data_7QYV # _entry.id 7QYV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7QYV pdb_00007qyv 10.2210/pdb7qyv/pdb WWPDB D_1292120657 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-09-28 2 'Structure model' 1 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7QYV _pdbx_database_status.recvd_initial_deposition_date 2022-01-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email graziano.lolli@unitn.it _pdbx_contact_author.name_first Graziano _pdbx_contact_author.name_last Lolli _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8536-5599 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Dalle Vedove, A.' 1 ? 'Cazzanelli, G.' 2 ? 'Caflisch, A.' 3 ? 'Lolli, G.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Med.Chem.Lett.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1948-5875 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 1434 _citation.page_last 1443 _citation.title 'Identification of a BAZ2A-Bromodomain Hit Compound by Fragment Growing.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.2c00173 _citation.pdbx_database_id_PubMed 36105334 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dalle Vedove, A.' 1 ? primary 'Cazzanelli, G.' 2 ? primary 'Batiste, L.' 3 ? primary 'Marchand, J.R.' 4 0000-0002-8002-9457 primary 'Spiliotopoulos, D.' 5 ? primary 'Corsi, J.' 6 ? primary ;D'Agostino, V.G. ; 7 ? primary 'Caflisch, A.' 8 0000-0002-2317-6792 primary 'Lolli, G.' 9 0000-0002-8536-5599 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bromodomain adjacent to zinc finger domain protein 2A' 12363.872 1 ? 'First two residues SM derive from the expression tag' 'Bromodomain (residues 1796-1899)' ? 2 non-polymer syn '(2~{R})-1-[4-(4-ethanoyl-3-ethyl-5-methyl-1~{H}-pyrrol-2-yl)-1,3-thiazol-2-yl]-~{N}-(4-oxidanylbutyl)piperazine-2-carboxamide' 433.568 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 57 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Transcription termination factor I-interacting protein 5,Tip5,hWALp3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMHSDLTFCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRHRLSRGGYTSSEEFAADALLVFDNCQTFN EDDSEVGKAGHIMRRFFESRWEEFY ; _entity_poly.pdbx_seq_one_letter_code_can ;SMHSDLTFCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRHRLSRGGYTSSEEFAADALLVFDNCQTFN EDDSEVGKAGHIMRRFFESRWEEFY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(2~{R})-1-[4-(4-ethanoyl-3-ethyl-5-methyl-1~{H}-pyrrol-2-yl)-1,3-thiazol-2-yl]-~{N}-(4-oxidanylbutyl)piperazine-2-carboxamide' GJ4 3 'MAGNESIUM ION' MG 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 HIS n 1 4 SER n 1 5 ASP n 1 6 LEU n 1 7 THR n 1 8 PHE n 1 9 CYS n 1 10 GLU n 1 11 ILE n 1 12 ILE n 1 13 LEU n 1 14 MET n 1 15 GLU n 1 16 MET n 1 17 GLU n 1 18 SER n 1 19 HIS n 1 20 ASP n 1 21 ALA n 1 22 ALA n 1 23 TRP n 1 24 PRO n 1 25 PHE n 1 26 LEU n 1 27 GLU n 1 28 PRO n 1 29 VAL n 1 30 ASN n 1 31 PRO n 1 32 ARG n 1 33 LEU n 1 34 VAL n 1 35 SER n 1 36 GLY n 1 37 TYR n 1 38 ARG n 1 39 ARG n 1 40 ILE n 1 41 ILE n 1 42 LYS n 1 43 ASN n 1 44 PRO n 1 45 MET n 1 46 ASP n 1 47 PHE n 1 48 SER n 1 49 THR n 1 50 MET n 1 51 ARG n 1 52 HIS n 1 53 ARG n 1 54 LEU n 1 55 SER n 1 56 ARG n 1 57 GLY n 1 58 GLY n 1 59 TYR n 1 60 THR n 1 61 SER n 1 62 SER n 1 63 GLU n 1 64 GLU n 1 65 PHE n 1 66 ALA n 1 67 ALA n 1 68 ASP n 1 69 ALA n 1 70 LEU n 1 71 LEU n 1 72 VAL n 1 73 PHE n 1 74 ASP n 1 75 ASN n 1 76 CYS n 1 77 GLN n 1 78 THR n 1 79 PHE n 1 80 ASN n 1 81 GLU n 1 82 ASP n 1 83 ASP n 1 84 SER n 1 85 GLU n 1 86 VAL n 1 87 GLY n 1 88 LYS n 1 89 ALA n 1 90 GLY n 1 91 HIS n 1 92 ILE n 1 93 MET n 1 94 ARG n 1 95 ARG n 1 96 PHE n 1 97 PHE n 1 98 GLU n 1 99 SER n 1 100 ARG n 1 101 TRP n 1 102 GLU n 1 103 GLU n 1 104 PHE n 1 105 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 105 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BAZ2A, KIAA0314, TIP5' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GJ4 non-polymer . '(2~{R})-1-[4-(4-ethanoyl-3-ethyl-5-methyl-1~{H}-pyrrol-2-yl)-1,3-thiazol-2-yl]-~{N}-(4-oxidanylbutyl)piperazine-2-carboxamide' ? 'C21 H31 N5 O3 S' 433.568 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1794 ? ? ? A . n A 1 2 MET 2 1795 ? ? ? A . n A 1 3 HIS 3 1796 1796 HIS HIS A . n A 1 4 SER 4 1797 1797 SER SER A . n A 1 5 ASP 5 1798 1798 ASP ASP A . n A 1 6 LEU 6 1799 1799 LEU LEU A . n A 1 7 THR 7 1800 1800 THR THR A . n A 1 8 PHE 8 1801 1801 PHE PHE A . n A 1 9 CYS 9 1802 1802 CYS CYS A . n A 1 10 GLU 10 1803 1803 GLU GLU A . n A 1 11 ILE 11 1804 1804 ILE ILE A . n A 1 12 ILE 12 1805 1805 ILE ILE A . n A 1 13 LEU 13 1806 1806 LEU LEU A . n A 1 14 MET 14 1807 1807 MET MET A . n A 1 15 GLU 15 1808 1808 GLU GLU A . n A 1 16 MET 16 1809 1809 MET MET A . n A 1 17 GLU 17 1810 1810 GLU GLU A . n A 1 18 SER 18 1811 1811 SER SER A . n A 1 19 HIS 19 1812 1812 HIS HIS A . n A 1 20 ASP 20 1813 1813 ASP ASP A . n A 1 21 ALA 21 1814 1814 ALA ALA A . n A 1 22 ALA 22 1815 1815 ALA ALA A . n A 1 23 TRP 23 1816 1816 TRP TRP A . n A 1 24 PRO 24 1817 1817 PRO PRO A . n A 1 25 PHE 25 1818 1818 PHE PHE A . n A 1 26 LEU 26 1819 1819 LEU LEU A . n A 1 27 GLU 27 1820 1820 GLU GLU A . n A 1 28 PRO 28 1821 1821 PRO PRO A . n A 1 29 VAL 29 1822 1822 VAL VAL A . n A 1 30 ASN 30 1823 1823 ASN ASN A . n A 1 31 PRO 31 1824 1824 PRO PRO A . n A 1 32 ARG 32 1825 1825 ARG ARG A . n A 1 33 LEU 33 1826 1826 LEU LEU A . n A 1 34 VAL 34 1827 1827 VAL VAL A . n A 1 35 SER 35 1828 1828 SER SER A . n A 1 36 GLY 36 1829 1829 GLY GLY A . n A 1 37 TYR 37 1830 1830 TYR TYR A . n A 1 38 ARG 38 1831 1831 ARG ARG A . n A 1 39 ARG 39 1832 1832 ARG ARG A . n A 1 40 ILE 40 1833 1833 ILE ILE A . n A 1 41 ILE 41 1834 1834 ILE ILE A . n A 1 42 LYS 42 1835 1835 LYS LYS A . n A 1 43 ASN 43 1836 1836 ASN ASN A . n A 1 44 PRO 44 1837 1837 PRO PRO A . n A 1 45 MET 45 1838 1838 MET MET A . n A 1 46 ASP 46 1839 1839 ASP ASP A . n A 1 47 PHE 47 1840 1840 PHE PHE A . n A 1 48 SER 48 1841 1841 SER SER A . n A 1 49 THR 49 1842 1842 THR THR A . n A 1 50 MET 50 1843 1843 MET MET A . n A 1 51 ARG 51 1844 1844 ARG ARG A . n A 1 52 HIS 52 1845 1845 HIS HIS A . n A 1 53 ARG 53 1846 1846 ARG ARG A . n A 1 54 LEU 54 1847 1847 LEU LEU A . n A 1 55 SER 55 1848 1848 SER SER A . n A 1 56 ARG 56 1849 1849 ARG ARG A . n A 1 57 GLY 57 1850 1850 GLY GLY A . n A 1 58 GLY 58 1851 1851 GLY GLY A . n A 1 59 TYR 59 1852 1852 TYR TYR A . n A 1 60 THR 60 1853 1853 THR THR A . n A 1 61 SER 61 1854 1854 SER SER A . n A 1 62 SER 62 1855 1855 SER SER A . n A 1 63 GLU 63 1856 1856 GLU GLU A . n A 1 64 GLU 64 1857 1857 GLU GLU A . n A 1 65 PHE 65 1858 1858 PHE PHE A . n A 1 66 ALA 66 1859 1859 ALA ALA A . n A 1 67 ALA 67 1860 1860 ALA ALA A . n A 1 68 ASP 68 1861 1861 ASP ASP A . n A 1 69 ALA 69 1862 1862 ALA ALA A . n A 1 70 LEU 70 1863 1863 LEU LEU A . n A 1 71 LEU 71 1864 1864 LEU LEU A . n A 1 72 VAL 72 1865 1865 VAL VAL A . n A 1 73 PHE 73 1866 1866 PHE PHE A . n A 1 74 ASP 74 1867 1867 ASP ASP A . n A 1 75 ASN 75 1868 1868 ASN ASN A . n A 1 76 CYS 76 1869 1869 CYS CYS A . n A 1 77 GLN 77 1870 1870 GLN GLN A . n A 1 78 THR 78 1871 1871 THR THR A . n A 1 79 PHE 79 1872 1872 PHE PHE A . n A 1 80 ASN 80 1873 1873 ASN ASN A . n A 1 81 GLU 81 1874 1874 GLU GLU A . n A 1 82 ASP 82 1875 1875 ASP ASP A . n A 1 83 ASP 83 1876 1876 ASP ASP A . n A 1 84 SER 84 1877 1877 SER SER A . n A 1 85 GLU 85 1878 1878 GLU GLU A . n A 1 86 VAL 86 1879 1879 VAL VAL A . n A 1 87 GLY 87 1880 1880 GLY GLY A . n A 1 88 LYS 88 1881 1881 LYS LYS A . n A 1 89 ALA 89 1882 1882 ALA ALA A . n A 1 90 GLY 90 1883 1883 GLY GLY A . n A 1 91 HIS 91 1884 1884 HIS HIS A . n A 1 92 ILE 92 1885 1885 ILE ILE A . n A 1 93 MET 93 1886 1886 MET MET A . n A 1 94 ARG 94 1887 1887 ARG ARG A . n A 1 95 ARG 95 1888 1888 ARG ARG A . n A 1 96 PHE 96 1889 1889 PHE PHE A . n A 1 97 PHE 97 1890 1890 PHE PHE A . n A 1 98 GLU 98 1891 1891 GLU GLU A . n A 1 99 SER 99 1892 1892 SER SER A . n A 1 100 ARG 100 1893 1893 ARG ARG A . n A 1 101 TRP 101 1894 1894 TRP TRP A . n A 1 102 GLU 102 1895 1895 GLU GLU A . n A 1 103 GLU 103 1896 1896 GLU GLU A . n A 1 104 PHE 104 1897 1897 PHE PHE A . n A 1 105 TYR 105 1898 1898 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GJ4 1 1901 1901 GJ4 430 A . C 3 MG 1 1902 1 MG MG A . D 4 HOH 1 2001 3 HOH HOH A . D 4 HOH 2 2002 32 HOH HOH A . D 4 HOH 3 2003 34 HOH HOH A . D 4 HOH 4 2004 41 HOH HOH A . D 4 HOH 5 2005 58 HOH HOH A . D 4 HOH 6 2006 25 HOH HOH A . D 4 HOH 7 2007 31 HOH HOH A . D 4 HOH 8 2008 52 HOH HOH A . D 4 HOH 9 2009 49 HOH HOH A . D 4 HOH 10 2010 36 HOH HOH A . D 4 HOH 11 2011 45 HOH HOH A . D 4 HOH 12 2012 24 HOH HOH A . D 4 HOH 13 2013 9 HOH HOH A . D 4 HOH 14 2014 55 HOH HOH A . D 4 HOH 15 2015 33 HOH HOH A . D 4 HOH 16 2016 37 HOH HOH A . D 4 HOH 17 2017 18 HOH HOH A . D 4 HOH 18 2018 10 HOH HOH A . D 4 HOH 19 2019 2 HOH HOH A . D 4 HOH 20 2020 6 HOH HOH A . D 4 HOH 21 2021 7 HOH HOH A . D 4 HOH 22 2022 28 HOH HOH A . D 4 HOH 23 2023 56 HOH HOH A . D 4 HOH 24 2024 4 HOH HOH A . D 4 HOH 25 2025 53 HOH HOH A . D 4 HOH 26 2026 20 HOH HOH A . D 4 HOH 27 2027 21 HOH HOH A . D 4 HOH 28 2028 26 HOH HOH A . D 4 HOH 29 2029 44 HOH HOH A . D 4 HOH 30 2030 8 HOH HOH A . D 4 HOH 31 2031 43 HOH HOH A . D 4 HOH 32 2032 17 HOH HOH A . D 4 HOH 33 2033 40 HOH HOH A . D 4 HOH 34 2034 19 HOH HOH A . D 4 HOH 35 2035 12 HOH HOH A . D 4 HOH 36 2036 13 HOH HOH A . D 4 HOH 37 2037 5 HOH HOH A . D 4 HOH 38 2038 11 HOH HOH A . D 4 HOH 39 2039 22 HOH HOH A . D 4 HOH 40 2040 27 HOH HOH A . D 4 HOH 41 2041 42 HOH HOH A . D 4 HOH 42 2042 15 HOH HOH A . D 4 HOH 43 2043 38 HOH HOH A . D 4 HOH 44 2044 30 HOH HOH A . D 4 HOH 45 2045 16 HOH HOH A . D 4 HOH 46 2046 51 HOH HOH A . D 4 HOH 47 2047 14 HOH HOH A . D 4 HOH 48 2048 1 HOH HOH A . D 4 HOH 49 2049 54 HOH HOH A . D 4 HOH 50 2050 57 HOH HOH A . D 4 HOH 51 2051 47 HOH HOH A . D 4 HOH 52 2052 29 HOH HOH A . D 4 HOH 53 2053 46 HOH HOH A . D 4 HOH 54 2054 59 HOH HOH A . D 4 HOH 55 2055 35 HOH HOH A . D 4 HOH 56 2056 23 HOH HOH A . D 4 HOH 57 2057 50 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7QYV _cell.details ? _cell.formula_units_Z ? _cell.length_a 93.902 _cell.length_a_esd ? _cell.length_b 93.902 _cell.length_b_esd ? _cell.length_c 33.232 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7QYV _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7QYV _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.42 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.04 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.360 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG3350, 0.2 M MgCl2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-05-25 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9998 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ELETTRA BEAMLINE 11.2C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9998 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 11.2C _diffrn_source.pdbx_synchrotron_site ELETTRA # _reflns.B_iso_Wilson_estimate 36.180 _reflns.entry_id 7QYV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.250 _reflns.d_resolution_low 81.320 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8214 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.400 _reflns.pdbx_Rmerge_I_obs 0.131 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.900 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.135 _reflns.pdbx_Rpim_I_all 0.031 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 150785 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.250 2.320 ? ? 11363 ? ? ? 750 99.900 ? ? ? ? 1.375 ? ? ? ? ? ? ? ? 15.200 ? ? ? 2.600 1.425 0.366 ? 1 1 0.865 ? ? ? ? ? ? ? ? ? ? 9.000 81.320 ? ? 2223 ? ? ? 148 99.000 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 15.000 ? ? ? 59.700 0.037 0.010 ? 2 1 0.999 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 90.500 _refine.B_iso_mean 45.5027 _refine.B_iso_min 24.000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7QYV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2500 _refine.ls_d_res_low 30.7630 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8178 _refine.ls_number_reflns_R_free 397 _refine.ls_number_reflns_R_work 7781 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6300 _refine.ls_percent_reflns_R_free 4.8500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1942 _refine.ls_R_factor_R_free 0.2369 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1922 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5MGJ _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.3700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2500 _refine_hist.d_res_low 30.7630 _refine_hist.number_atoms_solvent 57 _refine_hist.number_atoms_total 940 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 103 _refine_hist.pdbx_B_iso_mean_ligand 46.11 _refine_hist.pdbx_B_iso_mean_solvent 44.96 _refine_hist.pdbx_number_atoms_protein 852 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 948 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.796 ? 1284 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.047 ? 124 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 169 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 23.395 ? 572 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2500 2.5754 . . 142 2536 99.0000 . . . 0.2750 0.0000 0.2168 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5754 3.2442 . . 134 2573 100.0000 . . . 0.2183 0.0000 0.2246 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2442 30.763 . . 121 2672 100.0000 . . . 0.2347 0.0000 0.1734 . . . . . . . . . . . # _struct.entry_id 7QYV _struct.title 'BAZ2A bromodomain in complex with acetylpyrrole derivative compound 109' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7QYV _struct_keywords.text 'four helical bundle, transcription' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BAZ2A_HUMAN _struct_ref.pdbx_db_accession Q9UIF9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;HSDLTFCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNED DSEVGKAGHIMRRFFESRWEEFY ; _struct_ref.pdbx_align_begin 1796 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7QYV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 105 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UIF9 _struct_ref_seq.db_align_beg 1796 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1898 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1796 _struct_ref_seq.pdbx_auth_seq_align_end 1898 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7QYV SER A 1 ? UNP Q9UIF9 ? ? 'expression tag' 1794 1 1 7QYV MET A 2 ? UNP Q9UIF9 ? ? 'expression tag' 1795 2 1 7QYV HIS A 52 ? UNP Q9UIF9 GLU 1845 'engineered mutation' 1845 3 1 7QYV SER A 55 ? UNP Q9UIF9 LEU 1848 'engineered mutation' 1848 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 60 ? 1 MORE -3 ? 1 'SSA (A^2)' 6250 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 4 ? HIS A 19 ? SER A 1797 HIS A 1812 1 ? 16 HELX_P HELX_P2 AA2 ASP A 20 ? LEU A 26 ? ASP A 1813 LEU A 1819 5 ? 7 HELX_P HELX_P3 AA3 GLY A 36 ? ILE A 41 ? GLY A 1829 ILE A 1834 1 ? 6 HELX_P HELX_P4 AA4 ASP A 46 ? ARG A 56 ? ASP A 1839 ARG A 1849 1 ? 11 HELX_P HELX_P5 AA5 SER A 61 ? ASN A 80 ? SER A 1854 ASN A 1873 1 ? 20 HELX_P HELX_P6 AA6 SER A 84 ? GLU A 103 ? SER A 1877 GLU A 1896 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 1902 A HOH 2008 1_555 ? ? ? ? ? ? ? 2.386 ? ? metalc2 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 1902 A HOH 2014 1_555 ? ? ? ? ? ? ? 2.303 ? ? metalc3 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 1902 A HOH 2023 6_557 ? ? ? ? ? ? ? 2.306 ? ? metalc4 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 1902 A HOH 2025 6_557 ? ? ? ? ? ? ? 2.370 ? ? metalc5 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 1902 A HOH 2049 1_555 ? ? ? ? ? ? ? 2.178 ? ? metalc6 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 1902 A HOH 2050 1_555 ? ? ? ? ? ? ? 2.553 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? D HOH . ? A HOH 2008 ? 1_555 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2014 ? 1_555 98.4 ? 2 O ? D HOH . ? A HOH 2008 ? 1_555 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2023 ? 6_557 85.6 ? 3 O ? D HOH . ? A HOH 2014 ? 1_555 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2023 ? 6_557 99.3 ? 4 O ? D HOH . ? A HOH 2008 ? 1_555 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2025 ? 6_557 83.3 ? 5 O ? D HOH . ? A HOH 2014 ? 1_555 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2025 ? 6_557 169.5 ? 6 O ? D HOH . ? A HOH 2023 ? 6_557 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2025 ? 6_557 91.2 ? 7 O ? D HOH . ? A HOH 2008 ? 1_555 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2049 ? 1_555 89.2 ? 8 O ? D HOH . ? A HOH 2014 ? 1_555 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2049 ? 1_555 90.9 ? 9 O ? D HOH . ? A HOH 2023 ? 6_557 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2049 ? 1_555 169.2 ? 10 O ? D HOH . ? A HOH 2025 ? 6_557 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2049 ? 1_555 78.7 ? 11 O ? D HOH . ? A HOH 2008 ? 1_555 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2050 ? 1_555 159.4 ? 12 O ? D HOH . ? A HOH 2014 ? 1_555 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2050 ? 1_555 88.9 ? 13 O ? D HOH . ? A HOH 2023 ? 6_557 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2050 ? 1_555 74.2 ? 14 O ? D HOH . ? A HOH 2025 ? 6_557 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2050 ? 1_555 93.0 ? 15 O ? D HOH . ? A HOH 2049 ? 1_555 MG ? C MG . ? A MG 1902 ? 1_555 O ? D HOH . ? A HOH 2050 ? 1_555 110.0 ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 1797 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -93.04 _pdbx_validate_torsion.psi 31.54 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 2046 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _phasing.method MR # _pdbx_entry_details.entry_id 7QYV _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1794 ? A SER 1 2 1 Y 1 A MET 1795 ? A MET 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GJ4 C01 C N N 88 GJ4 C02 C N N 89 GJ4 C04 C Y N 90 GJ4 C05 C Y N 91 GJ4 C06 C Y N 92 GJ4 C08 C Y N 93 GJ4 N09 N N N 94 GJ4 C10 C N N 95 GJ4 C11 C N N 96 GJ4 C13 C N N 97 GJ4 C14 C N R 98 GJ4 C15 C N N 99 GJ4 C18 C N N 100 GJ4 C21 C N N 101 GJ4 C25 C Y N 102 GJ4 C26 C N N 103 GJ4 C27 C Y N 104 GJ4 C03 C Y N 105 GJ4 C19 C N N 106 GJ4 C20 C N N 107 GJ4 C28 C N N 108 GJ4 C29 C N N 109 GJ4 N12 N N N 110 GJ4 N17 N N N 111 GJ4 N23 N Y N 112 GJ4 N24 N Y N 113 GJ4 O16 O N N 114 GJ4 O22 O N N 115 GJ4 O30 O N N 116 GJ4 S07 S Y N 117 GJ4 H1 H N N 118 GJ4 H2 H N N 119 GJ4 H3 H N N 120 GJ4 H4 H N N 121 GJ4 H5 H N N 122 GJ4 H6 H N N 123 GJ4 H7 H N N 124 GJ4 H8 H N N 125 GJ4 H9 H N N 126 GJ4 H10 H N N 127 GJ4 H11 H N N 128 GJ4 H12 H N N 129 GJ4 H13 H N N 130 GJ4 H14 H N N 131 GJ4 H15 H N N 132 GJ4 H16 H N N 133 GJ4 H17 H N N 134 GJ4 H18 H N N 135 GJ4 H19 H N N 136 GJ4 H20 H N N 137 GJ4 H21 H N N 138 GJ4 H22 H N N 139 GJ4 H23 H N N 140 GJ4 H24 H N N 141 GJ4 H25 H N N 142 GJ4 H26 H N N 143 GJ4 H27 H N N 144 GJ4 H28 H N N 145 GJ4 H30 H N N 146 GJ4 H31 H N N 147 GJ4 H32 H N N 148 GLN N N N N 149 GLN CA C N S 150 GLN C C N N 151 GLN O O N N 152 GLN CB C N N 153 GLN CG C N N 154 GLN CD C N N 155 GLN OE1 O N N 156 GLN NE2 N N N 157 GLN OXT O N N 158 GLN H H N N 159 GLN H2 H N N 160 GLN HA H N N 161 GLN HB2 H N N 162 GLN HB3 H N N 163 GLN HG2 H N N 164 GLN HG3 H N N 165 GLN HE21 H N N 166 GLN HE22 H N N 167 GLN HXT H N N 168 GLU N N N N 169 GLU CA C N S 170 GLU C C N N 171 GLU O O N N 172 GLU CB C N N 173 GLU CG C N N 174 GLU CD C N N 175 GLU OE1 O N N 176 GLU OE2 O N N 177 GLU OXT O N N 178 GLU H H N N 179 GLU H2 H N N 180 GLU HA H N N 181 GLU HB2 H N N 182 GLU HB3 H N N 183 GLU HG2 H N N 184 GLU HG3 H N N 185 GLU HE2 H N N 186 GLU HXT H N N 187 GLY N N N N 188 GLY CA C N N 189 GLY C C N N 190 GLY O O N N 191 GLY OXT O N N 192 GLY H H N N 193 GLY H2 H N N 194 GLY HA2 H N N 195 GLY HA3 H N N 196 GLY HXT H N N 197 HIS N N N N 198 HIS CA C N S 199 HIS C C N N 200 HIS O O N N 201 HIS CB C N N 202 HIS CG C Y N 203 HIS ND1 N Y N 204 HIS CD2 C Y N 205 HIS CE1 C Y N 206 HIS NE2 N Y N 207 HIS OXT O N N 208 HIS H H N N 209 HIS H2 H N N 210 HIS HA H N N 211 HIS HB2 H N N 212 HIS HB3 H N N 213 HIS HD1 H N N 214 HIS HD2 H N N 215 HIS HE1 H N N 216 HIS HE2 H N N 217 HIS HXT H N N 218 HOH O O N N 219 HOH H1 H N N 220 HOH H2 H N N 221 ILE N N N N 222 ILE CA C N S 223 ILE C C N N 224 ILE O O N N 225 ILE CB C N S 226 ILE CG1 C N N 227 ILE CG2 C N N 228 ILE CD1 C N N 229 ILE OXT O N N 230 ILE H H N N 231 ILE H2 H N N 232 ILE HA H N N 233 ILE HB H N N 234 ILE HG12 H N N 235 ILE HG13 H N N 236 ILE HG21 H N N 237 ILE HG22 H N N 238 ILE HG23 H N N 239 ILE HD11 H N N 240 ILE HD12 H N N 241 ILE HD13 H N N 242 ILE HXT H N N 243 LEU N N N N 244 LEU CA C N S 245 LEU C C N N 246 LEU O O N N 247 LEU CB C N N 248 LEU CG C N N 249 LEU CD1 C N N 250 LEU CD2 C N N 251 LEU OXT O N N 252 LEU H H N N 253 LEU H2 H N N 254 LEU HA H N N 255 LEU HB2 H N N 256 LEU HB3 H N N 257 LEU HG H N N 258 LEU HD11 H N N 259 LEU HD12 H N N 260 LEU HD13 H N N 261 LEU HD21 H N N 262 LEU HD22 H N N 263 LEU HD23 H N N 264 LEU HXT H N N 265 LYS N N N N 266 LYS CA C N S 267 LYS C C N N 268 LYS O O N N 269 LYS CB C N N 270 LYS CG C N N 271 LYS CD C N N 272 LYS CE C N N 273 LYS NZ N N N 274 LYS OXT O N N 275 LYS H H N N 276 LYS H2 H N N 277 LYS HA H N N 278 LYS HB2 H N N 279 LYS HB3 H N N 280 LYS HG2 H N N 281 LYS HG3 H N N 282 LYS HD2 H N N 283 LYS HD3 H N N 284 LYS HE2 H N N 285 LYS HE3 H N N 286 LYS HZ1 H N N 287 LYS HZ2 H N N 288 LYS HZ3 H N N 289 LYS HXT H N N 290 MET N N N N 291 MET CA C N S 292 MET C C N N 293 MET O O N N 294 MET CB C N N 295 MET CG C N N 296 MET SD S N N 297 MET CE C N N 298 MET OXT O N N 299 MET H H N N 300 MET H2 H N N 301 MET HA H N N 302 MET HB2 H N N 303 MET HB3 H N N 304 MET HG2 H N N 305 MET HG3 H N N 306 MET HE1 H N N 307 MET HE2 H N N 308 MET HE3 H N N 309 MET HXT H N N 310 MG MG MG N N 311 PHE N N N N 312 PHE CA C N S 313 PHE C C N N 314 PHE O O N N 315 PHE CB C N N 316 PHE CG C Y N 317 PHE CD1 C Y N 318 PHE CD2 C Y N 319 PHE CE1 C Y N 320 PHE CE2 C Y N 321 PHE CZ C Y N 322 PHE OXT O N N 323 PHE H H N N 324 PHE H2 H N N 325 PHE HA H N N 326 PHE HB2 H N N 327 PHE HB3 H N N 328 PHE HD1 H N N 329 PHE HD2 H N N 330 PHE HE1 H N N 331 PHE HE2 H N N 332 PHE HZ H N N 333 PHE HXT H N N 334 PRO N N N N 335 PRO CA C N S 336 PRO C C N N 337 PRO O O N N 338 PRO CB C N N 339 PRO CG C N N 340 PRO CD C N N 341 PRO OXT O N N 342 PRO H H N N 343 PRO HA H N N 344 PRO HB2 H N N 345 PRO HB3 H N N 346 PRO HG2 H N N 347 PRO HG3 H N N 348 PRO HD2 H N N 349 PRO HD3 H N N 350 PRO HXT H N N 351 SER N N N N 352 SER CA C N S 353 SER C C N N 354 SER O O N N 355 SER CB C N N 356 SER OG O N N 357 SER OXT O N N 358 SER H H N N 359 SER H2 H N N 360 SER HA H N N 361 SER HB2 H N N 362 SER HB3 H N N 363 SER HG H N N 364 SER HXT H N N 365 THR N N N N 366 THR CA C N S 367 THR C C N N 368 THR O O N N 369 THR CB C N R 370 THR OG1 O N N 371 THR CG2 C N N 372 THR OXT O N N 373 THR H H N N 374 THR H2 H N N 375 THR HA H N N 376 THR HB H N N 377 THR HG1 H N N 378 THR HG21 H N N 379 THR HG22 H N N 380 THR HG23 H N N 381 THR HXT H N N 382 TRP N N N N 383 TRP CA C N S 384 TRP C C N N 385 TRP O O N N 386 TRP CB C N N 387 TRP CG C Y N 388 TRP CD1 C Y N 389 TRP CD2 C Y N 390 TRP NE1 N Y N 391 TRP CE2 C Y N 392 TRP CE3 C Y N 393 TRP CZ2 C Y N 394 TRP CZ3 C Y N 395 TRP CH2 C Y N 396 TRP OXT O N N 397 TRP H H N N 398 TRP H2 H N N 399 TRP HA H N N 400 TRP HB2 H N N 401 TRP HB3 H N N 402 TRP HD1 H N N 403 TRP HE1 H N N 404 TRP HE3 H N N 405 TRP HZ2 H N N 406 TRP HZ3 H N N 407 TRP HH2 H N N 408 TRP HXT H N N 409 TYR N N N N 410 TYR CA C N S 411 TYR C C N N 412 TYR O O N N 413 TYR CB C N N 414 TYR CG C Y N 415 TYR CD1 C Y N 416 TYR CD2 C Y N 417 TYR CE1 C Y N 418 TYR CE2 C Y N 419 TYR CZ C Y N 420 TYR OH O N N 421 TYR OXT O N N 422 TYR H H N N 423 TYR H2 H N N 424 TYR HA H N N 425 TYR HB2 H N N 426 TYR HB3 H N N 427 TYR HD1 H N N 428 TYR HD2 H N N 429 TYR HE1 H N N 430 TYR HE2 H N N 431 TYR HH H N N 432 TYR HXT H N N 433 VAL N N N N 434 VAL CA C N S 435 VAL C C N N 436 VAL O O N N 437 VAL CB C N N 438 VAL CG1 C N N 439 VAL CG2 C N N 440 VAL OXT O N N 441 VAL H H N N 442 VAL H2 H N N 443 VAL HA H N N 444 VAL HB H N N 445 VAL HG11 H N N 446 VAL HG12 H N N 447 VAL HG13 H N N 448 VAL HG21 H N N 449 VAL HG22 H N N 450 VAL HG23 H N N 451 VAL HXT H N N 452 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GJ4 C21 O22 sing N N 83 GJ4 C21 C20 sing N N 84 GJ4 C19 C20 sing N N 85 GJ4 C19 C18 sing N N 86 GJ4 C18 N17 sing N N 87 GJ4 C29 C28 sing N N 88 GJ4 C28 O30 doub N N 89 GJ4 C28 C27 sing N N 90 GJ4 N17 C15 sing N N 91 GJ4 C02 C03 sing N N 92 GJ4 C02 C01 sing N N 93 GJ4 O16 C15 doub N N 94 GJ4 C27 C03 sing Y N 95 GJ4 C27 C25 doub Y N 96 GJ4 C03 C04 doub Y N 97 GJ4 C15 C14 sing N N 98 GJ4 C25 C26 sing N N 99 GJ4 C25 N24 sing Y N 100 GJ4 C04 N24 sing Y N 101 GJ4 C04 C05 sing N N 102 GJ4 C05 C06 doub Y N 103 GJ4 C05 N23 sing Y N 104 GJ4 C06 S07 sing Y N 105 GJ4 N23 C08 doub Y N 106 GJ4 C14 N09 sing N N 107 GJ4 C14 C13 sing N N 108 GJ4 C08 S07 sing Y N 109 GJ4 C08 N09 sing N N 110 GJ4 C10 N09 sing N N 111 GJ4 C10 C11 sing N N 112 GJ4 C13 N12 sing N N 113 GJ4 C11 N12 sing N N 114 GJ4 C01 H1 sing N N 115 GJ4 C01 H2 sing N N 116 GJ4 C01 H3 sing N N 117 GJ4 C02 H4 sing N N 118 GJ4 C02 H5 sing N N 119 GJ4 C06 H6 sing N N 120 GJ4 C10 H7 sing N N 121 GJ4 C10 H8 sing N N 122 GJ4 C11 H9 sing N N 123 GJ4 C11 H10 sing N N 124 GJ4 C13 H11 sing N N 125 GJ4 C13 H12 sing N N 126 GJ4 C14 H13 sing N N 127 GJ4 C18 H14 sing N N 128 GJ4 C18 H15 sing N N 129 GJ4 C21 H16 sing N N 130 GJ4 C21 H17 sing N N 131 GJ4 C26 H18 sing N N 132 GJ4 C26 H19 sing N N 133 GJ4 C26 H20 sing N N 134 GJ4 C19 H21 sing N N 135 GJ4 C19 H22 sing N N 136 GJ4 C20 H23 sing N N 137 GJ4 C20 H24 sing N N 138 GJ4 C29 H25 sing N N 139 GJ4 C29 H26 sing N N 140 GJ4 C29 H27 sing N N 141 GJ4 N12 H28 sing N N 142 GJ4 N17 H30 sing N N 143 GJ4 N24 H31 sing N N 144 GJ4 O22 H32 sing N N 145 GLN N CA sing N N 146 GLN N H sing N N 147 GLN N H2 sing N N 148 GLN CA C sing N N 149 GLN CA CB sing N N 150 GLN CA HA sing N N 151 GLN C O doub N N 152 GLN C OXT sing N N 153 GLN CB CG sing N N 154 GLN CB HB2 sing N N 155 GLN CB HB3 sing N N 156 GLN CG CD sing N N 157 GLN CG HG2 sing N N 158 GLN CG HG3 sing N N 159 GLN CD OE1 doub N N 160 GLN CD NE2 sing N N 161 GLN NE2 HE21 sing N N 162 GLN NE2 HE22 sing N N 163 GLN OXT HXT sing N N 164 GLU N CA sing N N 165 GLU N H sing N N 166 GLU N H2 sing N N 167 GLU CA C sing N N 168 GLU CA CB sing N N 169 GLU CA HA sing N N 170 GLU C O doub N N 171 GLU C OXT sing N N 172 GLU CB CG sing N N 173 GLU CB HB2 sing N N 174 GLU CB HB3 sing N N 175 GLU CG CD sing N N 176 GLU CG HG2 sing N N 177 GLU CG HG3 sing N N 178 GLU CD OE1 doub N N 179 GLU CD OE2 sing N N 180 GLU OE2 HE2 sing N N 181 GLU OXT HXT sing N N 182 GLY N CA sing N N 183 GLY N H sing N N 184 GLY N H2 sing N N 185 GLY CA C sing N N 186 GLY CA HA2 sing N N 187 GLY CA HA3 sing N N 188 GLY C O doub N N 189 GLY C OXT sing N N 190 GLY OXT HXT sing N N 191 HIS N CA sing N N 192 HIS N H sing N N 193 HIS N H2 sing N N 194 HIS CA C sing N N 195 HIS CA CB sing N N 196 HIS CA HA sing N N 197 HIS C O doub N N 198 HIS C OXT sing N N 199 HIS CB CG sing N N 200 HIS CB HB2 sing N N 201 HIS CB HB3 sing N N 202 HIS CG ND1 sing Y N 203 HIS CG CD2 doub Y N 204 HIS ND1 CE1 doub Y N 205 HIS ND1 HD1 sing N N 206 HIS CD2 NE2 sing Y N 207 HIS CD2 HD2 sing N N 208 HIS CE1 NE2 sing Y N 209 HIS CE1 HE1 sing N N 210 HIS NE2 HE2 sing N N 211 HIS OXT HXT sing N N 212 HOH O H1 sing N N 213 HOH O H2 sing N N 214 ILE N CA sing N N 215 ILE N H sing N N 216 ILE N H2 sing N N 217 ILE CA C sing N N 218 ILE CA CB sing N N 219 ILE CA HA sing N N 220 ILE C O doub N N 221 ILE C OXT sing N N 222 ILE CB CG1 sing N N 223 ILE CB CG2 sing N N 224 ILE CB HB sing N N 225 ILE CG1 CD1 sing N N 226 ILE CG1 HG12 sing N N 227 ILE CG1 HG13 sing N N 228 ILE CG2 HG21 sing N N 229 ILE CG2 HG22 sing N N 230 ILE CG2 HG23 sing N N 231 ILE CD1 HD11 sing N N 232 ILE CD1 HD12 sing N N 233 ILE CD1 HD13 sing N N 234 ILE OXT HXT sing N N 235 LEU N CA sing N N 236 LEU N H sing N N 237 LEU N H2 sing N N 238 LEU CA C sing N N 239 LEU CA CB sing N N 240 LEU CA HA sing N N 241 LEU C O doub N N 242 LEU C OXT sing N N 243 LEU CB CG sing N N 244 LEU CB HB2 sing N N 245 LEU CB HB3 sing N N 246 LEU CG CD1 sing N N 247 LEU CG CD2 sing N N 248 LEU CG HG sing N N 249 LEU CD1 HD11 sing N N 250 LEU CD1 HD12 sing N N 251 LEU CD1 HD13 sing N N 252 LEU CD2 HD21 sing N N 253 LEU CD2 HD22 sing N N 254 LEU CD2 HD23 sing N N 255 LEU OXT HXT sing N N 256 LYS N CA sing N N 257 LYS N H sing N N 258 LYS N H2 sing N N 259 LYS CA C sing N N 260 LYS CA CB sing N N 261 LYS CA HA sing N N 262 LYS C O doub N N 263 LYS C OXT sing N N 264 LYS CB CG sing N N 265 LYS CB HB2 sing N N 266 LYS CB HB3 sing N N 267 LYS CG CD sing N N 268 LYS CG HG2 sing N N 269 LYS CG HG3 sing N N 270 LYS CD CE sing N N 271 LYS CD HD2 sing N N 272 LYS CD HD3 sing N N 273 LYS CE NZ sing N N 274 LYS CE HE2 sing N N 275 LYS CE HE3 sing N N 276 LYS NZ HZ1 sing N N 277 LYS NZ HZ2 sing N N 278 LYS NZ HZ3 sing N N 279 LYS OXT HXT sing N N 280 MET N CA sing N N 281 MET N H sing N N 282 MET N H2 sing N N 283 MET CA C sing N N 284 MET CA CB sing N N 285 MET CA HA sing N N 286 MET C O doub N N 287 MET C OXT sing N N 288 MET CB CG sing N N 289 MET CB HB2 sing N N 290 MET CB HB3 sing N N 291 MET CG SD sing N N 292 MET CG HG2 sing N N 293 MET CG HG3 sing N N 294 MET SD CE sing N N 295 MET CE HE1 sing N N 296 MET CE HE2 sing N N 297 MET CE HE3 sing N N 298 MET OXT HXT sing N N 299 PHE N CA sing N N 300 PHE N H sing N N 301 PHE N H2 sing N N 302 PHE CA C sing N N 303 PHE CA CB sing N N 304 PHE CA HA sing N N 305 PHE C O doub N N 306 PHE C OXT sing N N 307 PHE CB CG sing N N 308 PHE CB HB2 sing N N 309 PHE CB HB3 sing N N 310 PHE CG CD1 doub Y N 311 PHE CG CD2 sing Y N 312 PHE CD1 CE1 sing Y N 313 PHE CD1 HD1 sing N N 314 PHE CD2 CE2 doub Y N 315 PHE CD2 HD2 sing N N 316 PHE CE1 CZ doub Y N 317 PHE CE1 HE1 sing N N 318 PHE CE2 CZ sing Y N 319 PHE CE2 HE2 sing N N 320 PHE CZ HZ sing N N 321 PHE OXT HXT sing N N 322 PRO N CA sing N N 323 PRO N CD sing N N 324 PRO N H sing N N 325 PRO CA C sing N N 326 PRO CA CB sing N N 327 PRO CA HA sing N N 328 PRO C O doub N N 329 PRO C OXT sing N N 330 PRO CB CG sing N N 331 PRO CB HB2 sing N N 332 PRO CB HB3 sing N N 333 PRO CG CD sing N N 334 PRO CG HG2 sing N N 335 PRO CG HG3 sing N N 336 PRO CD HD2 sing N N 337 PRO CD HD3 sing N N 338 PRO OXT HXT sing N N 339 SER N CA sing N N 340 SER N H sing N N 341 SER N H2 sing N N 342 SER CA C sing N N 343 SER CA CB sing N N 344 SER CA HA sing N N 345 SER C O doub N N 346 SER C OXT sing N N 347 SER CB OG sing N N 348 SER CB HB2 sing N N 349 SER CB HB3 sing N N 350 SER OG HG sing N N 351 SER OXT HXT sing N N 352 THR N CA sing N N 353 THR N H sing N N 354 THR N H2 sing N N 355 THR CA C sing N N 356 THR CA CB sing N N 357 THR CA HA sing N N 358 THR C O doub N N 359 THR C OXT sing N N 360 THR CB OG1 sing N N 361 THR CB CG2 sing N N 362 THR CB HB sing N N 363 THR OG1 HG1 sing N N 364 THR CG2 HG21 sing N N 365 THR CG2 HG22 sing N N 366 THR CG2 HG23 sing N N 367 THR OXT HXT sing N N 368 TRP N CA sing N N 369 TRP N H sing N N 370 TRP N H2 sing N N 371 TRP CA C sing N N 372 TRP CA CB sing N N 373 TRP CA HA sing N N 374 TRP C O doub N N 375 TRP C OXT sing N N 376 TRP CB CG sing N N 377 TRP CB HB2 sing N N 378 TRP CB HB3 sing N N 379 TRP CG CD1 doub Y N 380 TRP CG CD2 sing Y N 381 TRP CD1 NE1 sing Y N 382 TRP CD1 HD1 sing N N 383 TRP CD2 CE2 doub Y N 384 TRP CD2 CE3 sing Y N 385 TRP NE1 CE2 sing Y N 386 TRP NE1 HE1 sing N N 387 TRP CE2 CZ2 sing Y N 388 TRP CE3 CZ3 doub Y N 389 TRP CE3 HE3 sing N N 390 TRP CZ2 CH2 doub Y N 391 TRP CZ2 HZ2 sing N N 392 TRP CZ3 CH2 sing Y N 393 TRP CZ3 HZ3 sing N N 394 TRP CH2 HH2 sing N N 395 TRP OXT HXT sing N N 396 TYR N CA sing N N 397 TYR N H sing N N 398 TYR N H2 sing N N 399 TYR CA C sing N N 400 TYR CA CB sing N N 401 TYR CA HA sing N N 402 TYR C O doub N N 403 TYR C OXT sing N N 404 TYR CB CG sing N N 405 TYR CB HB2 sing N N 406 TYR CB HB3 sing N N 407 TYR CG CD1 doub Y N 408 TYR CG CD2 sing Y N 409 TYR CD1 CE1 sing Y N 410 TYR CD1 HD1 sing N N 411 TYR CD2 CE2 doub Y N 412 TYR CD2 HD2 sing N N 413 TYR CE1 CZ doub Y N 414 TYR CE1 HE1 sing N N 415 TYR CE2 CZ sing Y N 416 TYR CE2 HE2 sing N N 417 TYR CZ OH sing N N 418 TYR OH HH sing N N 419 TYR OXT HXT sing N N 420 VAL N CA sing N N 421 VAL N H sing N N 422 VAL N H2 sing N N 423 VAL CA C sing N N 424 VAL CA CB sing N N 425 VAL CA HA sing N N 426 VAL C O doub N N 427 VAL C OXT sing N N 428 VAL CB CG1 sing N N 429 VAL CB CG2 sing N N 430 VAL CB HB sing N N 431 VAL CG1 HG11 sing N N 432 VAL CG1 HG12 sing N N 433 VAL CG1 HG13 sing N N 434 VAL CG2 HG21 sing N N 435 VAL CG2 HG22 sing N N 436 VAL CG2 HG23 sing N N 437 VAL OXT HXT sing N N 438 # _pdbx_audit_support.funding_organization 'Italian Association for Cancer Research' _pdbx_audit_support.country Italy _pdbx_audit_support.grant_number 'MFAG 2017 - ID. 19882' _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id GJ4 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id GJ4 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5MGJ _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7QYV _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010649 _atom_sites.fract_transf_matrix[1][2] 0.006148 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012297 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.030091 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MG N O S # loop_