data_7QUW # _entry.id 7QUW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7QUW pdb_00007quw 10.2210/pdb7quw/pdb WWPDB D_1292120327 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-03-09 2 'Structure model' 1 1 2022-10-05 3 'Structure model' 1 2 2024-01-31 4 'Structure model' 1 3 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_type 2 2 'Structure model' citation 3 2 'Structure model' citation_author 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' pdbx_initial_refinement_model 7 4 'Structure model' pdbx_entry_details 8 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_type.pdbx_N_electrons' 2 2 'Structure model' '_atom_type.pdbx_scat_Z' 3 2 'Structure model' '_citation.country' 4 2 'Structure model' '_citation.journal_abbrev' 5 2 'Structure model' '_citation.journal_id_CSD' 6 2 'Structure model' '_citation.journal_id_ISSN' 7 2 'Structure model' '_citation.journal_volume' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7QUW _pdbx_database_status.recvd_initial_deposition_date 2022-01-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email rolf.hilgenfeld@uni-luebeck.de _pdbx_contact_author.name_first Rolf _pdbx_contact_author.name_last 'Prof. Dr. Dr. Hilgenfeld' _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-8850-2977 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhang, L.' 1 0000-0003-4084-3582 'Hilgenfeld, R.' 2 0000-0001-8850-2977 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Molecules _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1420-3049 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'From Repurposing to Redesign: Optimization of Boceprevir to Highly Potent Inhibitors of the SARS-CoV-2 Main Protease.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/molecules27134292 _citation.pdbx_database_id_PubMed 35807537 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gohl, M.' 1 ? primary 'Zhang, L.' 2 ? primary 'El Kilani, H.' 3 ? primary 'Sun, X.' 4 ? primary 'Zhang, K.' 5 ? primary 'Bronstrup, M.' 6 0000-0002-8971-7045 primary 'Hilgenfeld, R.' 7 0000-0001-8850-2977 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protease 3C' 19925.961 1 3.4.22.28 ? ? ? 2 non-polymer syn ;(1R,2S,5S)-N-{(2S,3R)-4-amino-3-hydroxy-4-oxo-1-[(3S)-2-oxopyrrolidin-3-yl]butan-2-yl}-3-[N-(tert-butylcarbamoyl)-3-methyl-L-valyl]-6,6-dimethyl-3-azabicyclo[3.1.0]hexane-2-carboxamide ; 550.691 1 ? ? ? ? 3 water nat water 18.015 52 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Picornain 3C,P3C' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPAFEFAVAMMKRNSSTVKTEYGEFTMLGIYDRWAVLPRHAKPGPTILMNDQEVGVLDAKELVDKDGTNLELTLLKLNRN EKFRDIRGFLAKEEVEVNEAVLAINTSKFPNMYIPVGQVTEYGFLNLGGTPTKRMLMYNFPTRAGQCGGVLMSTGKVLGI HVGGNGHQGFSAALLKHYFN ; _entity_poly.pdbx_seq_one_letter_code_can ;GPAFEFAVAMMKRNSSTVKTEYGEFTMLGIYDRWAVLPRHAKPGPTILMNDQEVGVLDAKELVDKDGTNLELTLLKLNRN EKFRDIRGFLAKEEVEVNEAVLAINTSKFPNMYIPVGQVTEYGFLNLGGTPTKRMLMYNFPTRAGQCGGVLMSTGKVLGI HVGGNGHQGFSAALLKHYFN ; _entity_poly.pdbx_strand_id AAA _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(1R,2S,5S)-N-{(2S,3R)-4-amino-3-hydroxy-4-oxo-1-[(3S)-2-oxopyrrolidin-3-yl]butan-2-yl}-3-[N-(tert-butylcarbamoyl)-3-methyl-L-valyl]-6,6-dimethyl-3-azabicyclo[3.1.0]hexane-2-carboxamide ; I70 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 ALA n 1 4 PHE n 1 5 GLU n 1 6 PHE n 1 7 ALA n 1 8 VAL n 1 9 ALA n 1 10 MET n 1 11 MET n 1 12 LYS n 1 13 ARG n 1 14 ASN n 1 15 SER n 1 16 SER n 1 17 THR n 1 18 VAL n 1 19 LYS n 1 20 THR n 1 21 GLU n 1 22 TYR n 1 23 GLY n 1 24 GLU n 1 25 PHE n 1 26 THR n 1 27 MET n 1 28 LEU n 1 29 GLY n 1 30 ILE n 1 31 TYR n 1 32 ASP n 1 33 ARG n 1 34 TRP n 1 35 ALA n 1 36 VAL n 1 37 LEU n 1 38 PRO n 1 39 ARG n 1 40 HIS n 1 41 ALA n 1 42 LYS n 1 43 PRO n 1 44 GLY n 1 45 PRO n 1 46 THR n 1 47 ILE n 1 48 LEU n 1 49 MET n 1 50 ASN n 1 51 ASP n 1 52 GLN n 1 53 GLU n 1 54 VAL n 1 55 GLY n 1 56 VAL n 1 57 LEU n 1 58 ASP n 1 59 ALA n 1 60 LYS n 1 61 GLU n 1 62 LEU n 1 63 VAL n 1 64 ASP n 1 65 LYS n 1 66 ASP n 1 67 GLY n 1 68 THR n 1 69 ASN n 1 70 LEU n 1 71 GLU n 1 72 LEU n 1 73 THR n 1 74 LEU n 1 75 LEU n 1 76 LYS n 1 77 LEU n 1 78 ASN n 1 79 ARG n 1 80 ASN n 1 81 GLU n 1 82 LYS n 1 83 PHE n 1 84 ARG n 1 85 ASP n 1 86 ILE n 1 87 ARG n 1 88 GLY n 1 89 PHE n 1 90 LEU n 1 91 ALA n 1 92 LYS n 1 93 GLU n 1 94 GLU n 1 95 VAL n 1 96 GLU n 1 97 VAL n 1 98 ASN n 1 99 GLU n 1 100 ALA n 1 101 VAL n 1 102 LEU n 1 103 ALA n 1 104 ILE n 1 105 ASN n 1 106 THR n 1 107 SER n 1 108 LYS n 1 109 PHE n 1 110 PRO n 1 111 ASN n 1 112 MET n 1 113 TYR n 1 114 ILE n 1 115 PRO n 1 116 VAL n 1 117 GLY n 1 118 GLN n 1 119 VAL n 1 120 THR n 1 121 GLU n 1 122 TYR n 1 123 GLY n 1 124 PHE n 1 125 LEU n 1 126 ASN n 1 127 LEU n 1 128 GLY n 1 129 GLY n 1 130 THR n 1 131 PRO n 1 132 THR n 1 133 LYS n 1 134 ARG n 1 135 MET n 1 136 LEU n 1 137 MET n 1 138 TYR n 1 139 ASN n 1 140 PHE n 1 141 PRO n 1 142 THR n 1 143 ARG n 1 144 ALA n 1 145 GLY n 1 146 GLN n 1 147 CYS n 1 148 GLY n 1 149 GLY n 1 150 VAL n 1 151 LEU n 1 152 MET n 1 153 SER n 1 154 THR n 1 155 GLY n 1 156 LYS n 1 157 VAL n 1 158 LEU n 1 159 GLY n 1 160 ILE n 1 161 HIS n 1 162 VAL n 1 163 GLY n 1 164 GLY n 1 165 ASN n 1 166 GLY n 1 167 HIS n 1 168 GLN n 1 169 GLY n 1 170 PHE n 1 171 SER n 1 172 ALA n 1 173 ALA n 1 174 LEU n 1 175 LEU n 1 176 LYS n 1 177 HIS n 1 178 TYR n 1 179 PHE n 1 180 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 180 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Coxsackievirus B3' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 12072 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 I70 non-polymer . ;(1R,2S,5S)-N-{(2S,3R)-4-amino-3-hydroxy-4-oxo-1-[(3S)-2-oxopyrrolidin-3-yl]butan-2-yl}-3-[N-(tert-butylcarbamoyl)-3-methyl-L-valyl]-6,6-dimethyl-3-azabicyclo[3.1.0]hexane-2-carboxamide ; ? 'C27 H46 N6 O6' 550.691 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY AAA . n A 1 2 PRO 2 2 2 PRO PRO AAA . n A 1 3 ALA 3 3 3 ALA ALA AAA . n A 1 4 PHE 4 4 4 PHE PHE AAA . n A 1 5 GLU 5 5 5 GLU GLU AAA . n A 1 6 PHE 6 6 6 PHE PHE AAA . n A 1 7 ALA 7 7 7 ALA ALA AAA . n A 1 8 VAL 8 8 8 VAL VAL AAA . n A 1 9 ALA 9 9 9 ALA ALA AAA . n A 1 10 MET 10 10 10 MET MET AAA . n A 1 11 MET 11 11 11 MET MET AAA . n A 1 12 LYS 12 12 12 LYS LYS AAA . n A 1 13 ARG 13 13 13 ARG ARG AAA . n A 1 14 ASN 14 14 14 ASN ASN AAA . n A 1 15 SER 15 15 15 SER SER AAA . n A 1 16 SER 16 16 16 SER SER AAA . n A 1 17 THR 17 17 17 THR THR AAA . n A 1 18 VAL 18 18 18 VAL VAL AAA . n A 1 19 LYS 19 19 19 LYS LYS AAA . n A 1 20 THR 20 20 20 THR THR AAA . n A 1 21 GLU 21 21 21 GLU GLU AAA . n A 1 22 TYR 22 22 22 TYR TYR AAA . n A 1 23 GLY 23 23 23 GLY GLY AAA . n A 1 24 GLU 24 24 24 GLU GLU AAA . n A 1 25 PHE 25 25 25 PHE PHE AAA . n A 1 26 THR 26 26 26 THR THR AAA . n A 1 27 MET 27 27 27 MET MET AAA . n A 1 28 LEU 28 28 28 LEU LEU AAA . n A 1 29 GLY 29 29 29 GLY GLY AAA . n A 1 30 ILE 30 30 30 ILE ILE AAA . n A 1 31 TYR 31 31 31 TYR TYR AAA . n A 1 32 ASP 32 32 32 ASP ASP AAA . n A 1 33 ARG 33 33 33 ARG ARG AAA . n A 1 34 TRP 34 34 34 TRP TRP AAA . n A 1 35 ALA 35 35 35 ALA ALA AAA . n A 1 36 VAL 36 36 36 VAL VAL AAA . n A 1 37 LEU 37 37 37 LEU LEU AAA . n A 1 38 PRO 38 38 38 PRO PRO AAA . n A 1 39 ARG 39 39 39 ARG ARG AAA . n A 1 40 HIS 40 40 40 HIS HIS AAA . n A 1 41 ALA 41 41 41 ALA ALA AAA . n A 1 42 LYS 42 42 42 LYS LYS AAA . n A 1 43 PRO 43 43 43 PRO PRO AAA . n A 1 44 GLY 44 44 44 GLY GLY AAA . n A 1 45 PRO 45 45 45 PRO PRO AAA . n A 1 46 THR 46 46 46 THR THR AAA . n A 1 47 ILE 47 47 47 ILE ILE AAA . n A 1 48 LEU 48 48 48 LEU LEU AAA . n A 1 49 MET 49 49 49 MET MET AAA . n A 1 50 ASN 50 50 50 ASN ASN AAA . n A 1 51 ASP 51 51 51 ASP ASP AAA . n A 1 52 GLN 52 52 52 GLN GLN AAA . n A 1 53 GLU 53 53 53 GLU GLU AAA . n A 1 54 VAL 54 54 54 VAL VAL AAA . n A 1 55 GLY 55 55 55 GLY GLY AAA . n A 1 56 VAL 56 56 56 VAL VAL AAA . n A 1 57 LEU 57 57 57 LEU LEU AAA . n A 1 58 ASP 58 58 58 ASP ASP AAA . n A 1 59 ALA 59 59 59 ALA ALA AAA . n A 1 60 LYS 60 60 60 LYS LYS AAA . n A 1 61 GLU 61 61 61 GLU GLU AAA . n A 1 62 LEU 62 62 62 LEU LEU AAA . n A 1 63 VAL 63 63 63 VAL VAL AAA . n A 1 64 ASP 64 64 64 ASP ASP AAA . n A 1 65 LYS 65 65 65 LYS LYS AAA . n A 1 66 ASP 66 66 66 ASP ASP AAA . n A 1 67 GLY 67 67 67 GLY GLY AAA . n A 1 68 THR 68 68 68 THR THR AAA . n A 1 69 ASN 69 69 69 ASN ASN AAA . n A 1 70 LEU 70 70 70 LEU LEU AAA . n A 1 71 GLU 71 71 71 GLU GLU AAA . n A 1 72 LEU 72 72 72 LEU LEU AAA . n A 1 73 THR 73 73 73 THR THR AAA . n A 1 74 LEU 74 74 74 LEU LEU AAA . n A 1 75 LEU 75 75 75 LEU LEU AAA . n A 1 76 LYS 76 76 76 LYS LYS AAA . n A 1 77 LEU 77 77 77 LEU LEU AAA . n A 1 78 ASN 78 78 78 ASN ASN AAA . n A 1 79 ARG 79 79 79 ARG ARG AAA . n A 1 80 ASN 80 80 80 ASN ASN AAA . n A 1 81 GLU 81 81 81 GLU GLU AAA . n A 1 82 LYS 82 82 82 LYS LYS AAA . n A 1 83 PHE 83 83 83 PHE PHE AAA . n A 1 84 ARG 84 84 84 ARG ARG AAA . n A 1 85 ASP 85 85 85 ASP ASP AAA . n A 1 86 ILE 86 86 86 ILE ILE AAA . n A 1 87 ARG 87 87 87 ARG ARG AAA . n A 1 88 GLY 88 88 88 GLY GLY AAA . n A 1 89 PHE 89 89 89 PHE PHE AAA . n A 1 90 LEU 90 90 90 LEU LEU AAA . n A 1 91 ALA 91 91 91 ALA ALA AAA . n A 1 92 LYS 92 92 92 LYS LYS AAA . n A 1 93 GLU 93 93 93 GLU GLU AAA . n A 1 94 GLU 94 94 94 GLU GLU AAA . n A 1 95 VAL 95 95 95 VAL VAL AAA . n A 1 96 GLU 96 96 96 GLU GLU AAA . n A 1 97 VAL 97 97 97 VAL VAL AAA . n A 1 98 ASN 98 98 98 ASN ASN AAA . n A 1 99 GLU 99 99 99 GLU GLU AAA . n A 1 100 ALA 100 100 100 ALA ALA AAA . n A 1 101 VAL 101 101 101 VAL VAL AAA . n A 1 102 LEU 102 102 102 LEU LEU AAA . n A 1 103 ALA 103 103 103 ALA ALA AAA . n A 1 104 ILE 104 104 104 ILE ILE AAA . n A 1 105 ASN 105 105 105 ASN ASN AAA . n A 1 106 THR 106 106 106 THR THR AAA . n A 1 107 SER 107 107 107 SER SER AAA . n A 1 108 LYS 108 108 108 LYS LYS AAA . n A 1 109 PHE 109 109 109 PHE PHE AAA . n A 1 110 PRO 110 110 110 PRO PRO AAA . n A 1 111 ASN 111 111 111 ASN ASN AAA . n A 1 112 MET 112 112 112 MET MET AAA . n A 1 113 TYR 113 113 113 TYR TYR AAA . n A 1 114 ILE 114 114 114 ILE ILE AAA . n A 1 115 PRO 115 115 115 PRO PRO AAA . n A 1 116 VAL 116 116 116 VAL VAL AAA . n A 1 117 GLY 117 117 117 GLY GLY AAA . n A 1 118 GLN 118 118 118 GLN GLN AAA . n A 1 119 VAL 119 119 119 VAL VAL AAA . n A 1 120 THR 120 120 120 THR THR AAA . n A 1 121 GLU 121 121 121 GLU GLU AAA . n A 1 122 TYR 122 122 122 TYR TYR AAA . n A 1 123 GLY 123 123 123 GLY GLY AAA . n A 1 124 PHE 124 124 124 PHE PHE AAA . n A 1 125 LEU 125 125 125 LEU LEU AAA . n A 1 126 ASN 126 126 126 ASN ASN AAA . n A 1 127 LEU 127 127 127 LEU LEU AAA . n A 1 128 GLY 128 128 128 GLY GLY AAA . n A 1 129 GLY 129 129 129 GLY GLY AAA . n A 1 130 THR 130 130 130 THR THR AAA . n A 1 131 PRO 131 131 131 PRO PRO AAA . n A 1 132 THR 132 132 132 THR THR AAA . n A 1 133 LYS 133 133 133 LYS LYS AAA . n A 1 134 ARG 134 134 134 ARG ARG AAA . n A 1 135 MET 135 135 135 MET MET AAA . n A 1 136 LEU 136 136 136 LEU LEU AAA . n A 1 137 MET 137 137 137 MET MET AAA . n A 1 138 TYR 138 138 138 TYR TYR AAA . n A 1 139 ASN 139 139 139 ASN ASN AAA . n A 1 140 PHE 140 140 140 PHE PHE AAA . n A 1 141 PRO 141 141 141 PRO PRO AAA . n A 1 142 THR 142 142 142 THR THR AAA . n A 1 143 ARG 143 143 143 ARG ARG AAA . n A 1 144 ALA 144 144 144 ALA ALA AAA . n A 1 145 GLY 145 145 145 GLY GLY AAA . n A 1 146 GLN 146 146 146 GLN GLN AAA . n A 1 147 CYS 147 147 147 CYS CYS AAA . n A 1 148 GLY 148 148 148 GLY GLY AAA . n A 1 149 GLY 149 149 149 GLY GLY AAA . n A 1 150 VAL 150 150 150 VAL VAL AAA . n A 1 151 LEU 151 151 151 LEU LEU AAA . n A 1 152 MET 152 152 152 MET MET AAA . n A 1 153 SER 153 153 153 SER SER AAA . n A 1 154 THR 154 154 154 THR THR AAA . n A 1 155 GLY 155 155 155 GLY GLY AAA . n A 1 156 LYS 156 156 156 LYS LYS AAA . n A 1 157 VAL 157 157 157 VAL VAL AAA . n A 1 158 LEU 158 158 158 LEU LEU AAA . n A 1 159 GLY 159 159 159 GLY GLY AAA . n A 1 160 ILE 160 160 160 ILE ILE AAA . n A 1 161 HIS 161 161 161 HIS HIS AAA . n A 1 162 VAL 162 162 162 VAL VAL AAA . n A 1 163 GLY 163 163 163 GLY GLY AAA . n A 1 164 GLY 164 164 164 GLY GLY AAA . n A 1 165 ASN 165 165 165 ASN ASN AAA . n A 1 166 GLY 166 166 166 GLY GLY AAA . n A 1 167 HIS 167 167 167 HIS HIS AAA . n A 1 168 GLN 168 168 168 GLN GLN AAA . n A 1 169 GLY 169 169 169 GLY GLY AAA . n A 1 170 PHE 170 170 170 PHE PHE AAA . n A 1 171 SER 171 171 171 SER SER AAA . n A 1 172 ALA 172 172 172 ALA ALA AAA . n A 1 173 ALA 173 173 173 ALA ALA AAA . n A 1 174 LEU 174 174 174 LEU LEU AAA . n A 1 175 LEU 175 175 175 LEU LEU AAA . n A 1 176 LYS 176 176 176 LYS LYS AAA . n A 1 177 HIS 177 177 177 HIS HIS AAA . n A 1 178 TYR 178 178 178 TYR TYR AAA . n A 1 179 PHE 179 179 179 PHE PHE AAA . n A 1 180 ASN 180 180 180 ASN ASN AAA . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 I70 1 201 201 I70 G87 AAA . C 3 HOH 1 301 7 HOH HOH AAA . C 3 HOH 2 302 13 HOH HOH AAA . C 3 HOH 3 303 56 HOH HOH AAA . C 3 HOH 4 304 57 HOH HOH AAA . C 3 HOH 5 305 36 HOH HOH AAA . C 3 HOH 6 306 17 HOH HOH AAA . C 3 HOH 7 307 44 HOH HOH AAA . C 3 HOH 8 308 43 HOH HOH AAA . C 3 HOH 9 309 31 HOH HOH AAA . C 3 HOH 10 310 2 HOH HOH AAA . C 3 HOH 11 311 59 HOH HOH AAA . C 3 HOH 12 312 8 HOH HOH AAA . C 3 HOH 13 313 54 HOH HOH AAA . C 3 HOH 14 314 3 HOH HOH AAA . C 3 HOH 15 315 52 HOH HOH AAA . C 3 HOH 16 316 46 HOH HOH AAA . C 3 HOH 17 317 39 HOH HOH AAA . C 3 HOH 18 318 12 HOH HOH AAA . C 3 HOH 19 319 5 HOH HOH AAA . C 3 HOH 20 320 16 HOH HOH AAA . C 3 HOH 21 321 1 HOH HOH AAA . C 3 HOH 22 322 48 HOH HOH AAA . C 3 HOH 23 323 34 HOH HOH AAA . C 3 HOH 24 324 37 HOH HOH AAA . C 3 HOH 25 325 6 HOH HOH AAA . C 3 HOH 26 326 23 HOH HOH AAA . C 3 HOH 27 327 10 HOH HOH AAA . C 3 HOH 28 328 50 HOH HOH AAA . C 3 HOH 29 329 14 HOH HOH AAA . C 3 HOH 30 330 4 HOH HOH AAA . C 3 HOH 31 331 51 HOH HOH AAA . C 3 HOH 32 332 55 HOH HOH AAA . C 3 HOH 33 333 40 HOH HOH AAA . C 3 HOH 34 334 58 HOH HOH AAA . C 3 HOH 35 335 53 HOH HOH AAA . C 3 HOH 36 336 9 HOH HOH AAA . C 3 HOH 37 337 35 HOH HOH AAA . C 3 HOH 38 338 47 HOH HOH AAA . C 3 HOH 39 339 32 HOH HOH AAA . C 3 HOH 40 340 49 HOH HOH AAA . C 3 HOH 41 341 22 HOH HOH AAA . C 3 HOH 42 342 33 HOH HOH AAA . C 3 HOH 43 343 42 HOH HOH AAA . C 3 HOH 44 344 26 HOH HOH AAA . C 3 HOH 45 345 30 HOH HOH AAA . C 3 HOH 46 346 18 HOH HOH AAA . C 3 HOH 47 347 24 HOH HOH AAA . C 3 HOH 48 348 27 HOH HOH AAA . C 3 HOH 49 349 25 HOH HOH AAA . C 3 HOH 50 350 38 HOH HOH AAA . C 3 HOH 51 351 19 HOH HOH AAA . C 3 HOH 52 352 41 HOH HOH AAA . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 AAA PHE 124 ? CG ? A PHE 124 CG 2 1 Y 1 AAA PHE 124 ? CD1 ? A PHE 124 CD1 3 1 Y 1 AAA PHE 124 ? CD2 ? A PHE 124 CD2 4 1 Y 1 AAA PHE 124 ? CE1 ? A PHE 124 CE1 5 1 Y 1 AAA PHE 124 ? CE2 ? A PHE 124 CE2 6 1 Y 1 AAA PHE 124 ? CZ ? A PHE 124 CZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 115.553 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7QUW _cell.details ? _cell.formula_units_Z ? _cell.length_a 78.271 _cell.length_a_esd ? _cell.length_b 64.290 _cell.length_b_esd ? _cell.length_c 39.850 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7QUW _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7QUW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.27 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 M MgCl2 0.1M Tris-HCl pH 8.6 25% PEG 3350 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-06-22 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0332 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, DESY BEAMLINE P11' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0332 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline P11 _diffrn_source.pdbx_synchrotron_site 'PETRA III, DESY' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7QUW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.65 _reflns.d_resolution_low 35.95 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 43026 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.65 _reflns_shell.d_res_low 1.74 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 6281 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.874 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -1.265 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 2.498 _refine.aniso_B[2][2] -3.518 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] 1.643 _refine.B_iso_max ? _refine.B_iso_mean 50.522 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.967 _refine.correlation_coeff_Fo_to_Fc_free 0.939 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7QUW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.650 _refine.ls_d_res_low 33.803 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20746 _refine.ls_number_reflns_R_free 1082 _refine.ls_number_reflns_R_work 19664 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.560 _refine.ls_percent_reflns_R_free 5.215 _refine.ls_R_factor_all 0.222 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2791 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2192 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2VB0 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.122 _refine.pdbx_overall_ESU_R_Free 0.130 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 5.218 _refine.overall_SU_ML 0.157 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.650 _refine_hist.d_res_low 33.803 _refine_hist.number_atoms_solvent 52 _refine_hist.number_atoms_total 1483 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1392 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.013 1462 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1420 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.612 1.657 1981 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.221 1.584 3261 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.601 5.000 179 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 31.913 21.733 75 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.605 15.000 248 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 0.400 15.000 1 ? r_dihedral_angle_other_3_deg ? ? 'X-RAY DIFFRACTION' ? 12.541 15.000 8 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.320 0.200 188 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1650 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 330 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.216 0.200 240 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.175 0.200 1334 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.160 0.200 677 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.075 0.200 765 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.193 0.200 53 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.011 0.200 1 ? r_symmetry_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.166 0.200 8 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.166 0.200 35 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.179 0.200 3 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 4.181 5.054 719 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.179 5.051 718 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 5.630 7.576 897 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 5.627 7.579 898 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 4.425 5.597 741 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.422 5.598 742 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 6.474 8.228 1080 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 6.471 8.229 1081 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 8.252 58.967 1493 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 8.251 59.014 1493 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.650 1.693 . . 81 1446 98.0732 . . . 0.397 . 0.365 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.693 1.739 . . 62 1452 97.4260 . . . 0.357 . 0.351 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.739 1.790 . . 67 1354 95.3691 . . . 0.410 . 0.355 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.790 1.845 . . 80 1331 97.9181 . . . 0.347 . 0.315 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.845 1.905 . . 85 1231 92.8723 . . . 0.374 . 0.347 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.905 1.972 . . 79 1154 89.4775 . . . 0.399 . 0.396 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.972 2.046 . . 74 1226 98.6343 . . . 0.342 . 0.295 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.046 2.129 . . 64 1181 98.4190 . . . 0.314 . 0.262 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.129 2.224 . . 58 1156 98.5390 . . . 0.272 . 0.268 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.224 2.332 . . 55 969 89.5888 . . . 0.345 . 0.280 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.332 2.458 . . 43 1048 97.5850 . . . 0.320 . 0.231 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.458 2.607 . . 48 965 96.4762 . . . 0.352 . 0.239 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.607 2.786 . . 40 950 99.2979 . . . 0.354 . 0.230 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.786 3.008 . . 60 860 99.5671 . . . 0.261 . 0.227 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.008 3.294 . . 52 789 99.1745 . . . 0.303 . 0.214 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.294 3.681 . . 42 714 98.8235 . . . 0.229 . 0.182 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.681 4.246 . . 34 635 98.2379 . . . 0.200 . 0.167 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.246 5.190 . . 31 516 93.8250 . . . 0.222 . 0.151 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.190 7.296 . . 20 435 100.0000 . . . 0.181 . 0.195 . . . . . . . . . . . 'X-RAY DIFFRACTION' 7.296 33.803 . . 7 251 96.2687 . . . 0.463 . 0.175 . . . . . . . . . . . # _struct.entry_id 7QUW _struct.title 'CVB3-3Cpro in complex with inhibitor MG-78' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7QUW _struct_keywords.text 'Inhibitor complex, SARS-COV2, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POLG_CXB3N _struct_ref.pdbx_db_accession P03313 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GPAFEFAVAMMKRNSSTVKTEYGEFTMLGIYDRWAVLPRHAKPGPTILMNDQEVGVLDAKELVDKDGTNLELTLLKLNRN EKFRDIRGFLAKEEVEVNEAVLAINTSKFPNMYIPVGQVTEYGFLNLGGTPTKRMLMYNFPTRAGQCGGVLMSTGKVLGI HVGGNGHQGFSAALLKHYFN ; _struct_ref.pdbx_align_begin 1541 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7QUW _struct_ref_seq.pdbx_strand_id AAA _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 180 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03313 _struct_ref_seq.db_align_beg 1541 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1720 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 180 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8450 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 1 ? ASN A 14 ? GLY AAA 1 ASN AAA 14 1 ? 14 HELX_P HELX_P2 AA2 HIS A 40 ? LYS A 42 ? HIS AAA 40 LYS AAA 42 5 ? 3 HELX_P HELX_P3 AA3 ILE A 86 ? LEU A 90 ? ILE AAA 86 LEU AAA 90 5 ? 5 HELX_P HELX_P4 AA4 LEU A 175 ? ASN A 180 ? LEU AAA 175 ASN AAA 180 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 147 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id I70 _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C8 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id AAA _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 147 _struct_conn.ptnr2_auth_asym_id AAA _struct_conn.ptnr2_auth_comp_id I70 _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.817 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id I70 _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 147 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id I70 _pdbx_modification_feature.auth_asym_id AAA _pdbx_modification_feature.auth_seq_id 201 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id AAA _pdbx_modification_feature.modified_residue_auth_seq_id 147 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C8 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id I70 _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 15 ? THR A 20 ? SER AAA 15 THR AAA 20 AA1 2 GLY A 23 ? TYR A 31 ? GLY AAA 23 TYR AAA 31 AA1 3 TRP A 34 ? PRO A 38 ? TRP AAA 34 PRO AAA 38 AA1 4 ASN A 69 ? ASN A 78 ? ASN AAA 69 ASN AAA 78 AA1 5 GLN A 52 ? VAL A 63 ? GLN AAA 52 VAL AAA 63 AA1 6 THR A 46 ? MET A 49 ? THR AAA 46 MET AAA 49 AA1 7 SER A 15 ? THR A 20 ? SER AAA 15 THR AAA 20 AA2 1 VAL A 97 ? ILE A 104 ? VAL AAA 97 ILE AAA 104 AA2 2 MET A 112 ? LEU A 127 ? MET AAA 112 LEU AAA 127 AA2 3 THR A 130 ? TYR A 138 ? THR AAA 130 TYR AAA 138 AA2 4 GLY A 169 ? ALA A 173 ? GLY AAA 169 ALA AAA 173 AA2 5 LYS A 156 ? GLY A 164 ? LYS AAA 156 GLY AAA 164 AA2 6 VAL A 150 ? SER A 153 ? VAL AAA 150 SER AAA 153 AA2 7 VAL A 97 ? ILE A 104 ? VAL AAA 97 ILE AAA 104 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 18 ? N VAL AAA 18 O PHE A 25 ? O PHE AAA 25 AA1 2 3 N ILE A 30 ? N ILE AAA 30 O TRP A 34 ? O TRP AAA 34 AA1 3 4 N ALA A 35 ? N ALA AAA 35 O LEU A 75 ? O LEU AAA 75 AA1 4 5 O LEU A 72 ? O LEU AAA 72 N LEU A 62 ? N LEU AAA 62 AA1 5 6 O GLN A 52 ? O GLN AAA 52 N MET A 49 ? N MET AAA 49 AA1 6 7 O LEU A 48 ? O LEU AAA 48 N LYS A 19 ? N LYS AAA 19 AA2 1 2 N VAL A 97 ? N VAL AAA 97 O VAL A 119 ? O VAL AAA 119 AA2 2 3 N TYR A 122 ? N TYR AAA 122 O MET A 135 ? O MET AAA 135 AA2 3 4 N TYR A 138 ? N TYR AAA 138 O GLY A 169 ? O GLY AAA 169 AA2 4 5 O PHE A 170 ? O PHE AAA 170 N VAL A 162 ? N VAL AAA 162 AA2 5 6 O GLY A 159 ? O GLY AAA 159 N LEU A 151 ? N LEU AAA 151 AA2 6 7 O MET A 152 ? O MET AAA 152 N VAL A 101 ? N VAL AAA 101 # _pdbx_entry_details.entry_id 7QUW _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP AAA 32 ? ? 51.58 -116.66 2 1 ASP AAA 51 ? ? 75.61 -0.87 3 1 GLU AAA 71 ? ? 71.41 32.29 4 1 THR AAA 106 ? ? -120.76 -163.98 5 1 PHE AAA 109 ? ? -115.59 75.72 6 1 ASN AAA 111 ? ? 27.95 57.80 7 1 ARG AAA 134 ? ? 71.74 40.63 8 1 PRO AAA 141 ? ? -69.05 80.39 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id AAA _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 349 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? AAA HOH 351 ? 6.70 . 2 1 O ? AAA HOH 352 ? 10.30 . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 I70 C1 C N N 161 I70 C11 C N S 162 I70 C12 C N N 163 I70 C13 C N N 164 I70 C14 C N S 165 I70 C15 C N N 166 I70 C16 C N S 167 I70 C17 C N S 168 I70 C18 C N N 169 I70 C19 C N N 170 I70 C20 C N S 171 I70 C21 C N N 172 I70 C22 C N N 173 I70 C23 C N N 174 I70 C24 C N N 175 I70 C25 C N N 176 I70 C26 C N N 177 I70 C27 C N N 178 I70 C28 C N N 179 I70 C29 C N N 180 I70 C30 C N N 181 I70 C31 C N N 182 I70 C32 C N N 183 I70 C34 C N R 184 I70 C7 C N N 185 I70 C8 C N R 186 I70 C9 C N N 187 I70 N10 N N N 188 I70 N13 N N N 189 I70 N16 N N N 190 I70 N2 N N N 191 I70 N23 N N N 192 I70 N8 N N N 193 I70 O26 O N N 194 I70 O29 O N N 195 I70 O33 O N N 196 I70 O38 O N N 197 I70 O5 O N N 198 I70 O9 O N N 199 I70 H1 H N N 200 I70 H2 H N N 201 I70 H3 H N N 202 I70 H4 H N N 203 I70 H5 H N N 204 I70 H6 H N N 205 I70 H7 H N N 206 I70 H8 H N N 207 I70 H9 H N N 208 I70 H10 H N N 209 I70 H11 H N N 210 I70 H12 H N N 211 I70 H13 H N N 212 I70 H14 H N N 213 I70 H15 H N N 214 I70 H16 H N N 215 I70 H17 H N N 216 I70 H18 H N N 217 I70 H19 H N N 218 I70 H20 H N N 219 I70 H21 H N N 220 I70 H22 H N N 221 I70 H23 H N N 222 I70 H24 H N N 223 I70 H25 H N N 224 I70 H26 H N N 225 I70 H27 H N N 226 I70 H28 H N N 227 I70 H29 H N N 228 I70 H30 H N N 229 I70 H31 H N N 230 I70 H32 H N N 231 I70 H33 H N N 232 I70 H34 H N N 233 I70 H35 H N N 234 I70 H36 H N N 235 I70 H37 H N N 236 I70 H38 H N N 237 I70 H39 H N N 238 I70 H40 H N N 239 I70 H41 H N N 240 I70 H42 H N N 241 I70 H43 H N N 242 I70 H44 H N N 243 I70 H45 H N N 244 I70 H46 H N N 245 ILE N N N N 246 ILE CA C N S 247 ILE C C N N 248 ILE O O N N 249 ILE CB C N S 250 ILE CG1 C N N 251 ILE CG2 C N N 252 ILE CD1 C N N 253 ILE OXT O N N 254 ILE H H N N 255 ILE H2 H N N 256 ILE HA H N N 257 ILE HB H N N 258 ILE HG12 H N N 259 ILE HG13 H N N 260 ILE HG21 H N N 261 ILE HG22 H N N 262 ILE HG23 H N N 263 ILE HD11 H N N 264 ILE HD12 H N N 265 ILE HD13 H N N 266 ILE HXT H N N 267 LEU N N N N 268 LEU CA C N S 269 LEU C C N N 270 LEU O O N N 271 LEU CB C N N 272 LEU CG C N N 273 LEU CD1 C N N 274 LEU CD2 C N N 275 LEU OXT O N N 276 LEU H H N N 277 LEU H2 H N N 278 LEU HA H N N 279 LEU HB2 H N N 280 LEU HB3 H N N 281 LEU HG H N N 282 LEU HD11 H N N 283 LEU HD12 H N N 284 LEU HD13 H N N 285 LEU HD21 H N N 286 LEU HD22 H N N 287 LEU HD23 H N N 288 LEU HXT H N N 289 LYS N N N N 290 LYS CA C N S 291 LYS C C N N 292 LYS O O N N 293 LYS CB C N N 294 LYS CG C N N 295 LYS CD C N N 296 LYS CE C N N 297 LYS NZ N N N 298 LYS OXT O N N 299 LYS H H N N 300 LYS H2 H N N 301 LYS HA H N N 302 LYS HB2 H N N 303 LYS HB3 H N N 304 LYS HG2 H N N 305 LYS HG3 H N N 306 LYS HD2 H N N 307 LYS HD3 H N N 308 LYS HE2 H N N 309 LYS HE3 H N N 310 LYS HZ1 H N N 311 LYS HZ2 H N N 312 LYS HZ3 H N N 313 LYS HXT H N N 314 MET N N N N 315 MET CA C N S 316 MET C C N N 317 MET O O N N 318 MET CB C N N 319 MET CG C N N 320 MET SD S N N 321 MET CE C N N 322 MET OXT O N N 323 MET H H N N 324 MET H2 H N N 325 MET HA H N N 326 MET HB2 H N N 327 MET HB3 H N N 328 MET HG2 H N N 329 MET HG3 H N N 330 MET HE1 H N N 331 MET HE2 H N N 332 MET HE3 H N N 333 MET HXT H N N 334 PHE N N N N 335 PHE CA C N S 336 PHE C C N N 337 PHE O O N N 338 PHE CB C N N 339 PHE CG C Y N 340 PHE CD1 C Y N 341 PHE CD2 C Y N 342 PHE CE1 C Y N 343 PHE CE2 C Y N 344 PHE CZ C Y N 345 PHE OXT O N N 346 PHE H H N N 347 PHE H2 H N N 348 PHE HA H N N 349 PHE HB2 H N N 350 PHE HB3 H N N 351 PHE HD1 H N N 352 PHE HD2 H N N 353 PHE HE1 H N N 354 PHE HE2 H N N 355 PHE HZ H N N 356 PHE HXT H N N 357 PRO N N N N 358 PRO CA C N S 359 PRO C C N N 360 PRO O O N N 361 PRO CB C N N 362 PRO CG C N N 363 PRO CD C N N 364 PRO OXT O N N 365 PRO H H N N 366 PRO HA H N N 367 PRO HB2 H N N 368 PRO HB3 H N N 369 PRO HG2 H N N 370 PRO HG3 H N N 371 PRO HD2 H N N 372 PRO HD3 H N N 373 PRO HXT H N N 374 SER N N N N 375 SER CA C N S 376 SER C C N N 377 SER O O N N 378 SER CB C N N 379 SER OG O N N 380 SER OXT O N N 381 SER H H N N 382 SER H2 H N N 383 SER HA H N N 384 SER HB2 H N N 385 SER HB3 H N N 386 SER HG H N N 387 SER HXT H N N 388 THR N N N N 389 THR CA C N S 390 THR C C N N 391 THR O O N N 392 THR CB C N R 393 THR OG1 O N N 394 THR CG2 C N N 395 THR OXT O N N 396 THR H H N N 397 THR H2 H N N 398 THR HA H N N 399 THR HB H N N 400 THR HG1 H N N 401 THR HG21 H N N 402 THR HG22 H N N 403 THR HG23 H N N 404 THR HXT H N N 405 TRP N N N N 406 TRP CA C N S 407 TRP C C N N 408 TRP O O N N 409 TRP CB C N N 410 TRP CG C Y N 411 TRP CD1 C Y N 412 TRP CD2 C Y N 413 TRP NE1 N Y N 414 TRP CE2 C Y N 415 TRP CE3 C Y N 416 TRP CZ2 C Y N 417 TRP CZ3 C Y N 418 TRP CH2 C Y N 419 TRP OXT O N N 420 TRP H H N N 421 TRP H2 H N N 422 TRP HA H N N 423 TRP HB2 H N N 424 TRP HB3 H N N 425 TRP HD1 H N N 426 TRP HE1 H N N 427 TRP HE3 H N N 428 TRP HZ2 H N N 429 TRP HZ3 H N N 430 TRP HH2 H N N 431 TRP HXT H N N 432 TYR N N N N 433 TYR CA C N S 434 TYR C C N N 435 TYR O O N N 436 TYR CB C N N 437 TYR CG C Y N 438 TYR CD1 C Y N 439 TYR CD2 C Y N 440 TYR CE1 C Y N 441 TYR CE2 C Y N 442 TYR CZ C Y N 443 TYR OH O N N 444 TYR OXT O N N 445 TYR H H N N 446 TYR H2 H N N 447 TYR HA H N N 448 TYR HB2 H N N 449 TYR HB3 H N N 450 TYR HD1 H N N 451 TYR HD2 H N N 452 TYR HE1 H N N 453 TYR HE2 H N N 454 TYR HH H N N 455 TYR HXT H N N 456 VAL N N N N 457 VAL CA C N S 458 VAL C C N N 459 VAL O O N N 460 VAL CB C N N 461 VAL CG1 C N N 462 VAL CG2 C N N 463 VAL OXT O N N 464 VAL H H N N 465 VAL H2 H N N 466 VAL HA H N N 467 VAL HB H N N 468 VAL HG11 H N N 469 VAL HG12 H N N 470 VAL HG13 H N N 471 VAL HG21 H N N 472 VAL HG22 H N N 473 VAL HG23 H N N 474 VAL HXT H N N 475 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 I70 C32 C30 sing N N 152 I70 C26 C30 sing N N 153 I70 C30 C11 sing N N 154 I70 C30 C31 sing N N 155 I70 C13 C16 sing N N 156 I70 C13 N13 sing N N 157 I70 O29 C9 doub N N 158 I70 C16 C34 sing N N 159 I70 C16 C18 sing N N 160 I70 O38 C15 doub N N 161 I70 C11 N10 sing N N 162 I70 C11 C12 sing N N 163 I70 C29 C7 sing N N 164 I70 C9 N10 sing N N 165 I70 C9 N8 sing N N 166 I70 N13 C12 sing N N 167 I70 N13 C14 sing N N 168 I70 N2 C1 sing N N 169 I70 C34 C18 sing N N 170 I70 C34 C14 sing N N 171 I70 C25 C18 sing N N 172 I70 C12 O33 doub N N 173 I70 C21 C22 sing N N 174 I70 C21 C20 sing N N 175 I70 C18 C23 sing N N 176 I70 C15 C14 sing N N 177 I70 C15 N16 sing N N 178 I70 C22 N23 sing N N 179 I70 C7 N8 sing N N 180 I70 C7 C28 sing N N 181 I70 C7 C27 sing N N 182 I70 O9 C8 sing N N 183 I70 C1 C8 sing N N 184 I70 C1 O5 doub N N 185 I70 C17 N16 sing N N 186 I70 C17 C8 sing N N 187 I70 C17 C19 sing N N 188 I70 C20 C19 sing N N 189 I70 C20 C24 sing N N 190 I70 N23 C24 sing N N 191 I70 C24 O26 doub N N 192 I70 C11 H1 sing N N 193 I70 C13 H2 sing N N 194 I70 C13 H3 sing N N 195 I70 C14 H4 sing N N 196 I70 C16 H5 sing N N 197 I70 C17 H6 sing N N 198 I70 C19 H7 sing N N 199 I70 C19 H8 sing N N 200 I70 C20 H9 sing N N 201 I70 C21 H10 sing N N 202 I70 C21 H11 sing N N 203 I70 C22 H12 sing N N 204 I70 C22 H13 sing N N 205 I70 C23 H14 sing N N 206 I70 C23 H15 sing N N 207 I70 C23 H16 sing N N 208 I70 C25 H17 sing N N 209 I70 C25 H18 sing N N 210 I70 C25 H19 sing N N 211 I70 C26 H20 sing N N 212 I70 C26 H21 sing N N 213 I70 C26 H22 sing N N 214 I70 C27 H23 sing N N 215 I70 C27 H24 sing N N 216 I70 C27 H25 sing N N 217 I70 C28 H26 sing N N 218 I70 C28 H27 sing N N 219 I70 C28 H28 sing N N 220 I70 C29 H29 sing N N 221 I70 C29 H30 sing N N 222 I70 C29 H31 sing N N 223 I70 C31 H32 sing N N 224 I70 C31 H33 sing N N 225 I70 C31 H34 sing N N 226 I70 C32 H35 sing N N 227 I70 C32 H36 sing N N 228 I70 C32 H37 sing N N 229 I70 C34 H38 sing N N 230 I70 C8 H39 sing N N 231 I70 N10 H40 sing N N 232 I70 N16 H41 sing N N 233 I70 N2 H42 sing N N 234 I70 N2 H43 sing N N 235 I70 N23 H44 sing N N 236 I70 N8 H45 sing N N 237 I70 O9 H46 sing N N 238 ILE N CA sing N N 239 ILE N H sing N N 240 ILE N H2 sing N N 241 ILE CA C sing N N 242 ILE CA CB sing N N 243 ILE CA HA sing N N 244 ILE C O doub N N 245 ILE C OXT sing N N 246 ILE CB CG1 sing N N 247 ILE CB CG2 sing N N 248 ILE CB HB sing N N 249 ILE CG1 CD1 sing N N 250 ILE CG1 HG12 sing N N 251 ILE CG1 HG13 sing N N 252 ILE CG2 HG21 sing N N 253 ILE CG2 HG22 sing N N 254 ILE CG2 HG23 sing N N 255 ILE CD1 HD11 sing N N 256 ILE CD1 HD12 sing N N 257 ILE CD1 HD13 sing N N 258 ILE OXT HXT sing N N 259 LEU N CA sing N N 260 LEU N H sing N N 261 LEU N H2 sing N N 262 LEU CA C sing N N 263 LEU CA CB sing N N 264 LEU CA HA sing N N 265 LEU C O doub N N 266 LEU C OXT sing N N 267 LEU CB CG sing N N 268 LEU CB HB2 sing N N 269 LEU CB HB3 sing N N 270 LEU CG CD1 sing N N 271 LEU CG CD2 sing N N 272 LEU CG HG sing N N 273 LEU CD1 HD11 sing N N 274 LEU CD1 HD12 sing N N 275 LEU CD1 HD13 sing N N 276 LEU CD2 HD21 sing N N 277 LEU CD2 HD22 sing N N 278 LEU CD2 HD23 sing N N 279 LEU OXT HXT sing N N 280 LYS N CA sing N N 281 LYS N H sing N N 282 LYS N H2 sing N N 283 LYS CA C sing N N 284 LYS CA CB sing N N 285 LYS CA HA sing N N 286 LYS C O doub N N 287 LYS C OXT sing N N 288 LYS CB CG sing N N 289 LYS CB HB2 sing N N 290 LYS CB HB3 sing N N 291 LYS CG CD sing N N 292 LYS CG HG2 sing N N 293 LYS CG HG3 sing N N 294 LYS CD CE sing N N 295 LYS CD HD2 sing N N 296 LYS CD HD3 sing N N 297 LYS CE NZ sing N N 298 LYS CE HE2 sing N N 299 LYS CE HE3 sing N N 300 LYS NZ HZ1 sing N N 301 LYS NZ HZ2 sing N N 302 LYS NZ HZ3 sing N N 303 LYS OXT HXT sing N N 304 MET N CA sing N N 305 MET N H sing N N 306 MET N H2 sing N N 307 MET CA C sing N N 308 MET CA CB sing N N 309 MET CA HA sing N N 310 MET C O doub N N 311 MET C OXT sing N N 312 MET CB CG sing N N 313 MET CB HB2 sing N N 314 MET CB HB3 sing N N 315 MET CG SD sing N N 316 MET CG HG2 sing N N 317 MET CG HG3 sing N N 318 MET SD CE sing N N 319 MET CE HE1 sing N N 320 MET CE HE2 sing N N 321 MET CE HE3 sing N N 322 MET OXT HXT sing N N 323 PHE N CA sing N N 324 PHE N H sing N N 325 PHE N H2 sing N N 326 PHE CA C sing N N 327 PHE CA CB sing N N 328 PHE CA HA sing N N 329 PHE C O doub N N 330 PHE C OXT sing N N 331 PHE CB CG sing N N 332 PHE CB HB2 sing N N 333 PHE CB HB3 sing N N 334 PHE CG CD1 doub Y N 335 PHE CG CD2 sing Y N 336 PHE CD1 CE1 sing Y N 337 PHE CD1 HD1 sing N N 338 PHE CD2 CE2 doub Y N 339 PHE CD2 HD2 sing N N 340 PHE CE1 CZ doub Y N 341 PHE CE1 HE1 sing N N 342 PHE CE2 CZ sing Y N 343 PHE CE2 HE2 sing N N 344 PHE CZ HZ sing N N 345 PHE OXT HXT sing N N 346 PRO N CA sing N N 347 PRO N CD sing N N 348 PRO N H sing N N 349 PRO CA C sing N N 350 PRO CA CB sing N N 351 PRO CA HA sing N N 352 PRO C O doub N N 353 PRO C OXT sing N N 354 PRO CB CG sing N N 355 PRO CB HB2 sing N N 356 PRO CB HB3 sing N N 357 PRO CG CD sing N N 358 PRO CG HG2 sing N N 359 PRO CG HG3 sing N N 360 PRO CD HD2 sing N N 361 PRO CD HD3 sing N N 362 PRO OXT HXT sing N N 363 SER N CA sing N N 364 SER N H sing N N 365 SER N H2 sing N N 366 SER CA C sing N N 367 SER CA CB sing N N 368 SER CA HA sing N N 369 SER C O doub N N 370 SER C OXT sing N N 371 SER CB OG sing N N 372 SER CB HB2 sing N N 373 SER CB HB3 sing N N 374 SER OG HG sing N N 375 SER OXT HXT sing N N 376 THR N CA sing N N 377 THR N H sing N N 378 THR N H2 sing N N 379 THR CA C sing N N 380 THR CA CB sing N N 381 THR CA HA sing N N 382 THR C O doub N N 383 THR C OXT sing N N 384 THR CB OG1 sing N N 385 THR CB CG2 sing N N 386 THR CB HB sing N N 387 THR OG1 HG1 sing N N 388 THR CG2 HG21 sing N N 389 THR CG2 HG22 sing N N 390 THR CG2 HG23 sing N N 391 THR OXT HXT sing N N 392 TRP N CA sing N N 393 TRP N H sing N N 394 TRP N H2 sing N N 395 TRP CA C sing N N 396 TRP CA CB sing N N 397 TRP CA HA sing N N 398 TRP C O doub N N 399 TRP C OXT sing N N 400 TRP CB CG sing N N 401 TRP CB HB2 sing N N 402 TRP CB HB3 sing N N 403 TRP CG CD1 doub Y N 404 TRP CG CD2 sing Y N 405 TRP CD1 NE1 sing Y N 406 TRP CD1 HD1 sing N N 407 TRP CD2 CE2 doub Y N 408 TRP CD2 CE3 sing Y N 409 TRP NE1 CE2 sing Y N 410 TRP NE1 HE1 sing N N 411 TRP CE2 CZ2 sing Y N 412 TRP CE3 CZ3 doub Y N 413 TRP CE3 HE3 sing N N 414 TRP CZ2 CH2 doub Y N 415 TRP CZ2 HZ2 sing N N 416 TRP CZ3 CH2 sing Y N 417 TRP CZ3 HZ3 sing N N 418 TRP CH2 HH2 sing N N 419 TRP OXT HXT sing N N 420 TYR N CA sing N N 421 TYR N H sing N N 422 TYR N H2 sing N N 423 TYR CA C sing N N 424 TYR CA CB sing N N 425 TYR CA HA sing N N 426 TYR C O doub N N 427 TYR C OXT sing N N 428 TYR CB CG sing N N 429 TYR CB HB2 sing N N 430 TYR CB HB3 sing N N 431 TYR CG CD1 doub Y N 432 TYR CG CD2 sing Y N 433 TYR CD1 CE1 sing Y N 434 TYR CD1 HD1 sing N N 435 TYR CD2 CE2 doub Y N 436 TYR CD2 HD2 sing N N 437 TYR CE1 CZ doub Y N 438 TYR CE1 HE1 sing N N 439 TYR CE2 CZ sing Y N 440 TYR CE2 HE2 sing N N 441 TYR CZ OH sing N N 442 TYR OH HH sing N N 443 TYR OXT HXT sing N N 444 VAL N CA sing N N 445 VAL N H sing N N 446 VAL N H2 sing N N 447 VAL CA C sing N N 448 VAL CA CB sing N N 449 VAL CA HA sing N N 450 VAL C O doub N N 451 VAL C OXT sing N N 452 VAL CB CG1 sing N N 453 VAL CB CG2 sing N N 454 VAL CB HB sing N N 455 VAL CG1 HG11 sing N N 456 VAL CG1 HG12 sing N N 457 VAL CG1 HG13 sing N N 458 VAL CG2 HG21 sing N N 459 VAL CG2 HG22 sing N N 460 VAL CG2 HG23 sing N N 461 VAL OXT HXT sing N N 462 # _pdbx_audit_support.funding_organization 'European Commission' _pdbx_audit_support.country 'European Union' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2VB0 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7QUW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012776 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.006108 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015555 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.027815 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.065 # loop_