHE 124 CZ
#
loop_
_software.citation_id
_software.classification
_software.compiler_name
_software.compiler_version
_software.contact_author
_software.contact_author_email
_software.date
_software.description
_software.dependencies
_software.hardware
_software.language
_software.location
_software.mods
_software.name
_software.os
_software.os_version
_software.type
_software.version
_software.pdbx_ordinal
? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3
? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 4
#
_cell.angle_alpha 90.000
_cell.angle_alpha_esd ?
_cell.angle_beta 115.553
_cell.angle_beta_esd ?
_cell.angle_gamma 90.000
_cell.angle_gamma_esd ?
_cell.entry_id 7QUW
_cell.details ?
_cell.formula_units_Z ?
_cell.length_a 78.271
_cell.length_a_esd ?
_cell.length_b 64.290
_cell.length_b_esd ?
_cell.length_c 39.850
_cell.length_c_esd ?
_cell.volume ?
_cell.volume_esd ?
_cell.Z_PDB 4
_cell.reciprocal_angle_alpha ?
_cell.reciprocal_angle_beta ?
_cell.reciprocal_angle_gamma ?
_cell.reciprocal_angle_alpha_esd ?
_cell.reciprocal_angle_beta_esd ?
_cell.reciprocal_angle_gamma_esd ?
_cell.reciprocal_length_a ?
_cell.reciprocal_length_b ?
_cell.reciprocal_length_c ?
_cell.reciprocal_length_a_esd ?
_cell.reciprocal_length_b_esd ?
_cell.reciprocal_length_c_esd ?
_cell.pdbx_unique_axis ?
#
_symmetry.entry_id 7QUW
_symmetry.cell_setting ?
_symmetry.Int_Tables_number 5
_symmetry.space_group_name_Hall ?
_symmetry.space_group_name_H-M 'C 1 2 1'
_symmetry.pdbx_full_space_group_name_H-M ?
#
_exptl.absorpt_coefficient_mu ?
_exptl.absorpt_correction_T_max ?
_exptl.absorpt_correction_T_min ?
_exptl.absorpt_correction_type ?
_exptl.absorpt_process_details ?
_exptl.entry_id 7QUW
_exptl.crystals_number 1
_exptl.details ?
_exptl.method 'X-RAY DIFFRACTION'
_exptl.method_details ?
#
_exptl_crystal.colour ?
_exptl_crystal.density_diffrn ?
_exptl_crystal.density_Matthews 2.27
_exptl_crystal.density_method ?
_exptl_crystal.density_percent_sol 45.81
_exptl_crystal.description ?
_exptl_crystal.F_000 ?
_exptl_crystal.id 1
_exptl_crystal.preparation ?
_exptl_crystal.size_max ?
_exptl_crystal.size_mid ?
_exptl_crystal.size_min ?
_exptl_crystal.size_rad ?
_exptl_crystal.colour_lustre ?
_exptl_crystal.colour_modifier ?
_exptl_crystal.colour_primary ?
_exptl_crystal.density_meas ?
_exptl_crystal.density_meas_esd ?
_exptl_crystal.density_meas_gt ?
_exptl_crystal.density_meas_lt ?
_exptl_crystal.density_meas_temp ?
_exptl_crystal.density_meas_temp_esd ?
_exptl_crystal.density_meas_temp_gt ?
_exptl_crystal.density_meas_temp_lt ?
_exptl_crystal.pdbx_crystal_image_url ?
_exptl_crystal.pdbx_crystal_image_format ?
_exptl_crystal.pdbx_mosaicity ?
_exptl_crystal.pdbx_mosaicity_esd ?
#
_exptl_crystal_grow.apparatus ?
_exptl_crystal_grow.atmosphere ?
_exptl_crystal_grow.crystal_id 1
_exptl_crystal_grow.details ?
_exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP'
_exptl_crystal_grow.method_ref ?
_exptl_crystal_grow.pH 8.6
_exptl_crystal_grow.pressure ?
_exptl_crystal_grow.pressure_esd ?
_exptl_crystal_grow.seeding ?
_exptl_crystal_grow.seeding_ref ?
_exptl_crystal_grow.temp 293
_exptl_crystal_grow.temp_details ?
_exptl_crystal_grow.temp_esd ?
_exptl_crystal_grow.time ?
_exptl_crystal_grow.pdbx_details
;0.2 M MgCl2
0.1M Tris-HCl pH 8.6
25% PEG 3350
;
_exptl_crystal_grow.pdbx_pH_range ?
#
_diffrn.ambient_environment ?
_diffrn.ambient_temp 100
_diffrn.ambient_temp_details ?
_diffrn.ambient_temp_esd ?
_diffrn.crystal_id 1
_diffrn.crystal_support ?
_diffrn.crystal_treatment ?
_diffrn.details ?
_diffrn.id 1
_diffrn.ambient_pressure ?
_diffrn.ambient_pressure_esd ?
_diffrn.ambient_pressure_gt ?
_diffrn.ambient_pressure_lt ?
_diffrn.ambient_temp_gt ?
_diffrn.ambient_temp_lt ?
_diffrn.pdbx_serial_crystal_experiment N
#
_diffrn_detector.details ?
_diffrn_detector.detector PIXEL
_diffrn_detector.diffrn_id 1
_diffrn_detector.type 'DECTRIS EIGER X 16M'
_diffrn_detector.area_resol_mean ?
_diffrn_detector.dtime ?
_diffrn_detector.pdbx_frames_total ?
_diffrn_detector.pdbx_collection_time_total ?
_diffrn_detector.pdbx_collection_date 2021-06-22
_diffrn_detector.pdbx_frequency ?
#
_diffrn_radiation.collimation ?
_diffrn_radiation.diffrn_id 1
_diffrn_radiation.filter_edge ?
_diffrn_radiation.inhomogeneity ?
_diffrn_radiation.monochromator ?
_diffrn_radiation.polarisn_norm ?
_diffrn_radiation.polarisn_ratio ?
_diffrn_radiation.probe ?
_diffrn_radiation.type ?
_diffrn_radiation.xray_symbol ?
_diffrn_radiation.wavelength_id 1
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l M
_diffrn_radiation.pdbx_wavelength_list ?
_diffrn_radiation.pdbx_wavelength ?
_diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH'
_diffrn_radiation.pdbx_analyzer ?
_diffrn_radiation.pdbx_scattering_type x-ray
#
_diffrn_radiation_wavelength.id 1
_diffrn_radiation_wavelength.wavelength 1.0332
_diffrn_radiation_wavelength.wt 1.0
#
_diffrn_source.current ?
_diffrn_source.details ?
_diffrn_source.diffrn_id 1
_diffrn_source.power ?
_diffrn_source.size ?
_diffrn_source.source SYNCHROTRON
_diffrn_source.target ?
_diffrn_source.type 'PETRA III, DESY BEAMLINE P11'
_diffrn_source.voltage ?
_diffrn_source.take-off_angle ?
_diffrn_source.pdbx_wavelength_list 1.0332
_diffrn_source.pdbx_wavelength ?
_diffrn_source.pdbx_synchrotron_beamline P11
_diffrn_source.pdbx_synchrotron_site 'PETRA III, DESY'
#
_reflns.B_iso_Wilson_estimate ?
_reflns.entry_id 7QUW
_reflns.data_reduction_details ?
_reflns.data_reduction_method ?
_reflns.d_resolution_high 1.65
_reflns.d_resolution_low 35.95
_reflns.details ?
_reflns.limit_h_max ?
_reflns.limit_h_min ?
_reflns.limit_k_max ?
_reflns.limit_k_min ?
_reflns.limit_l_max ?
_reflns.limit_l_min ?
_reflns.number_all ?
_reflns.number_obs 43026
_reflns.observed_criterion ?
_reflns.observed_criterion_F_max ?
_reflns.observed_criterion_F_min ?
_reflns.observed_criterion_I_max ?
_reflns.observed_criterion_I_min ?
_reflns.observed_criterion_sigma_F ?
_reflns.observed_criterion_sigma_I ?
_reflns.percent_possible_obs 98.1
_reflns.R_free_details ?
_reflns.Rmerge_F_all ?
_reflns.Rmerge_F_obs ?
_reflns.Friedel_coverage ?
_reflns.number_gt ?
_reflns.threshold_expression ?
_reflns.pdbx_redundancy 6.7
_reflns.pdbx_Rmerge_I_obs ?
_reflns.pdbx_Rmerge_I_all ?
_reflns.pdbx_Rsym_value ?
_reflns.pdbx_netI_over_av_sigmaI ?
_reflns.pdbx_netI_over_sigmaI 15.4
_reflns.pdbx_res_netI_over_av_sigmaI_2 ?
_reflns.pdbx_res_netI_over_sigmaI_2 ?
_reflns.pdbx_chi_squared ?
_reflns.pdbx_scaling_rejects ?
_reflns.pdbx_d_res_high_opt ?
_reflns.pdbx_d_res_low_opt ?
_reflns.pdbx_d_res_opt_method ?
_reflns.phase_calculation_details ?
_reflns.pdbx_Rrim_I_all ?
_reflns.pdbx_Rpim_I_all ?
_reflns.pdbx_d_opt ?
_reflns.pdbx_number_measured_all ?
_reflns.pdbx_diffrn_id 1
_reflns.pdbx_ordinal 1
_reflns.pdbx_CC_half 0.999
_reflns.pdbx_CC_star ?
_reflns.pdbx_R_split ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_1 ?
_reflns.pdbx_aniso_diffraction_limit_2 ?
_reflns.pdbx_aniso_diffraction_limit_3 ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_1 ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_2 ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_3 ?
_reflns.pdbx_orthogonalization_convention ?
_reflns.pdbx_percent_possible_ellipsoidal ?
_reflns.pdbx_percent_possible_spherical ?
_reflns.pdbx_percent_possible_ellipsoidal_anomalous ?
_reflns.pdbx_percent_possible_spherical_anomalous ?
_reflns.pdbx_redundancy_anomalous ?
_reflns.pdbx_CC_half_anomalous ?
_reflns.pdbx_absDiff_over_sigma_anomalous ?
_reflns.pdbx_percent_possible_anomalous ?
_reflns.pdbx_observed_signal_threshold ?
_reflns.pdbx_signal_type ?
_reflns.pdbx_signal_details ?
_reflns.pdbx_signal_software_id ?
#
_reflns_shell.d_res_high 1.65
_reflns_shell.d_res_low 1.74
_reflns_shell.meanI_over_sigI_all ?
_reflns_shell.meanI_over_sigI_obs ?
_reflns_shell.number_measured_all ?
_reflns_shell.number_measured_obs ?
_reflns_shell.number_possible ?
_reflns_shell.number_unique_all ?
_reflns_shell.number_unique_obs 6281
_reflns_shell.percent_possible_all ?
_reflns_shell.percent_possible_obs ?
_reflns_shell.Rmerge_F_all ?
_reflns_shell.Rmerge_F_obs ?
_reflns_shell.Rmerge_I_all ?
_reflns_shell.Rmerge_I_obs ?
_reflns_shell.meanI_over_sigI_gt ?
_reflns_shell.meanI_over_uI_all ?
_reflns_shell.meanI_over_uI_gt ?
_reflns_shell.number_measured_gt ?
_reflns_shell.number_unique_gt ?
_reflns_shell.percent_possible_gt ?
_reflns_shell.Rmerge_F_gt ?
_reflns_shell.Rmerge_I_gt ?
_reflns_shell.pdbx_redundancy ?
_reflns_shell.pdbx_Rsym_value ?
_reflns_shell.pdbx_chi_squared ?
_reflns_shell.pdbx_netI_over_sigmaI_all ?
_reflns_shell.pdbx_netI_over_sigmaI_obs ?
_reflns_shell.pdbx_Rrim_I_all ?
_reflns_shell.pdbx_Rpim_I_all ?
_reflns_shell.pdbx_rejects ?
_reflns_shell.pdbx_ordinal 1
_reflns_shell.pdbx_diffrn_id 1
_reflns_shell.pdbx_CC_half 0.874
_reflns_shell.pdbx_CC_star ?
_reflns_shell.pdbx_R_split ?
_reflns_shell.pdbx_percent_possible_ellipsoidal ?
_reflns_shell.pdbx_percent_possible_spherical ?
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ?
_reflns_shell.pdbx_percent_possible_spherical_anomalous ?
_reflns_shell.pdbx_redundancy_anomalous ?
_reflns_shell.pdbx_CC_half_anomalous ?
_reflns_shell.pdbx_absDiff_over_sigma_anomalous ?
_reflns_shell.pdbx_percent_possible_anomalous ?
#
_refine.aniso_B[1][1] -1.265
_refine.aniso_B[1][2] 0.000
_refine.aniso_B[1][3] 2.498
_refine.aniso_B[2][2] -3.518
_refine.aniso_B[2][3] -0.000
_refine.aniso_B[3][3] 1.643
_refine.B_iso_max ?
_refine.B_iso_mean 50.522
_refine.B_iso_min ?
_refine.correlation_coeff_Fo_to_Fc 0.967
_refine.correlation_coeff_Fo_to_Fc_free 0.939
_refine.details 'Hydrogens have been added in their riding positions'
_refine.diff_density_max ?
_refine.diff_density_max_esd ?
_refine.diff_density_min ?
_refine.diff_density_min_esd ?
_refine.diff_density_rms ?
_refine.diff_density_rms_esd ?
_refine.entry_id 7QUW
_refine.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine.ls_abs_structure_details ?
_refine.ls_abs_structure_Flack ?
_refine.ls_abs_structure_Flack_esd ?
_refine.ls_abs_structure_Rogers ?
_refine.ls_abs_structure_Rogers_esd ?
_refine.ls_d_res_high 1.650
_refine.ls_d_res_low 33.803
_refine.ls_extinction_coef ?
_refine.ls_extinction_coef_esd ?
_refine.ls_extinction_expression ?
_refine.ls_extinction_method ?
_refine.ls_goodness_of_fit_all ?
_refine.ls_goodness_of_fit_all_esd ?
_refine.ls_goodness_of_fit_obs ?
_refine.ls_goodness_of_fit_obs_esd ?
_refine.ls_hydrogen_treatment ?
_refine.ls_matrix_type ?
_refine.ls_number_constraints ?
_refine.ls_number_parameters ?
_refine.ls_number_reflns_all ?
_refine.ls_number_reflns_obs 20746
_refine.ls_number_reflns_R_free 1082
_refine.ls_number_reflns_R_work 19664
_refine.ls_number_restraints ?
_refine.ls_percent_reflns_obs 96.560
_refine.ls_percent_reflns_R_free 5.215
_refine.ls_R_factor_all 0.222
_refine.ls_R_factor_obs ?
_refine.ls_R_factor_R_free 0.2791
_refine.ls_R_factor_R_free_error ?
_refine.ls_R_factor_R_free_error_details ?
_refine.ls_R_factor_R_work 0.2192
_refine.ls_R_Fsqd_factor_obs ?
_refine.ls_R_I_factor_obs ?
_refine.ls_redundancy_reflns_all ?
_refine.ls_redundancy_reflns_obs ?
_refine.ls_restrained_S_all ?
_refine.ls_restrained_S_obs ?
_refine.ls_shift_over_esd_max ?
_refine.ls_shift_over_esd_mean ?
_refine.ls_structure_factor_coef ?
_refine.ls_weighting_details ?
_refine.ls_weighting_scheme ?
_refine.ls_wR_factor_all ?
_refine.ls_wR_factor_obs ?
_refine.ls_wR_factor_R_free ?
_refine.ls_wR_factor_R_work ?
_refine.occupancy_max ?
_refine.occupancy_min ?
_refine.solvent_model_details 'MASK BULK SOLVENT'
_refine.solvent_model_param_bsol ?
_refine.solvent_model_param_ksol ?
_refine.pdbx_R_complete ?
_refine.ls_R_factor_gt ?
_refine.ls_goodness_of_fit_gt ?
_refine.ls_goodness_of_fit_ref ?
_refine.ls_shift_over_su_max ?
_refine.ls_shift_over_su_max_lt ?
_refine.ls_shift_over_su_mean ?
_refine.ls_shift_over_su_mean_lt ?
_refine.pdbx_ls_sigma_I ?
_refine.pdbx_ls_sigma_F ?
_refine.pdbx_ls_sigma_Fsqd ?
_refine.pdbx_data_cutoff_high_absF ?
_refine.pdbx_data_cutoff_high_rms_absF ?
_refine.pdbx_data_cutoff_low_absF ?
_refine.pdbx_isotropic_thermal_model ?
_refine.pdbx_ls_cross_valid_method 'FREE R-VALUE'
_refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT'
_refine.pdbx_starting_model 2VB0
_refine.pdbx_stereochemistry_target_values ?
_refine.pdbx_R_Free_selection_details ?
_refine.pdbx_stereochem_target_val_spec_case ?
_refine.pdbx_overall_ESU_R 0.122
_refine.pdbx_overall_ESU_R_Free 0.130
_refine.pdbx_solvent_vdw_probe_radii 1.200
_refine.pdbx_solvent_ion_probe_radii 0.800
_refine.pdbx_solvent_shrinkage_radii 0.800
_refine.pdbx_real_space_R ?
_refine.pdbx_density_correlation ?
_refine.pdbx_pd_number_of_powder_patterns ?
_refine.pdbx_pd_number_of_points ?
_refine.pdbx_pd_meas_number_of_points ?
_refine.pdbx_pd_proc_ls_prof_R_factor ?
_refine.pdbx_pd_proc_ls_prof_wR_factor ?
_refine.pdbx_pd_Marquardt_correlation_coeff ?
_refine.pdbx_pd_Fsqrd_R_factor ?
_refine.pdbx_pd_ls_matrix_band_width ?
_refine.pdbx_overall_phase_error ?
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI ?
_refine.pdbx_overall_SU_R_free_Blow_DPI ?
_refine.pdbx_overall_SU_R_Blow_DPI ?
_refine.pdbx_TLS_residual_ADP_flag ?
_refine.pdbx_diffrn_id 1
_refine.overall_SU_B 5.218
_refine.overall_SU_ML 0.157
_refine.overall_SU_R_Cruickshank_DPI ?
_refine.overall_SU_R_free ?
_refine.overall_FOM_free_R_set ?
_refine.overall_FOM_work_R_set ?
_refine.pdbx_average_fsc_overall ?
_refine.pdbx_average_fsc_work ?
_refine.pdbx_average_fsc_free ?
#
_refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_hist.cycle_id LAST
_refine_hist.details ?
_refine_hist.d_res_high 1.650
_refine_hist.d_res_low 33.803
_refine_hist.number_atoms_solvent 52
_refine_hist.number_atoms_total 1483
_refine_hist.number_reflns_all ?
_refine_hist.number_reflns_obs ?
_refine_hist.number_reflns_R_free ?
_refine_hist.number_reflns_R_work ?
_refine_hist.R_factor_all ?
_refine_hist.R_factor_obs ?
_refine_hist.R_factor_R_free ?
_refine_hist.R_factor_R_work ?
_refine_hist.pdbx_number_residues_total ?
_refine_hist.pdbx_B_iso_mean_ligand ?
_refine_hist.pdbx_B_iso_mean_solvent ?
_refine_hist.pdbx_number_atoms_protein 1392
_refine_hist.pdbx_number_atoms_nucleic_acid 0
_refine_hist.pdbx_number_atoms_ligand 39
_refine_hist.pdbx_number_atoms_lipid ?
_refine_hist.pdbx_number_atoms_carb ?
_refine_hist.pdbx_pseudo_atom_details ?
#
loop_
_refine_ls_restr.pdbx_refine_id
_refine_ls_restr.criterion
_refine_ls_restr.dev_ideal
_refine_ls_restr.dev_ideal_target
_refine_ls_restr.number
_refine_ls_restr.rejects
_refine_ls_restr.type
_refine_ls_restr.weight
_refine_ls_restr.pdbx_restraint_function
'X-RAY DIFFRACTION' ? 0.007 0.013 1462 ? r_bond_refined_d ? ?
'X-RAY DIFFRACTION' ? 0.001 0.017 1420 ? r_bond_other_d ? ?
'X-RAY DIFFRACTION' ? 1.612 1.657 1981 ? r_angle_refined_deg ? ?
'X-RAY DIFFRACTION' ? 1.221 1.584 3261 ? r_angle_other_deg ? ?
'X-RAY DIFFRACTION' ? 7.601 5.000 179 ? r_dihedral_angle_1_deg ? ?
'X-RAY DIFFRACTION' ? 31.913 21.733 75 ? r_dihedral_angle_2_deg ? ?
'X-RAY DIFFRACTION' ? 14.605 15.000 248 ? r_dihedral_angle_3_deg ? ?
'X-RAY DIFFRACTION' ? 0.400 15.000 1 ? r_dihedral_angle_other_3_deg ? ?
'X-RAY DIFFRACTION' ? 12.541 15.000 8 ? r_dihedral_angle_4_deg ? ?
'X-RAY DIFFRACTION' ? 0.320 0.200 188 ? r_chiral_restr ? ?
'X-RAY DIFFRACTION' ? 0.007 0.020 1650 ? r_gen_planes_refined ? ?
'X-RAY DIFFRACTION' ? 0.001 0.020 330 ? r_gen_planes_other ? ?
'X-RAY DIFFRACTION' ? 0.216 0.200 240 ? r_nbd_refined ? ?
'X-RAY DIFFRACTION' ? 0.175 0.200 1334 ? r_symmetry_nbd_other ? ?
'X-RAY DIFFRACTION' ? 0.160 0.200 677 ? r_nbtor_refined ? ?
'X-RAY DIFFRACTION' ? 0.075 0.200 765 ? r_symmetry_nbtor_other ? ?
'X-RAY DIFFRACTION' ? 0.193 0.200 53 ? r_xyhbond_nbd_refined ? ?
'X-RAY DIFFRACTION' ? 0.011 0.200 1 ? r_symmetry_xyhbond_nbd_other ? ?
'X-RAY DIFFRACTION' ? 0.166 0.200 8 ? r_symmetry_nbd_refined ? ?
'X-RAY DIFFRACTION' ? 0.166 0.200 35 ? r_nbd_other ? ?
'X-RAY DIFFRACTION' ? 0.179 0.200 3 ? r_symmetry_xyhbond_nbd_refined ? ?
'X-RAY DIFFRACTION' ? 4.181 5.054 719 ? r_mcbond_it ? ?
'X-RAY DIFFRACTION' ? 4.179 5.051 718 ? r_mcbond_other ? ?
'X-RAY DIFFRACTION' ? 5.630 7.576 897 ? r_mcangle_it ? ?
'X-RAY DIFFRACTION' ? 5.627 7.579 898 ? r_mcangle_other ? ?
'X-RAY DIFFRACTION' ? 4.425 5.597 741 ? r_scbond_it ? ?
'X-RAY DIFFRACTION' ? 4.422 5.598 742 ? r_scbond_other ? ?
'X-RAY DIFFRACTION' ? 6.474 8.228 1080 ? r_scangle_it ? ?
'X-RAY DIFFRACTION' ? 6.471 8.229 1081 ? r_scangle_other ? ?
'X-RAY DIFFRACTION' ? 8.252 58.967 1493 ? r_lrange_it ? ?
'X-RAY DIFFRACTION' ? 8.251 59.014 1493 ? r_lrange_other ? ?
#
loop_
_refine_ls_shell.pdbx_refine_id
_refine_ls_shell.d_res_high
_refine_ls_shell.d_res_low
_refine_ls_shell.number_reflns_all
_refine_ls_shell.number_reflns_obs
_refine_ls_shell.number_reflns_R_free
_refine_ls_shell.number_reflns_R_work
_refine_ls_shell.percent_reflns_obs
_refine_ls_shell.percent_reflns_R_free
_refine_ls_shell.R_factor_all
_refine_ls_shell.R_factor_obs
_refine_ls_shell.R_factor_R_free
_refine_ls_shell.R_factor_R_free_error
_refine_ls_shell.R_factor_R_work
_refine_ls_shell.redundancy_reflns_all
_refine_ls_shell.redundancy_reflns_obs
_refine_ls_shell.wR_factor_all
_refine_ls_shell.wR_factor_obs
_refine_ls_shell.wR_factor_R_free
_refine_ls_shell.wR_factor_R_work
_refine_ls_shell.pdbx_R_complete
_refine_ls_shell.pdbx_total_number_of_bins_used
_refine_ls_shell.pdbx_phase_error
_refine_ls_shell.pdbx_fsc_work
_refine_ls_shell.pdbx_fsc_free
'X-RAY DIFFRACTION' 1.650 1.693 . . 81 1446 98.0732 . . . 0.397 . 0.365 . . . . . . . . . . .
'X-RAY DIFFRACTION' 1.693 1.739 . . 62 1452 97.4260 . . . 0.357 . 0.351 . . . . . . . . . . .
'X-RAY DIFFRACTION' 1.739 1.790 . . 67 1354 95.3691 . . . 0.410 . 0.355 . . . . . . . . . . .
'X-RAY DIFFRACTION' 1.790 1.845 . . 80 1331 97.9181 . . . 0.347 . 0.315 . . . . . . . . . . .
'X-RAY DIFFRACTION' 1.845 1.905 . . 85 1231 92.8723 . . . 0.374 . 0.347 . . . . . . . . . . .
'X-RAY DIFFRACTION' 1.905 1.972 . . 79 1154 89.4775 . . . 0.399 . 0.396 . . . . . . . . . . .
'X-RAY DIFFRACTION' 1.972 2.046 . . 74 1226 98.6343 . . . 0.342 . 0.295 . . . . . . . . . . .
'X-RAY DIFFRACTION' 2.046 2.129 . . 64 1181 98.4190 . . . 0.314 . 0.262 . . . . . . . . . . .
'X-RAY DIFFRACTION' 2.129 2.224 . . 58 1156 98.5390 . . . 0.272 . 0.268 . . . . . . . . . . .
'X-RAY DIFFRACTION' 2.224 2.332 . . 55 969 89.5888 . . . 0.345 . 0.280 . . . . . . . . . . .
'X-RAY DIFFRACTION' 2.332 2.458 . . 43 1048 97.5850 . . . 0.320 . 0.231 . . . . . . . . . . .
'X-RAY DIFFRACTION' 2.458 2.607 . . 48 965 96.4762 . . . 0.352 . 0.239 . . . . . . . . . . .
'X-RAY DIFFRACTION' 2.607 2.786 . . 40 950 99.2979 . . . 0.354 . 0.230 . . . . . . . . . . .
'X-RAY DIFFRACTION' 2.786 3.008 . . 60 860 99.5671 . . . 0.261 . 0.227 . . . . . . . . . . .
'X-RAY DIFFRACTION' 3.008 3.294 . . 52 789 99.1745 . . . 0.303 . 0.214 . . . . . . . . . . .
'X-RAY DIFFRACTION' 3.294 3.681 . . 42 714 98.8235 . . . 0.229 . 0.182 . . . . . . . . . . .
'X-RAY DIFFRACTION' 3.681 4.246 . . 34 635 98.2379 . . . 0.200 . 0.167 . . . . . . . . . . .
'X-RAY DIFFRACTION' 4.246 5.190 . . 31 516 93.8250 . . . 0.222 . 0.151 . . . . . . . . . . .
'X-RAY DIFFRACTION' 5.190 7.296 . . 20 435 100.0000 . . . 0.181 . 0.195 . . . . . . . . . . .
'X-RAY DIFFRACTION' 7.296 33.803 . . 7 251 96.2687 . . . 0.463 . 0.175 . . . . . . . . . . .
#
_struct.entry_id 7QUW
_struct.title 'CVB3-3Cpro in complex with inhibitor MG-78'
_struct.pdbx_model_details ?
_struct.pdbx_formula_weight ?
_struct.pdbx_formula_weight_method ?
_struct.pdbx_model_type_details ?
_struct.pdbx_CASP_flag N
#
_struct_keywords.entry_id 7QUW
_struct_keywords.text 'Inhibitor complex, SARS-COV2, VIRAL PROTEIN'
_struct_keywords.pdbx_keywords 'VIRAL PROTEIN'
#
loop_
_struct_asym.id
_struct_asym.pdbx_blank_PDB_chainid_flag
_struct_asym.pdbx_modified
_struct_asym.entity_id
_struct_asym.details
A N N 1 ?
B N N 2 ?
C N N 3 ?
#
_struct_ref.id 1
_struct_ref.db_name UNP
_struct_ref.db_code POLG_CXB3N
_struct_ref.pdbx_db_accession P03313
_struct_ref.pdbx_db_isoform ?
_struct_ref.entity_id 1
_struct_ref.pdbx_seq_one_letter_code
;GPAFEFAVAMMKRNSSTVKTEYGEFTMLGIYDRWAVLPRHAKPGPTILMNDQEVGVLDAKELVDKDGTNLELTLLKLNRN
EKFRDIRGFLAKEEVEVNEAVLAINTSKFPNMYIPVGQVTEYGFLNLGGTPTKRMLMYNFPTRAGQCGGVLMSTGKVLGI
HVGGNGHQGFSAALLKHYFN
;
_struct_ref.pdbx_align_begin 1541
#
_struct_ref_seq.align_id 1
_struct_ref_seq.ref_id 1
_struct_ref_seq.pdbx_PDB_id_code 7QUW
_struct_ref_seq.pdbx_strand_id AAA
_struct_ref_seq.seq_align_beg 1
_struct_ref_seq.pdbx_seq_align_beg_ins_code ?
_struct_ref_seq.seq_align_end 180
_struct_ref_seq.pdbx_seq_align_end_ins_code ?
_struct_ref_seq.pdbx_db_accession P03313
_struct_ref_seq.db_align_beg 1541
_struct_ref_seq.pdbx_db_align_beg_ins_code ?
_struct_ref_seq.db_align_end 1720
_struct_ref_seq.pdbx_db_align_end_ins_code ?
_struct_ref_seq.pdbx_auth_seq_align_beg 1
_struct_ref_seq.pdbx_auth_seq_align_end 180
#
_pdbx_struct_assembly.id 1
_pdbx_struct_assembly.details author_defined_assembly
_pdbx_struct_assembly.method_details ?
_pdbx_struct_assembly.oligomeric_details monomeric
_pdbx_struct_assembly.oligomeric_count 1
#
loop_
_pdbx_struct_assembly_prop.biol_id
_pdbx_struct_assembly_prop.type
_pdbx_struct_assembly_prop.value
_pdbx_struct_assembly_prop.details
1 'ABSA (A^2)' 0 ?
1 MORE 0 ?
1 'SSA (A^2)' 8450 ?
#
_pdbx_struct_assembly_gen.assembly_id 1
_pdbx_struct_assembly_gen.oper_expression 1
_pdbx_struct_assembly_gen.asym_id_list A,B,C
#
_pdbx_struct_assembly_auth_evidence.id 1
_pdbx_struct_assembly_auth_evidence.assembly_id 1
_pdbx_struct_assembly_auth_evidence.experimental_support none
_pdbx_struct_assembly_auth_evidence.details ?
#
_pdbx_struct_oper_list.id 1
_pdbx_struct_oper_list.type 'identity operation'
_pdbx_struct_oper_list.name 1_555
_pdbx_struct_oper_list.symmetry_operation x,y,z
_pdbx_struct_oper_list.matrix[1][1] 1.0000000000
_pdbx_struct_oper_list.matrix[1][2] 0.0000000000
_pdbx_struct_oper_list.matrix[1][3] 0.0000000000
_pdbx_struct_oper_list.vector[1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][2] 1.0000000000
_pdbx_struct_oper_list.matrix[2][3] 0.0000000000
_pdbx_struct_oper_list.vector[2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][1] 0.0000000000
_pdbx_struct_oper_list.matrix[3][2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][3] 1.0000000000
_pdbx_struct_oper_list.vector[3] 0.0000000000
#
loop_
_struct_conf.conf_type_id
_struct_conf.id
_struct_conf.pdbx_PDB_helix_id
_struct_conf.beg_label_comp_id
_struct_conf.beg_label_asym_id
_struct_conf.beg_label_seq_id
_struct_conf.pdbx_beg_PDB_ins_code
_struct_conf.end_label_comp_id
_struct_conf.end_label_asym_id
_struct_conf.end_label_seq_id
_struct_conf.pdbx_end_PDB_ins_code
_struct_conf.beg_auth_comp_id
_struct_conf.beg_auth_asym_id
_struct_conf.beg_auth_seq_id
_struct_conf.end_auth_comp_id
_struct_conf.end_auth_asym_id
_struct_conf.end_auth_seq_id
_struct_conf.pdbx_PDB_helix_class
_struct_conf.details
_struct_conf.pdbx_PDB_helix_length
HELX_P HELX_P1 AA1 GLY A 1 ? ASN A 14 ? GLY AAA 1 ASN AAA 14 1 ? 14
HELX_P HELX_P2 AA2 HIS A 40 ? LYS A 42 ? HIS AAA 40 LYS AAA 42 5 ? 3
HELX_P HELX_P3 AA3 ILE A 86 ? LEU A 90 ? ILE AAA 86 LEU AAA 90 5 ? 5
HELX_P HELX_P4 AA4 LEU A 175 ? ASN A 180 ? LEU AAA 175 ASN AAA 180 5 ? 6
#
_struct_conf_type.id HELX_P
_struct_conf_type.criteria ?
_struct_conf_type.reference ?
#
_struct_conn.id covale1
_struct_conn.conn_type_id covale
_struct_conn.pdbx_leaving_atom_flag one
_struct_conn.pdbx_PDB_id ?
_struct_conn.ptnr1_label_asym_id A
_struct_conn.ptnr1_label_comp_id CYS
_struct_conn.ptnr1_label_seq_id 147
_struct_conn.ptnr1_label_atom_id SG
_struct_conn.pdbx_ptnr1_label_alt_id ?
_struct_conn.pdbx_ptnr1_PDB_ins_code ?
_struct_conn.pdbx_ptnr1_standard_comp_id ?
_struct_conn.ptnr1_symmetry 1_555
_struct_conn.ptnr2_label_asym_id B
_struct_conn.ptnr2_label_comp_id I70
_struct_conn.ptnr2_label_seq_id .
_struct_conn.ptnr2_label_atom_id C8
_struct_conn.pdbx_ptnr2_label_alt_id ?
_struct_conn.pdbx_ptnr2_PDB_ins_code ?
_struct_conn.ptnr1_auth_asym_id AAA
_struct_conn.ptnr1_auth_comp_id CYS
_struct_conn.ptnr1_auth_seq_id 147
_struct_conn.ptnr2_auth_asym_id AAA
_struct_conn.ptnr2_auth_comp_id I70
_struct_conn.ptnr2_auth_seq_id 201
_struct_conn.ptnr2_symmetry 1_555
_struct_conn.pdbx_ptnr3_label_atom_id ?
_struct_conn.pdbx_ptnr3_label_seq_id ?
_struct_conn.pdbx_ptnr3_label_comp_id ?
_struct_conn.pdbx_ptnr3_label_asym_id ?
_struct_conn.pdbx_ptnr3_label_alt_id ?
_struct_conn.pdbx_ptnr3_PDB_ins_code ?
_struct_conn.details ?
_struct_conn.pdbx_dist_value 1.817
_struct_conn.pdbx_value_order ?
_struct_conn.pdbx_role ?
#
_struct_conn_type.id covale
_struct_conn_type.criteria ?
_struct_conn_type.reference ?
#
_pdbx_modification_feature.ordinal 1
_pdbx_modification_feature.label_comp_id I70
_pdbx_modification_feature.label_asym_id B
_pdbx_modification_feature.label_seq_id .
_pdbx_modification_feature.label_alt_id ?
_pdbx_modification_feature.modified_residue_label_comp_id CYS
_pdbx_modification_feature.modified_residue_label_asym_id A
_pdbx_modification_feature.modified_residue_label_seq_id 147
_pdbx_modification_feature.modified_residue_label_alt_id ?
_pdbx_modification_feature.auth_comp_id I70
_pdbx_modification_feature.auth_asym_id AAA
_pdbx_modification_feature.auth_seq_id 201
_pdbx_modification_feature.PDB_ins_code ?
_pdbx_modification_feature.symmetry 1_555
_pdbx_modification_feature.modified_residue_auth_comp_id CYS
_pdbx_modification_feature.modified_residue_auth_asym_id AAA
_pdbx_modification_feature.modified_residue_auth_seq_id 147
_pdbx_modification_feature.modified_residue_PDB_ins_code ?
_pdbx_modification_feature.modified_residue_symmetry 1_555
_pdbx_modification_feature.comp_id_linking_atom C8
_pdbx_modification_feature.modified_residue_id_linking_atom SG
_pdbx_modification_feature.modified_residue_id CYS
_pdbx_modification_feature.ref_pcm_id 1
_pdbx_modification_feature.ref_comp_id I70
_pdbx_modification_feature.type None
_pdbx_modification_feature.category 'Covalent chemical modification'
#
loop_
_struct_sheet.id
_struct_sheet.type
_struct_sheet.number_strands
_struct_sheet.details
AA1 ? 7 ?
AA2 ? 7 ?
#
loop_
_struct_sheet_order.sheet_id
_struct_sheet_order.range_id_1
_struct_sheet_order.range_id_2
_struct_sheet_order.offset
_struct_sheet_order.sense
AA1 1 2 ? anti-parallel
AA1 2 3 ? anti-parallel
AA1 3 4 ? anti-parallel
AA1 4 5 ? anti-parallel
AA1 5 6 ? anti-parallel
AA1 6 7 ? anti-parallel
AA2 1 2 ? anti-parallel
AA2 2 3 ? anti-parallel
AA2 3 4 ? anti-parallel
AA2 4 5 ? anti-parallel
AA2 5 6 ? anti-parallel
AA2 6 7 ? anti-parallel
#
loop_
_struct_sheet_range.sheet_id
_struct_sheet_range.id
_struct_sheet_range.beg_label_comp_id
_struct_sheet_range.beg_label_asym_id
_struct_sheet_range.beg_label_seq_id
_struct_sheet_range.pdbx_beg_PDB_ins_code
_struct_sheet_range.end_label_comp_id
_struct_sheet_range.end_label_asym_id
_struct_sheet_range.end_label_seq_id
_struct_sheet_range.pdbx_end_PDB_ins_code
_struct_sheet_range.beg_auth_comp_id
_struct_sheet_range.beg_auth_asym_id
_struct_sheet_range.beg_auth_seq_id
_struct_sheet_range.end_auth_comp_id
_struct_sheet_range.end_auth_asym_id
_struct_sheet_range.end_auth_seq_id
AA1 1 SER A 15 ? THR A 20 ? SER AAA 15 THR AAA 20
AA1 2 GLY A 23 ? TYR A 31 ? GLY AAA 23 TYR AAA 31
AA1 3 TRP A 34 ? PRO A 38 ? TRP AAA 34 PRO AAA 38
AA1 4 ASN A 69 ? ASN A 78 ? ASN AAA 69 ASN AAA 78
AA1 5 GLN A 52 ? VAL A 63 ? GLN AAA 52 VAL AAA 63
AA1 6 THR A 46 ? MET A 49 ? THR AAA 46 MET AAA 49
AA1 7 SER A 15 ? THR A 20 ? SER AAA 15 THR AAA 20
AA2 1 VAL A 97 ? ILE A 104 ? VAL AAA 97 ILE AAA 104
AA2 2 MET A 112 ? LEU A 127 ? MET AAA 112 LEU AAA 127
AA2 3 THR A 130 ? TYR A 138 ? THR AAA 130 TYR AAA 138
AA2 4 GLY A 169 ? ALA A 173 ? GLY AAA 169 ALA AAA 173
AA2 5 LYS A 156 ? GLY A 164 ? LYS AAA 156 GLY AAA 164
AA2 6 VAL A 150 ? SER A 153 ? VAL AAA 150 SER AAA 153
AA2 7 VAL A 97 ? ILE A 104 ? VAL AAA 97 ILE AAA 104
#
loop_
_pdbx_struct_sheet_hbond.sheet_id
_pdbx_struct_sheet_hbond.range_id_1
_pdbx_struct_sheet_hbond.range_id_2
_pdbx_struct_sheet_hbond.range_1_label_atom_id
_pdbx_struct_sheet_hbond.range_1_label_comp_id
_pdbx_struct_sheet_hbond.range_1_label_asym_id
_pdbx_struct_sheet_hbond.range_1_label_seq_id
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code
_pdbx_struct_sheet_hbond.range_1_auth_atom_id
_pdbx_struct_sheet_hbond.range_1_auth_comp_id
_pdbx_struct_sheet_hbond.range_1_auth_asym_id
_pdbx_struct_sheet_hbond.range_1_auth_seq_id
_pdbx_struct_sheet_hbond.range_2_label_atom_id
_pdbx_struct_sheet_hbond.range_2_label_comp_id
_pdbx_struct_sheet_hbond.range_2_label_asym_id
_pdbx_struct_sheet_hbond.range_2_label_seq_id
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code
_pdbx_struct_sheet_hbond.range_2_auth_atom_id
_pdbx_struct_sheet_hbond.range_2_auth_comp_id
_pdbx_struct_sheet_hbond.range_2_auth_asym_id
_pdbx_struct_sheet_hbond.range_2_auth_seq_id
AA1 1 2 N VAL A 18 ? N VAL AAA 18 O PHE A 25 ? O PHE AAA 25
AA1 2 3 N ILE A 30 ? N ILE AAA 30 O TRP A 34 ? O TRP AAA 34
AA1 3 4 N ALA A 35 ? N ALA AAA 35 O LEU A 75 ? O LEU AAA 75
AA1 4 5 O LEU A 72 ? O LEU AAA 72 N LEU A 62 ? N LEU AAA 62
AA1 5 6 O GLN A 52 ? O GLN AAA 52 N MET A 49 ? N MET AAA 49
AA1 6 7 O LEU A 48 ? O LEU AAA 48 N LYS A 19 ? N LYS AAA 19
AA2 1 2 N VAL A 97 ? N VAL AAA 97 O VAL A 119 ? O VAL AAA 119
AA2 2 3 N TYR A 122 ? N TYR AAA 122 O MET A 135 ? O MET AAA 135
AA2 3 4 N TYR A 138 ? N TYR AAA 138 O GLY A 169 ? O GLY AAA 169
AA2 4 5 O PHE A 170 ? O PHE AAA 170 N VAL A 162 ? N VAL AAA 162
AA2 5 6 O GLY A 159 ? O GLY AAA 159 N LEU A 151 ? N LEU AAA 151
AA2 6 7 O MET A 152 ? O MET AAA 152 N VAL A 101 ? N VAL AAA 101
#
_pdbx_entry_details.entry_id 7QUW
_pdbx_entry_details.nonpolymer_details ?
_pdbx_entry_details.sequence_details ?
_pdbx_entry_details.compound_details ?
_pdbx_entry_details.source_details ?
_pdbx_entry_details.has_ligand_of_interest Y
_pdbx_entry_details.has_protein_modification Y
#
loop_
_pdbx_validate_torsion.id
_pdbx_validate_torsion.PDB_model_num
_pdbx_validate_torsion.auth_comp_id
_pdbx_validate_torsion.auth_asym_id
_pdbx_validate_torsion.auth_seq_id
_pdbx_validate_torsion.PDB_ins_code
_pdbx_validate_torsion.label_alt_id
_pdbx_validate_torsion.phi
_pdbx_validate_torsion.psi
1 1 ASP AAA 32 ? ? 51.58 -116.66
2 1 ASP AAA 51 ? ? 75.61 -0.87
3 1 GLU AAA 71 ? ? 71.41 32.29
4 1 THR AAA 106 ? ? -120.76 -163.98
5 1 PHE AAA 109 ? ? -115.59 75.72
6 1 ASN AAA 111 ? ? 27.95 57.80
7 1 ARG AAA 134 ? ? 71.74 40.63
8 1 PRO AAA 141 ? ? -69.05 80.39
#
_pdbx_struct_special_symmetry.id 1
_pdbx_struct_special_symmetry.PDB_model_num 1
_pdbx_struct_special_symmetry.auth_asym_id AAA
_pdbx_struct_special_symmetry.auth_comp_id HOH
_pdbx_struct_special_symmetry.auth_seq_id 349
_pdbx_struct_special_symmetry.PDB_ins_code ?
_pdbx_struct_special_symmetry.label_asym_id C
_pdbx_struct_special_symmetry.label_comp_id HOH
_pdbx_struct_special_symmetry.label_seq_id .
#
loop_
_pdbx_distant_solvent_atoms.id
_pdbx_distant_solvent_atoms.PDB_model_num
_pdbx_distant_solvent_atoms.auth_atom_id
_pdbx_distant_solvent_atoms.label_alt_id
_pdbx_distant_solvent_atoms.auth_asym_id
_pdbx_distant_solvent_atoms.auth_comp_id
_pdbx_distant_solvent_atoms.auth_seq_id
_pdbx_distant_solvent_atoms.PDB_ins_code
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance
_pdbx_distant_solvent_atoms.neighbor_ligand_distance
1 1 O ? AAA HOH 351 ? 6.70 .
2 1 O ? AAA HOH 352 ? 10.30 .
#
loop_
_chem_comp_atom.comp_id
_chem_comp_atom.atom_id
_chem_comp_atom.type_symbol
_chem_comp_atom.pdbx_aromatic_flag
_chem_comp_atom.pdbx_stereo_config
_chem_comp_atom.pdbx_ordinal
ALA N N N N 1
ALA CA C N S 2
ALA C C N N 3
ALA O O N N 4
ALA CB C N N 5
ALA OXT O N N 6
ALA H H N N 7
ALA H2 H N N 8
ALA HA H N N 9
ALA HB1 H N N 10
ALA HB2 H N N 11
ALA HB3 H N N 12
ALA HXT H N N 13
ARG N N N N 14
ARG CA C N S 15
ARG C C N N 16
ARG O O N N 17
ARG CB C N N 18
ARG CG C N N 19
ARG CD C N N 20
ARG NE N N N 21
ARG CZ C N N 22
ARG NH1 N N N 23
ARG NH2 N N N 24
ARG OXT O N N 25
ARG H H N N 26
ARG H2 H N N 27
ARG HA H N N 28
ARG HB2 H N N 29
ARG HB3 H N N 30
ARG HG2 H N N 31
ARG HG3 H N N 32
ARG HD2 H N N 33
ARG HD3 H N N 34
ARG HE H N N 35
ARG HH11 H N N 36
ARG HH12 H N N 37
ARG HH21 H N N 38
ARG HH22 H N N 39
ARG HXT H N N 40
ASN N N N N 41
ASN CA C N S 42
ASN C C N N 43
ASN O O N N 44
ASN CB C N N 45
ASN CG C N N 46
ASN OD1 O N N 47
ASN ND2 N N N 48
ASN OXT O N N 49
ASN H H N N 50
ASN H2 H N N 51
ASN HA H N N 52
ASN HB2 H N N 53
ASN HB3 H N N 54
ASN HD21 H N N 55
ASN HD22 H N N 56
ASN HXT H N N 57
ASP N N N N 58
ASP CA C N S 59
ASP C C N N 60
ASP O O N N 61
ASP CB C N N 62
ASP CG C N N 63
ASP OD1 O N N 64
ASP OD2 O N N 65
ASP OXT O N N 66
ASP H H N N 67
ASP H2 H N N 68
ASP HA H N N 69
ASP HB2 H N N 70
ASP HB3 H N N 71
ASP HD2 H N N 72
ASP HXT H N N 73
CYS N N N N 74
CYS CA C N R 75
CYS C C N N 76
CYS O O N N 77
CYS CB C N N 78
CYS SG S N N 79
CYS OXT O N N 80
CYS H H N N 81
CYS H2 H N N 82
CYS HA H N N 83
CYS HB2 H N N 84
CYS HB3 H N N 85
CYS HG H N N 86
CYS HXT H N N 87
GLN N N N N 88
GLN CA C N S 89
GLN C C N N 90
GLN O O N N 91
GLN CB C N N 92
GLN CG C N N 93
GLN CD C N N 94
GLN OE1 O N N 95
GLN NE2 N N N 96
GLN OXT O N N 97
GLN H H N N 98
GLN H2 H N N 99
GLN HA H N N 100
GLN HB2 H N N 101
GLN HB3 H N N 102
GLN HG2 H N N 103
GLN HG3 H N N 104
GLN HE21 H N N 105
GLN HE22 H N N 106
GLN HXT H N N 107
GLU N N N N 108
GLU CA C N S 109
GLU C C N N 110
GLU O O N N 111
GLU CB C N N 112
GLU CG C N N 113
GLU CD C N N 114
GLU OE1 O N N 115
GLU OE2 O N N 116
GLU OXT O N N 117
GLU H H N N 118
GLU H2 H N N 119
GLU HA H N N 120
GLU HB2 H N N 121
GLU HB3 H N N 122
GLU HG2 H N N 123
GLU HG3 H N N 124
GLU HE2 H N N 125
GLU HXT H N N 126
GLY N N N N 127
GLY CA C N N 128
GLY C C N N 129
GLY O O N N 130
GLY OXT O N N 131
GLY H H N N 132
GLY H2 H N N 133
GLY HA2 H N N 134
GLY HA3 H N N 135
GLY HXT H N N 136
HIS N N N N 137
HIS CA C N S 138
HIS C C N N 139
HIS O O N N 140
HIS CB C N N 141
HIS CG C Y N 142
HIS ND1 N Y N 143
HIS CD2 C Y N 144
HIS CE1 C Y N 145
HIS NE2 N Y N 146
HIS OXT O N N 147
HIS H H N N 148
HIS H2 H N N 149
HIS HA H N N 150
HIS HB2 H N N 151
HIS HB3 H N N 152
HIS HD1 H N N 153
HIS HD2 H N N 154
HIS HE1 H N N 155
HIS HE2 H N N 156
HIS HXT H N N 157
HOH O O N N 158
HOH H1 H N N 159
HOH H2 H N N 160
I70 C1 C N N 161
I70 C11 C N S 162
I70 C12 C N N 163
I70 C13 C N N 164
I70 C14 C N S 165
I70 C15 C N N 166
I70 C16 C N S 167
I70 C17 C N S 168
I70 C18 C N N 169
I70 C19 C N N 170
I70 C20 C N S 171
I70 C21 C N N 172
I70 C22 C N N 173
I70 C23 C N N 174
I70 C24 C N N 175
I70 C25 C N N 176
I70 C26 C N N 177
I70 C27 C N N 178
I70 C28 C N N 179
I70 C29 C N N 180
I70 C30 C N N 181
I70 C31 C N N 182
I70 C32 C N N 183
I70 C34 C N R 184
I70 C7 C N N 185
I70 C8 C N R 186
I70 C9 C N N 187
I70 N10 N N N 188
I70 N13 N N N 189
I70 N16 N N N 190
I70 N2 N N N 191
I70 N23 N N N 192
I70 N8 N N N 193
I70 O26 O N N 194
I70 O29 O N N 195
I70 O33 O N N 196
I70 O38 O N N 197
I70 O5 O N N 198
I70 O9 O N N 199
I70 H1 H N N 200
I70 H2 H N N 201
I70 H3 H N N 202
I70 H4 H N N 203
I70 H5 H N N 204
I70 H6 H N N 205
I70 H7 H N N 206
I70 H8 H N N 207
I70 H9 H N N 208
I70 H10 H N N 209
I70 H11 H N N 210
I70 H12 H N N 211
I70 H13 H N N 212
I70 H14 H N N 213
I70 H15 H N N 214
I70 H16 H N N 215
I70 H17 H N N 216
I70 H18 H N N 217
I70 H19 H N N 218
I70 H20 H N N 219
I70 H21 H N N 220
I70 H22 H N N 221
I70 H23 H N N 222
I70 H24 H N N 223
I70 H25 H N N 224
I70 H26 H N N 225
I70 H27 H N N 226
I70 H28 H N N 227
I70 H29 H N N 228
I70 H30 H N N 229
I70 H31 H N N 230
I70 H32 H N N 231
I70 H33 H N N 232
I70 H34 H N N 233
I70 H35 H N N 234
I70 H36 H N N 235
I70 H37 H N N 236
I70 H38 H N N 237
I70 H39 H N N 238
I70 H40 H N N 239
I70 H41 H N N 240
I70 H42 H N N 241
I70 H43 H N N 242
I70 H44 H N N 243
I70 H45 H N N 244
I70 H46 H N N 245
ILE N N N N 246
ILE CA C N S 247
ILE C C N N 248
ILE O O N N 249
ILE CB C N S 250
ILE CG1 C N N 251
ILE CG2 C N N 252
ILE CD1 C N N 253
ILE OXT O N N 254
ILE H H N N 255
ILE H2 H N N 256
ILE HA H N N 257
ILE HB H N N 258
ILE HG12 H N N 259
ILE HG13 H N N 260
ILE HG21 H N N 261
ILE HG22 H N N 262
ILE HG23 H N N 263
ILE HD11 H N N 264
ILE HD12 H N N 265
ILE HD13 H N N 266
ILE HXT H N N 267
LEU N N N N 268
LEU CA C N S 269
LEU C C N N 270
LEU O O N N 271
LEU CB C N N 272
LEU CG C N N 273
LEU CD1 C N N 274
LEU CD2 C N N 275
LEU OXT O N N 276
LEU H H N N 277
LEU H2 H N N 278
LEU HA H N N 279
LEU HB2 H N N 280
LEU HB3 H N N 281
LEU HG H N N 282
LEU HD11 H N N 283
LEU HD12 H N N 284
LEU HD13 H N N 285
LEU HD21 H N N 286
LEU HD22 H N N 287
LEU HD23 H N N 288
LEU HXT H N N 289
LYS N N N N 290
LYS CA C N S 291
LYS C C N N 292
LYS O O N N 293
LYS CB C N N 294
LYS CG C N N 295
LYS CD C N N 296
LYS CE C N N 297
LYS NZ N N N 298
LYS OXT O N N 299
LYS H H N N 300
LYS H2 H N N 301
LYS HA H N N 302
LYS HB2 H N N 303
LYS HB3 H N N 304
LYS HG2 H N N 305
LYS HG3 H N N 306
LYS HD2 H N N 307
LYS HD3 H N N 308
LYS HE2 H N N 309
LYS HE3 H N N 310
LYS HZ1 H N N 311
LYS HZ2 H N N 312
LYS HZ3 H N N 313
LYS HXT H N N 314
MET N N N N 315
MET CA C N S 316
MET C C N N 317
MET O O N N 318
MET CB C N N 319
MET CG C N N 320
MET SD S N N 321
MET CE C N N 322
MET OXT O N N 323
MET H H N N 324
MET H2 H N N 325
MET HA H N N 326
MET HB2 H N N 327
MET HB3 H N N 328
MET HG2 H N N 329
MET HG3 H N N 330
MET HE1 H N N 331
MET HE2 H N N 332
MET HE3 H N N 333
MET HXT H N N 334
PHE N N N N 335
PHE CA C N S 336
PHE C C N N 337
PHE O O N N 338
PHE CB C N N 339
PHE CG C Y N 340
PHE CD1 C Y N 341
PHE CD2 C Y N 342
PHE CE1 C Y N 343
PHE CE2 C Y N 344
PHE CZ C Y N 345
PHE OXT O N N 346
PHE H H N N 347
PHE H2 H N N 348
PHE HA H N N 349
PHE HB2 H N N 350
PHE HB3 H N N 351
PHE HD1 H N N 352
PHE HD2 H N N 353
PHE HE1 H N N 354
PHE HE2 H N N 355
PHE HZ H N N 356
PHE HXT H N N 357
PRO N N N N 358
PRO CA C N S 359
PRO C C N N 360
PRO O O N N 361
PRO CB C N N 362
PRO CG C N N 363
PRO CD C N N 364
PRO OXT O N N 365
PRO H H N N 366
PRO HA H N N 367
PRO HB2 H N N 368
PRO HB3 H N N 369
PRO HG2 H N N 370
PRO HG3 H N N 371
PRO HD2 H N N 372
PRO HD3 H N N 373
PRO HXT H N N 374
SER N N N N 375
SER CA C N S 376
SER C C N N 377
SER O O N N 378
SER CB C N N 379
SER OG O N N 380
SER OXT O N N 381
SER H H N N 382
SER H2 H N N 383
SER HA H N N 384
SER HB2 H N N 385
SER HB3 H N N 386
SER HG H N N 387
SER HXT H N N 388
THR N N N N 389
THR CA C N S 390
THR C C N N 391
THR O O N N 392
THR CB C N R 393
THR OG1 O N N 394
THR CG2 C N N 395
THR OXT O N N 396
THR H H N N 397
THR H2 H N N 398
THR HA H N N 399
THR HB H N N 400
THR HG1 H N N 401
THR HG21 H N N 402
THR HG22 H N N 403
THR HG23 H N N 404
THR HXT H N N 405
TRP N N N N 406
TRP CA C N S 407
TRP C C N N 408
TRP O O N N 409
TRP CB C N N 410
TRP CG C Y N 411
TRP CD1 C Y N 412
TRP CD2 C Y N 413
TRP NE1 N Y N 414
TRP CE2 C Y N 415
TRP CE3 C Y N 416
TRP CZ2 C Y N 417
TRP CZ3 C Y N 418
TRP CH2 C Y N 419
TRP OXT O N N 420
TRP H H N N 421
TRP H2 H N N 422
TRP HA H N N 423
TRP HB2 H N N 424
TRP HB3 H N N 425
TRP HD1 H N N 426
TRP HE1 H N N 427
TRP HE3 H N N 428
TRP HZ2 H N N 429
TRP HZ3 H N N 430
TRP HH2 H N N 431
TRP HXT H N N 432
TYR N N N N 433
TYR CA C N S 434
TYR C C N N 435
TYR O O N N 436
TYR CB C N N 437
TYR CG C Y N 438
TYR CD1 C Y N 439
TYR CD2 C Y N 440
TYR CE1 C Y N 441
TYR CE2 C Y N 442
TYR CZ C Y N 443
TYR OH O N N 444
TYR OXT O N N 445
TYR H H N N 446
TYR H2 H N N 447
TYR HA H N N 448
TYR HB2 H N N 449
TYR HB3 H N N 450
TYR HD1 H N N 451
TYR HD2 H N N 452
TYR HE1 H N N 453
TYR HE2 H N N 454
TYR HH H N N 455
TYR HXT H N N 456
VAL N N N N 457
VAL CA C N S 458
VAL C C N N 459
VAL O O N N 460
VAL CB C N N 461
VAL CG1 C N N 462
VAL CG2 C N N 463
VAL OXT O N N 464
VAL H H N N 465
VAL H2 H N N 466
VAL HA H N N 467
VAL HB H N N 468
VAL HG11 H N N 469
VAL HG12 H N N 470
VAL HG13 H N N 471
VAL HG21 H N N 472
VAL HG22 H N N 473
VAL HG23 H N N 474
VAL HXT H N N 475
#
loop_
_chem_comp_bond.comp_id
_chem_comp_bond.atom_id_1
_chem_comp_bond.atom_id_2
_chem_comp_bond.value_order
_chem_comp_bond.pdbx_aromatic_flag
_chem_comp_bond.pdbx_stereo_config
_chem_comp_bond.pdbx_ordinal
ALA N CA sing N N 1
ALA N H sing N N 2
ALA N H2 sing N N 3
ALA CA C sing N N 4
ALA CA CB sing N N 5
ALA CA HA sing N N 6
ALA C O doub N N 7
ALA C OXT sing N N 8
ALA CB HB1 sing N N 9
ALA CB HB2 sing N N 10
ALA CB HB3 sing N N 11
ALA OXT HXT sing N N 12
ARG N CA sing N N 13
ARG N H sing N N 14
ARG N H2 sing N N 15
ARG CA C sing N N 16
ARG CA CB sing N N 17
ARG CA HA sing N N 18
ARG C O doub N N 19
ARG C OXT sing N N 20
ARG CB CG sing N N 21
ARG CB HB2 sing N N 22
ARG CB HB3 sing N N 23
ARG CG CD sing N N 24
ARG CG HG2 sing N N 25
ARG CG HG3 sing N N 26
ARG CD NE sing N N 27
ARG CD HD2 sing N N 28
ARG CD HD3 sing N N 29
ARG NE CZ sing N N 30
ARG NE HE sing N N 31
ARG CZ NH1 sing N N 32
ARG CZ NH2 doub N N 33
ARG NH1 HH11 sing N N 34
ARG NH1 HH12 sing N N 35
ARG NH2 HH21 sing N N 36
ARG NH2 HH22 sing N N 37
ARG OXT HXT sing N N 38
ASN N CA sing N N 39
ASN N H sing N N 40
ASN N H2 sing N N 41
ASN CA C sing N N 42
ASN CA CB sing N N 43
ASN CA HA sing N N 44
ASN C O doub N N 45
ASN C OXT sing N N 46
ASN CB CG sing N N 47
ASN CB HB2 sing N N 48
ASN CB HB3 sing N N 49
ASN CG OD1 doub N N 50
ASN CG ND2 sing N N 51
ASN ND2 HD21 sing N N 52
ASN ND2 HD22 sing N N 53
ASN OXT HXT sing N N 54
ASP N CA sing N N 55
ASP N H sing N N 56
ASP N H2 sing N N 57
ASP CA C sing N N 58
ASP CA CB sing N N 59
ASP CA HA sing N N 60
ASP C O doub N N 61
ASP C OXT sing N N 62
ASP CB CG sing N N 63
ASP CB HB2 sing N N 64
ASP CB HB3 sing N N 65
ASP CG OD1 doub N N 66
ASP CG OD2 sing N N 67
ASP OD2 HD2 sing N N 68
ASP OXT HXT sing N N 69
CYS N CA sing N N 70
CYS N H sing N N 71
CYS N H2 sing N N 72
CYS CA C sing N N 73
CYS CA CB sing N N 74
CYS CA HA sing N N 75
CYS C O doub N N 76
CYS C OXT sing N N 77
CYS CB SG sing N N 78
CYS CB HB2 sing N N 79
CYS CB HB3 sing N N 80
CYS SG HG sing N N 81
CYS OXT HXT sing N N 82
GLN N CA sing N N 83
GLN N H sing N N 84
GLN N H2 sing N N 85
GLN CA C sing N N 86
GLN CA CB sing N N 87
GLN CA HA sing N N 88
GLN C O doub N N 89
GLN C OXT sing N N 90
GLN CB CG sing N N 91
GLN CB HB2 sing N N 92
GLN CB HB3 sing N N 93
GLN CG CD sing N N 94
GLN CG HG2 sing N N 95
GLN CG HG3 sing N N 96
GLN CD OE1 doub N N 97
GLN CD NE2 sing N N 98
GLN NE2 HE21 sing N N 99
GLN NE2 HE22 sing N N 100
GLN OXT HXT sing N N 101
GLU N CA sing N N 102
GLU N H sing N N 103
GLU N H2 sing N N 104
GLU CA C sing N N 105
GLU CA CB sing N N 106
GLU CA HA sing N N 107
GLU C O doub N N 108
GLU C OXT sing N N 109
GLU CB CG sing N N 110
GLU CB HB2 sing N N 111
GLU CB HB3 sing N N 112
GLU CG CD sing N N 113
GLU CG HG2 sing N N 114
GLU CG HG3 sing N N 115
GLU CD OE1 doub N N 116
GLU CD OE2 sing N N 117
GLU OE2 HE2 sing N N 118
GLU OXT HXT sing N N 119
GLY N CA sing N N 120
GLY N H sing N N 121
GLY N H2 sing N N 122
GLY CA C sing N N 123
GLY CA HA2 sing N N 124
GLY CA HA3 sing N N 125
GLY C O doub N N 126
GLY C OXT sing N N 127
GLY OXT HXT sing N N 128
HIS N CA sing N N 129
HIS N H sing N N 130
HIS N H2 sing N N 131
HIS CA C sing N N 132
HIS CA CB sing N N 133
HIS CA HA sing N N 134
HIS C O doub N N 135
HIS C OXT sing N N 136
HIS CB CG sing N N 137
HIS CB HB2 sing N N 138
HIS CB HB3 sing N N 139
HIS CG ND1 sing Y N 140
HIS CG CD2 doub Y N 141
HIS ND1 CE1 doub Y N 142
HIS ND1 HD1 sing N N 143
HIS CD2 NE2 sing Y N 144
HIS CD2 HD2 sing N N 145
HIS CE1 NE2 sing Y N 146
HIS CE1 HE1 sing N N 147
HIS NE2 HE2 sing N N 148
HIS OXT HXT sing N N 149
HOH O H1 sing N N 150
HOH O H2 sing N N 151
I70 C32 C30 sing N N 152
I70 C26 C30 sing N N 153
I70 C30 C11 sing N N 154
I70 C30 C31 sing N N 155
I70 C13 C16 sing N N 156
I70 C13 N13 sing N N 157
I70 O29 C9 doub N N 158
I70 C16 C34 sing N N 159
I70 C16 C18 sing N N 160
I70 O38 C15 doub N N 161
I70 C11 N10 sing N N 162
I70 C11 C12 sing N N 163
I70 C29 C7 sing N N 164
I70 C9 N10 sing N N 165
I70 C9 N8 sing N N 166
I70 N13 C12 sing N N 167
I70 N13 C14 sing N N 168
I70 N2 C1 sing N N 169
I70 C34 C18 sing N N 170
I70 C34 C14 sing N N 171
I70 C25 C18 sing N N 172
I70 C12 O33 doub N N 173
I70 C21 C22 sing N N 174
I70 C21 C20 sing N N 175
I70 C18 C23 sing N N 176
I70 C15 C14 sing N N 177
I70 C15 N16 sing N N 178
I70 C22 N23 sing N N 179
I70 C7 N8 sing N N 180
I70 C7 C28 sing N N 181
I70 C7 C27 sing N N 182
I70 O9 C8 sing N N 183
I70 C1 C8 sing N N 184
I70 C1 O5 doub N N 185
I70 C17 N16 sing N N 186
I70 C17 C8 sing N N 187
I70 C17 C19 sing N N 188
I70 C20 C19 sing N N 189
I70 C20 C24 sing N N 190
I70 N23 C24 sing N N 191
I70 C24 O26 doub N N 192
I70 C11 H1 sing N N 193
I70 C13 H2 sing N N 194
I70 C13 H3 sing N N 195
I70 C14 H4 sing N N 196
I70 C16 H5 sing N N 197
I70 C17 H6 sing N N 198
I70 C19 H7 sing N N 199
I70 C19 H8 sing N N 200
I70 C20 H9 sing N N 201
I70 C21 H10 sing N N 202
I70 C21 H11 sing N N 203
I70 C22 H12 sing N N 204
I70 C22 H13 sing N N 205
I70 C23 H14 sing N N 206
I70 C23 H15 sing N N 207
I70 C23 H16 sing N N 208
I70 C25 H17 sing N N 209
I70 C25 H18 sing N N 210
I70 C25 H19 sing N N 211
I70 C26 H20 sing N N 212
I70 C26 H21 sing N N 213
I70 C26 H22 sing N N 214
I70 C27 H23 sing N N 215
I70 C27 H24 sing N N 216
I70 C27 H25 sing N N 217
I70 C28 H26 sing N N 218
I70 C28 H27 sing N N 219
I70 C28 H28 sing N N 220
I70 C29 H29 sing N N 221
I70 C29 H30 sing N N 222
I70 C29 H31 sing N N 223
I70 C31 H32 sing N N 224
I70 C31 H33 sing N N 225
I70 C31 H34 sing N N 226
I70 C32 H35 sing N N 227
I70 C32 H36 sing N N 228
I70 C32 H37 sing N N 229
I70 C34 H38 sing N N 230
I70 C8 H39 sing N N 231
I70 N10 H40 sing N N 232
I70 N16 H41 sing N N 233
I70 N2 H42 sing N N 234
I70 N2 H43 sing N N 235
I70 N23 H44 sing N N 236
I70 N8 H45 sing N N 237
I70 O9 H46 sing N N 238
ILE N CA sing N N 239
ILE N H sing N N 240
ILE N H2 sing N N 241
ILE CA C sing N N 242
ILE CA CB sing N N 243
ILE CA HA sing N N 244
ILE C O doub N N 245
ILE C OXT sing N N 246
ILE CB CG1 sing N N 247
ILE CB CG2 sing N N 248
ILE CB HB sing N N 249
ILE CG1 CD1 sing N N 250
ILE CG1 HG12 sing N N 251
ILE CG1 HG13 sing N N 252
ILE CG2 HG21 sing N N 253
ILE CG2 HG22 sing N N 254
ILE CG2 HG23 sing N N 255
ILE CD1 HD11 sing N N 256
ILE CD1 HD12 sing N N 257
ILE CD1 HD13 sing N N 258
ILE OXT HXT sing N N 259
LEU N CA sing N N 260
LEU N H sing N N 261
LEU N H2 sing N N 262
LEU CA C sing N N 263
LEU CA CB sing N N 264
LEU CA HA sing N N 265
LEU C O doub N N 266
LEU C OXT sing N N 267
LEU CB CG sing N N 268
LEU CB HB2 sing N N 269
LEU CB HB3 sing N N 270
LEU CG CD1 sing N N 271
LEU CG CD2 sing N N 272
LEU CG HG sing N N 273
LEU CD1 HD11 sing N N 274
LEU CD1 HD12 sing N N 275
LEU CD1 HD13 sing N N 276
LEU CD2 HD21 sing N N 277
LEU CD2 HD22 sing N N 278
LEU CD2 HD23 sing N N 279
LEU OXT HXT sing N N 280
LYS N CA sing N N 281
LYS N H sing N N 282
LYS N H2 sing N N 283
LYS CA C sing N N 284
LYS CA CB sing N N 285
LYS CA HA sing N N 286
LYS C O doub N N 287
LYS C OXT sing N N 288
LYS CB CG sing N N 289
LYS CB HB2 sing N N 290
LYS CB HB3 sing N N 291
LYS CG CD sing N N 292
LYS CG HG2 sing N N 293
LYS CG HG3 sing N N 294
LYS CD CE sing N N 295
LYS CD HD2 sing N N 296
LYS CD HD3 sing N N 297
LYS CE NZ sing N N 298
LYS CE HE2 sing N N 299
LYS CE HE3 sing N N 300
LYS NZ HZ1 sing N N 301
LYS NZ HZ2 sing N N 302
LYS NZ HZ3 sing N N 303
LYS OXT HXT sing N N 304
MET N CA sing N N 305
MET N H sing N N 306
MET N H2 sing N N 307
MET CA C sing N N 308
MET CA CB sing N N 309
MET CA HA sing N N 310
MET C O doub N N 311
MET C OXT sing N N 312
MET CB CG sing N N 313
MET CB HB2 sing N N 314
MET CB HB3 sing N N 315
MET CG SD sing N N 316
MET CG HG2 sing N N 317
MET CG HG3 sing N N 318
MET SD CE sing N N 319
MET CE HE1 sing N N 320
MET CE HE2 sing N N 321
MET CE HE3 sing N N 322
MET OXT HXT sing N N 323
PHE N CA sing N N 324
PHE N H sing N N 325
PHE N H2 sing N N 326
PHE CA C sing N N 327
PHE CA CB sing N N 328
PHE CA HA sing N N 329
PHE C O doub N N 330
PHE C OXT sing N N 331
PHE CB CG sing N N 332
PHE CB HB2 sing N N 333
PHE CB HB3 sing N N 334
PHE CG CD1 doub Y N 335
PHE CG CD2 sing Y N 336
PHE CD1 CE1 sing Y N 337
PHE CD1 HD1 sing N N 338
PHE CD2 CE2 doub Y N 339
PHE CD2 HD2 sing N N 340
PHE CE1 CZ doub Y N 341
PHE CE1 HE1 sing N N 342
PHE CE2 CZ sing Y N 343
PHE CE2 HE2 sing N N 344
PHE CZ HZ sing N N 345
PHE OXT HXT sing N N 346
PRO N CA sing N N 347
PRO N CD sing N N 348
PRO N H sing N N 349
PRO CA C sing N N 350
PRO CA CB sing N N 351
PRO CA HA sing N N 352
PRO C O doub N N 353
PRO C OXT sing N N 354
PRO CB CG sing N N 355
PRO CB HB2 sing N N 356
PRO CB HB3 sing N N 357
PRO CG CD sing N N 358
PRO CG HG2 sing N N 359
PRO CG HG3 sing N N 360
PRO CD HD2 sing N N 361
PRO CD HD3 sing N N 362
PRO OXT HXT sing N N 363
SER N CA sing N N 364
SER N H sing N N 365
SER N H2 sing N N 366
SER CA C sing N N 367
SER CA CB sing N N 368
SER CA HA sing N N 369
SER C O doub N N 370
SER C OXT sing N N 371
SER CB OG sing N N 372
SER CB HB2 sing N N 373
SER CB HB3 sing N N 374
SER OG HG sing N N 375
SER OXT HXT sing N N 376
THR N CA sing N N 377
THR N H sing N N 378
THR N H2 sing N N 379
THR CA C sing N N 380
THR CA CB sing N N 381
THR CA HA sing N N 382
THR C O doub N N 383
THR C OXT sing N N 384
THR CB OG1 sing N N 385
THR CB CG2 sing N N 386
THR CB HB sing N N 387
THR OG1 HG1 sing N N 388
THR CG2 HG21 sing N N 389
THR CG2 HG22 sing N N 390
THR CG2 HG23 sing N N 391
THR OXT HXT sing N N 392
TRP N CA sing N N 393
TRP N H sing N N 394
TRP N H2 sing N N 395
TRP CA C sing N N 396
TRP CA CB sing N N 397
TRP CA HA sing N N 398
TRP C O doub N N 399
TRP C OXT sing N N 400
TRP CB CG sing N N 401
TRP CB HB2 sing N N 402
TRP CB HB3 sing N N 403
TRP CG CD1 doub Y N 404
TRP CG CD2 sing Y N 405
TRP CD1 NE1 sing Y N 406
TRP CD1 HD1 sing N N 407
TRP CD2 CE2 doub Y N 408
TRP CD2 CE3 sing Y N 409
TRP NE1 CE2 sing Y N 410
TRP NE1 HE1 sing N N 411
TRP CE2 CZ2 sing Y N 412
TRP CE3 CZ3 doub Y N 413
TRP CE3 HE3 sing N N 414
TRP CZ2 CH2 doub Y N 415
TRP CZ2 HZ2 sing N N 416
TRP CZ3 CH2 sing Y N 417
TRP CZ3 HZ3 sing N N 418
TRP CH2 HH2 sing N N 419
TRP OXT HXT sing N N 420
TYR N CA sing N N 421
TYR N H sing N N 422
TYR N H2 sing N N 423
TYR CA C sing N N 424
TYR CA CB sing N N 425
TYR CA HA sing N N 426
TYR C O doub N N 427
TYR C OXT sing N N 428
TYR CB CG sing N N 429
TYR CB HB2 sing N N 430
TYR CB HB3 sing N N 431
TYR CG CD1 doub Y N 432
TYR CG CD2 sing Y N 433
TYR CD1 CE1 sing Y N 434
TYR CD1 HD1 sing N N 435
TYR CD2 CE2 doub Y N 436
TYR CD2 HD2 sing N N 437
TYR CE1 CZ doub Y N 438
TYR CE1 HE1 sing N N 439
TYR CE2 CZ sing Y N 440
TYR CE2 HE2 sing N N 441
TYR CZ OH sing N N 442
TYR OH HH sing N N 443
TYR OXT HXT sing N N 444
VAL N CA sing N N 445
VAL N H sing N N 446
VAL N H2 sing N N 447
VAL CA C sing N N 448
VAL CA CB sing N N 449
VAL CA HA sing N N 450
VAL C O doub N N 451
VAL C OXT sing N N 452
VAL CB CG1 sing N N 453
VAL CB CG2 sing N N 454
VAL CB HB sing N N 455
VAL CG1 HG11 sing N N 456
VAL CG1 HG12 sing N N 457
VAL CG1 HG13 sing N N 458
VAL CG2 HG21 sing N N 459
VAL CG2 HG22 sing N N 460
VAL CG2 HG23 sing N N 461
VAL OXT HXT sing N N 462
#
_pdbx_audit_support.funding_organization 'European Commission'
_pdbx_audit_support.country 'European Union'
_pdbx_audit_support.grant_number ?
_pdbx_audit_support.ordinal 1
#
_pdbx_initial_refinement_model.id 1
_pdbx_initial_refinement_model.entity_id_list ?
_pdbx_initial_refinement_model.type 'experimental model'
_pdbx_initial_refinement_model.source_name PDB
_pdbx_initial_refinement_model.accession_code 2VB0
_pdbx_initial_refinement_model.details ?
#
_atom_sites.entry_id 7QUW
_atom_sites.Cartn_transf_matrix[1][1] ?
_atom_sites.Cartn_transf_matrix[1][2] ?
_atom_sites.Cartn_transf_matrix[1][3] ?
_atom_sites.Cartn_transf_matrix[2][1] ?
_atom_sites.Cartn_transf_matrix[2][2] ?
_atom_sites.Cartn_transf_matrix[2][3] ?
_atom_sites.Cartn_transf_matrix[3][1] ?
_atom_sites.Cartn_transf_matrix[3][2] ?
_atom_sites.Cartn_transf_matrix[3][3] ?
_atom_sites.Cartn_transf_vector[1] ?
_atom_sites.Cartn_transf_vector[2] ?
_atom_sites.Cartn_transf_vector[3] ?
_atom_sites.fract_transf_matrix[1][1] 0.012776
_atom_sites.fract_transf_matrix[1][2] 0.000000
_atom_sites.fract_transf_matrix[1][3] 0.006108
_atom_sites.fract_transf_matrix[2][1] 0.000000
_atom_sites.fract_transf_matrix[2][2] 0.015555
_atom_sites.fract_transf_matrix[2][3] 0.000000
_atom_sites.fract_transf_matrix[3][1] 0.000000
_atom_sites.fract_transf_matrix[3][2] 0.000000
_atom_sites.fract_transf_matrix[3][3] 0.027815
_atom_sites.fract_transf_vector[1] 0.00000
_atom_sites.fract_transf_vector[2] 0.00000
_atom_sites.fract_transf_vector[3] 0.00000
_atom_sites.solution_primary ?
_atom_sites.solution_secondary ?
_atom_sites.solution_hydrogens ?
_atom_sites.special_details ?
#
loop_
_atom_type.symbol
_atom_type.pdbx_scat_Z
_atom_type.pdbx_N_electrons
_atom_type.scat_Cromer_Mann_a1
_atom_type.scat_Cromer_Mann_b1
_atom_type.scat_Cromer_Mann_a2
_atom_type.scat_Cromer_Mann_b2
_atom_type.scat_Cromer_Mann_a3
_atom_type.scat_Cromer_Mann_b3
_atom_type.scat_Cromer_Mann_a4
_atom_type.scat_Cromer_Mann_b4
_atom_type.scat_Cromer_Mann_c
C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216
H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003
N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538
O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251
S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.065
#
loop_