data_7R1C # _entry.id 7R1C # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.367 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7R1C pdb_00007r1c 10.2210/pdb7r1c/pdb WWPDB D_1292120776 ? ? EMDB EMD-14238 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type EMDB 'Cryo-EM structure of Bacillus megaterium gas vesicles - Small Section' EMD-14238 'associated EM volume' EMDB 'Cryo-EM structure of Bacillus megaterium gas vesicles - Entire Helical Assembly' EMD-14340 'other EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7R1C _pdbx_database_status.recvd_initial_deposition_date 2022-02-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Huber, S.T.' 1 0000-0003-3721-5104 'Evers, W.' 2 0000-0002-3413-5128 'Jakobi, A.J.' 3 0000-0002-7761-2027 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? ? ? ? primary Cell ? ? 1097-4172 ? ? 186 ? 975 986.e13 'Cryo-EM structure of gas vesicles for buoyancy-controlled motility.' 2023 ? 10.1016/j.cell.2023.01.041 36868215 ? ? ? ? ? ? ? ? ? US ? ? 1 Biorxiv ? ? 2692-8205 ? ? ? ? ? ? 'Cryo-EM structure of gas vesicles for buoyancy-controlled motility' 2022 ? 10.1101/2022.05.08.489936 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huber, S.T.' 1 ? primary 'Terwiel, D.' 2 ? primary 'Evers, W.H.' 3 ? primary 'Maresca, D.' 4 ? primary 'Jakobi, A.J.' 5 ? 1 'Huber, S.T.' 6 ? 1 'Terwiel, D.' 7 ? 1 'Evers, W.H.' 8 ? 1 'Maresca, D.' 9 ? 1 'Jakobi, A.J.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Gas vesicle structural protein' _entity.formula_weight 9626.850 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name GVP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSIQKSTNSSSLAEVIDRILDKGIVIDAFARVSVVGIEILTIEARVVIASVDTWLRYAEAVGLLRDDVEENGLPERSNSS EGQPRFSI ; _entity_poly.pdbx_seq_one_letter_code_can ;MSIQKSTNSSSLAEVIDRILDKGIVIDAFARVSVVGIEILTIEARVVIASVDTWLRYAEAVGLLRDDVEENGLPERSNSS EGQPRFSI ; _entity_poly.pdbx_strand_id N _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ILE n 1 4 GLN n 1 5 LYS n 1 6 SER n 1 7 THR n 1 8 ASN n 1 9 SER n 1 10 SER n 1 11 SER n 1 12 LEU n 1 13 ALA n 1 14 GLU n 1 15 VAL n 1 16 ILE n 1 17 ASP n 1 18 ARG n 1 19 ILE n 1 20 LEU n 1 21 ASP n 1 22 LYS n 1 23 GLY n 1 24 ILE n 1 25 VAL n 1 26 ILE n 1 27 ASP n 1 28 ALA n 1 29 PHE n 1 30 ALA n 1 31 ARG n 1 32 VAL n 1 33 SER n 1 34 VAL n 1 35 VAL n 1 36 GLY n 1 37 ILE n 1 38 GLU n 1 39 ILE n 1 40 LEU n 1 41 THR n 1 42 ILE n 1 43 GLU n 1 44 ALA n 1 45 ARG n 1 46 VAL n 1 47 VAL n 1 48 ILE n 1 49 ALA n 1 50 SER n 1 51 VAL n 1 52 ASP n 1 53 THR n 1 54 TRP n 1 55 LEU n 1 56 ARG n 1 57 TYR n 1 58 ALA n 1 59 GLU n 1 60 ALA n 1 61 VAL n 1 62 GLY n 1 63 LEU n 1 64 LEU n 1 65 ARG n 1 66 ASP n 1 67 ASP n 1 68 VAL n 1 69 GLU n 1 70 GLU n 1 71 ASN n 1 72 GLY n 1 73 LEU n 1 74 PRO n 1 75 GLU n 1 76 ARG n 1 77 SER n 1 78 ASN n 1 79 SER n 1 80 SER n 1 81 GLU n 1 82 GLY n 1 83 GLN n 1 84 PRO n 1 85 ARG n 1 86 PHE n 1 87 SER n 1 88 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 88 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'gvpA, BG04_216, G3M54_29730' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 14581 / DSM 32 / JCM 2506 / NBRC 15308 / NCIMB 9376 / NCTC 10342 / NRRL B-14308 / VKM B-512' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Priestia megaterium NBRC 15308 = ATCC 14581' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1348623 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21-DE3-pLysS _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0B6AAV2_BACMB _struct_ref.pdbx_db_accession A0A0B6AAV2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSIQKSTNSSSLAEVIDRILDKGIVIDAFARVSVVGIEILTIEARVVIASVDTWLRYAEAVGLLRDDVEENGLPERSNSS EGQPRFSI ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7R1C _struct_ref_seq.pdbx_strand_id N _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 88 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0B6AAV2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 88 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 88 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7R1C _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 7R1C _struct.title 'Cryo-EM structure of Bacillus megaterium gas vesicles' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7R1C _struct_keywords.text 'gas vesicle, buoyancy, helical, microbial motility, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 11 ? ASP A 21 ? SER N 11 ASP N 21 1 ? 11 HELX_P HELX_P2 AA2 SER A 50 ? GLY A 62 ? SER N 50 GLY N 62 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 24 ? VAL A 34 ? ILE N 24 VAL N 34 AA1 2 ILE A 37 ? ILE A 48 ? ILE N 37 ILE N 48 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 34 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id N _pdbx_struct_sheet_hbond.range_1_auth_seq_id 34 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 37 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id N _pdbx_struct_sheet_hbond.range_2_auth_seq_id 37 # _atom_sites.entry_id 7R1C _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? N . n A 1 2 SER 2 2 2 SER SER N . n A 1 3 ILE 3 3 3 ILE ILE N . n A 1 4 GLN 4 4 4 GLN GLN N . n A 1 5 LYS 5 5 5 LYS LYS N . n A 1 6 SER 6 6 6 SER SER N . n A 1 7 THR 7 7 7 THR THR N . n A 1 8 ASN 8 8 8 ASN ASN N . n A 1 9 SER 9 9 9 SER SER N . n A 1 10 SER 10 10 10 SER SER N . n A 1 11 SER 11 11 11 SER SER N . n A 1 12 LEU 12 12 12 LEU LEU N . n A 1 13 ALA 13 13 13 ALA ALA N . n A 1 14 GLU 14 14 14 GLU GLU N . n A 1 15 VAL 15 15 15 VAL VAL N . n A 1 16 ILE 16 16 16 ILE ILE N . n A 1 17 ASP 17 17 17 ASP ASP N . n A 1 18 ARG 18 18 18 ARG ARG N . n A 1 19 ILE 19 19 19 ILE ILE N . n A 1 20 LEU 20 20 20 LEU LEU N . n A 1 21 ASP 21 21 21 ASP ASP N . n A 1 22 LYS 22 22 22 LYS LYS N . n A 1 23 GLY 23 23 23 GLY GLY N . n A 1 24 ILE 24 24 24 ILE ILE N . n A 1 25 VAL 25 25 25 VAL VAL N . n A 1 26 ILE 26 26 26 ILE ILE N . n A 1 27 ASP 27 27 27 ASP ASP N . n A 1 28 ALA 28 28 28 ALA ALA N . n A 1 29 PHE 29 29 29 PHE PHE N . n A 1 30 ALA 30 30 30 ALA ALA N . n A 1 31 ARG 31 31 31 ARG ARG N . n A 1 32 VAL 32 32 32 VAL VAL N . n A 1 33 SER 33 33 33 SER SER N . n A 1 34 VAL 34 34 34 VAL VAL N . n A 1 35 VAL 35 35 35 VAL VAL N . n A 1 36 GLY 36 36 36 GLY GLY N . n A 1 37 ILE 37 37 37 ILE ILE N . n A 1 38 GLU 38 38 38 GLU GLU N . n A 1 39 ILE 39 39 39 ILE ILE N . n A 1 40 LEU 40 40 40 LEU LEU N . n A 1 41 THR 41 41 41 THR THR N . n A 1 42 ILE 42 42 42 ILE ILE N . n A 1 43 GLU 43 43 43 GLU GLU N . n A 1 44 ALA 44 44 44 ALA ALA N . n A 1 45 ARG 45 45 45 ARG ARG N . n A 1 46 VAL 46 46 46 VAL VAL N . n A 1 47 VAL 47 47 47 VAL VAL N . n A 1 48 ILE 48 48 48 ILE ILE N . n A 1 49 ALA 49 49 49 ALA ALA N . n A 1 50 SER 50 50 50 SER SER N . n A 1 51 VAL 51 51 51 VAL VAL N . n A 1 52 ASP 52 52 52 ASP ASP N . n A 1 53 THR 53 53 53 THR THR N . n A 1 54 TRP 54 54 54 TRP TRP N . n A 1 55 LEU 55 55 55 LEU LEU N . n A 1 56 ARG 56 56 56 ARG ARG N . n A 1 57 TYR 57 57 57 TYR TYR N . n A 1 58 ALA 58 58 58 ALA ALA N . n A 1 59 GLU 59 59 59 GLU GLU N . n A 1 60 ALA 60 60 60 ALA ALA N . n A 1 61 VAL 61 61 61 VAL VAL N . n A 1 62 GLY 62 62 62 GLY GLY N . n A 1 63 LEU 63 63 63 LEU LEU N . n A 1 64 LEU 64 64 64 LEU LEU N . n A 1 65 ARG 65 65 65 ARG ARG N . n A 1 66 ASP 66 66 66 ASP ASP N . n A 1 67 ASP 67 67 ? ? ? N . n A 1 68 VAL 68 68 ? ? ? N . n A 1 69 GLU 69 69 ? ? ? N . n A 1 70 GLU 70 70 ? ? ? N . n A 1 71 ASN 71 71 ? ? ? N . n A 1 72 GLY 72 72 ? ? ? N . n A 1 73 LEU 73 73 ? ? ? N . n A 1 74 PRO 74 74 ? ? ? N . n A 1 75 GLU 75 75 ? ? ? N . n A 1 76 ARG 76 76 ? ? ? N . n A 1 77 SER 77 77 ? ? ? N . n A 1 78 ASN 78 78 ? ? ? N . n A 1 79 SER 79 79 ? ? ? N . n A 1 80 SER 80 80 ? ? ? N . n A 1 81 GLU 81 81 ? ? ? N . n A 1 82 GLY 82 82 ? ? ? N . n A 1 83 GLN 83 83 ? ? ? N . n A 1 84 PRO 84 84 ? ? ? N . n A 1 85 ARG 85 85 ? ? ? N . n A 1 86 PHE 86 86 ? ? ? N . n A 1 87 SER 87 87 ? ? ? N . n A 1 88 ILE 88 88 ? ? ? N . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email a.jakobi@tudelft.nl _pdbx_contact_author.name_first Arjen _pdbx_contact_author.name_last Jakobi _pdbx_contact_author.name_mi J _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7761-2027 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? 'Example of gas vesicle rib formed by lateral connections of GvpB/A2 monomers' 5 2 author_defined_assembly ? 'Single helical turn of a gas vesicle formed by lateral connections and rib-to-rib connections of GvpB/A2 monomers' 100 3 author_defined_assembly ? 'Cylinder made from 930 monomers of GvpB/A2 formed by helical repetition' 930 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2,3,4,5 A 2 ;1,10,100,11,12,13,14,15,16,17,18,19,2,20,21,22,23,24,25,26,27,28,29,3,30,31,32,33,34,35,36,37,38,39,4,40,41,42,43,44,45,46,47,48,49,5,50,51,52,53,54,55,56,57,58,59,6,60,61,62,63,64,65,66,67,68,69,7,70,71,72,73,74,75,76,77,78,79,8,80,81,82,83,84,85,86,87,88,89,9,90,91,92,93,94,95,96,97,98,99 ; A 3 ;1,10,100,101,102,103,104,105,106,107,108,109,11,110,111,112,113,114,115,116,117,118,119,12,120,121,122,123,124,125,126,127,128,129,13,130,131,132,133,134,135,136,137,138,139,14,140,141,142,143,144,145,146,147,148,149,15,150,151,152,153,154,155,156,157,158,159,16,160,161,162,163,164,165,166,167,168,169,17,170,171,172,173,174,175,176,177,178,179,18,180,181,182,183,184,185,186,187,188,189,19,190,191,192,193,194,195,196,197,198,199,2,20,200,201,202,203,204,205,206,207,208,209,21,210,211,212,213,214,215,216,217,218,219,22,220,221,222,223,224,225,226,227,228,229,23,230,231,232,233,234,235,236,237,238,239,24,240,241,242,243,244,245,246,247,248,249,25,250,251,252,253,254,255,256,257,258,259,26,260,261,262,263,264,265,266,267,268,269,27,270,271,272,273,274,275,276,277,278,279,28,280,281,282,283,284,285,286,287,288,289,29,290,291,292,293,294,295,296,297,298,299,3,30,300,301,302,303,304,305,306,307,308,309,31,310,311,312,313,314,315,316,317,318,319,32,320,321,322,323,324,325,326,327,328,329,33,330,331,332,333,334,335,336,337,338,339,34,340,341,342,343,344,345,346,347,348,349,35,350,351,352,353,354,355,356,357,358,359,36,360,361,362,363,364,365,366,367,368,369,37,370,371,372,373,374,375,376,377,378,379,38,380,381,382,383,384,385,386,387,388,389,39,390,391,392,393,394,395,396,397,398,399,4,40,400,401,402,403,404,405,406,407,408,409,41,410,411,412,413,414,415,416,417,418,419,42,420,421,422,423,424,425,426,427,428,429,43,430,431,432,433,434,435,436,437,438,439,44,440,441,442,443,444,445,446,447,448,449,45,450,451,452,453,454,455,456,457,458,459,46,460,461,462,463,464,465,466,467,468,469,47,470,471,472,473,474,475,476,477,478,479,48,480,481,482,483,484,485,486,487,488,489,49,490,491,492,493,494,495,496,497,498,499,5,50,500,501,502,503,504,505,506,507,508,509,51,510,511,512,513,514,515,516,517,518,519,52,520,521,522,523,524,525,526,527,528,529,53,530,531,532,533,534,535,536,537,538,539,54,540,541,542,543,544,545,546,547,548,549,55,550,551,552,553,554,555,556,557,558,559,56,560,561,562,563,564,565,566,567,568,569,57,570,571,572,573,574,575,576,577,578,579,58,580,581,582,583,584,585,586,587,588,589,59,590,591,592,593,594,595,596,597,598,599,6,60,600,601,602,603,604,605,606,607,608,609,61,610,611,612,613,614,615,616,617,618,619,62,620,621,622,623,624,625,626,627,628,629,63,630,631,632,633,634,635,636,637,638,639,64,640,641,642,643,644,645,646,647,648,649,65,650,651,652,653,654,655,656,657,658,659,66,660,661,662,663,664,665,666,667,668,669,67,670,671,672,673,674,675,676,677,678,679,68,680,681,682,683,684,685,686,687,688,689,69,690,691,692,693,694,695,696,697,698,699,7,70,700,701,702,703,704,705,706,707,708,709,71,710,711,712,713,714,715,716,717,718,719,72,720,721,722,723,724,725,726,727,728,729,73,730,731,732,733,734,735,736,737,738,739,74,740,741,742,743,744,745,746,747,748,749,75,750,751,752,753,754,755,756,757,758,759,76,760,761,762,763,764,765,766,767,768,769,77,770,771,772,773,774,775,776,777,778,779,78,780,781,782,783,784,785,786,787,788,789,79,790,791,792,793,794,795,796,797,798,799,8,80,800,801,802,803,804,805,806,807,808,809,81,810,811,812,813,814,815,816,817,818,819,82,820,821,822,823,824,825,826,827,828,829,83,830,831,832,833,834,835,836,837,838,839,84,840,841,842,843,844,845,846,847,848,849,85,850,851,852,853,854,855,856,857,858,859,86,860,861,862,863,864,865,866,867,868,869,87,870,871,872,873,874,875,876,877,878,879,88,880,881,882,883,884,885,886,887,888,889,89,890,891,892,893,894,895,896,897,898,899,9,90,900,901,902,903,904,905,906,907,908,909,91,910,911,912,913,914,915,916,917,918,919,92,920,921,922,923,924,925,926,927,928,929,93,930,94,95,96,97,98,99 ; A # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.000000 -0.000000 0.000000 0.00000 -0.000000 1.000000 0.000000 0.00000 0.000000 0.000000 1.000000 0.00000 2 'point symmetry operation' ? ? 0.997715 0.067562 0.000000 0.00000 -0.067562 0.997715 0.000000 0.00000 0.000000 0.000000 1.000000 0.52570 3 'point symmetry operation' ? ? 0.990871 0.134816 0.000000 0.00000 -0.134816 0.990871 0.000000 0.00000 0.000000 0.000000 1.000000 1.05140 4 'point symmetry operation' ? ? 0.979498 0.201454 0.000000 0.00000 -0.201454 0.979498 -0.000000 0.00000 0.000000 0.000000 1.000000 1.57710 5 'point symmetry operation' ? ? 0.963649 0.267170 0.000000 0.00000 -0.267170 0.963649 -0.000000 0.00000 0.000000 0.000000 1.000000 2.10280 6 'point symmetry operation' ? ? 0.943397 0.331666 0.000000 -0.00000 -0.331666 0.943397 -0.000000 0.00000 0.000000 0.000000 1.000000 2.62850 7 'point symmetry operation' ? ? 0.918833 0.394647 0.000000 -0.00000 -0.394647 0.918833 -0.000000 0.00000 0.000000 0.000000 1.000000 3.15420 8 'point symmetry operation' ? ? 0.890070 0.455823 0.000000 -0.00000 -0.455823 0.890070 -0.000000 0.00000 0.000000 0.000000 1.000000 3.67990 9 'point symmetry operation' ? ? 0.857240 0.514917 0.000000 -0.00000 -0.514917 0.857240 -0.000000 0.00000 0.000000 0.000000 1.000000 4.20560 10 'point symmetry operation' ? ? 0.820492 0.571658 0.000000 -0.00000 -0.571658 0.820492 -0.000000 0.00000 0.000000 0.000000 1.000000 4.73130 11 'point symmetry operation' ? ? 0.779995 0.625786 0.000000 -0.00000 -0.625786 0.779995 -0.000000 0.00000 0.000000 0.000000 1.000000 5.25700 12 'point symmetry operation' ? ? 0.735933 0.677054 0.000000 -0.00000 -0.677054 0.735933 -0.000000 0.00000 0.000000 0.000000 1.000000 5.78270 13 'point symmetry operation' ? ? 0.688508 0.725229 0.000000 -0.00000 -0.725229 0.688508 -0.000000 0.00000 0.000000 0.000000 1.000000 6.30840 14 'point symmetry operation' ? ? 0.637937 0.770089 0.000000 -0.00000 -0.770089 0.637937 -0.000000 0.00000 0.000000 0.000000 1.000000 6.83410 15 'point symmetry operation' ? ? 0.584450 0.811430 0.000000 -0.00000 -0.811430 0.584450 -0.000000 0.00000 0.000000 0.000000 1.000000 7.35980 16 'point symmetry operation' ? ? 0.528292 0.849063 0.000000 -0.00000 -0.849063 0.528292 -0.000000 0.00000 0.000000 0.000000 1.000000 7.88550 17 'point symmetry operation' ? ? 0.469721 0.882815 0.000000 -0.00000 -0.882815 0.469721 -0.000000 0.00000 0.000000 0.000000 1.000000 8.41120 18 'point symmetry operation' ? ? 0.409002 0.912533 0.000000 -0.00000 -0.912533 0.409002 -0.000000 0.00000 0.000000 0.000000 1.000000 8.93690 19 'point symmetry operation' ? ? 0.346415 0.938081 0.000000 -0.00000 -0.938081 0.346415 -0.000000 0.00000 0.000000 0.000000 1.000000 9.46260 20 'point symmetry operation' ? ? 0.282244 0.959343 0.000000 -0.00000 -0.959343 0.282244 -0.000000 0.00000 0.000000 0.000000 1.000000 9.98830 21 'point symmetry operation' ? ? 0.216784 0.976220 0.000000 -0.00000 -0.976220 0.216784 -0.000000 0.00000 0.000000 0.000000 1.000000 10.51400 22 'point symmetry operation' ? ? 0.150333 0.988635 0.000000 -0.00000 -0.988635 0.150333 -0.000000 0.00000 0.000000 0.000000 1.000000 11.03970 23 'point symmetry operation' ? ? 0.083195 0.996533 0.000000 -0.00000 -0.996533 0.083195 -0.000000 0.00000 0.000000 0.000000 1.000000 11.56540 24 'point symmetry operation' ? ? 0.015676 0.999877 0.000000 -0.00000 -0.999877 0.015676 -0.000000 0.00000 0.000000 0.000000 1.000000 12.09110 25 'point symmetry operation' ? ? -0.051913 0.998652 0.000000 -0.00000 -0.998652 -0.051913 -0.000000 0.00000 0.000000 0.000000 1.000000 12.61680 26 'point symmetry operation' ? ? -0.119266 0.992862 0.000000 -0.00000 -0.992862 -0.119266 -0.000000 0.00000 0.000000 0.000000 1.000000 13.14250 27 'point symmetry operation' ? ? -0.186074 0.982536 0.000000 -0.00000 -0.982536 -0.186074 -0.000000 0.00000 0.000000 0.000000 1.000000 13.66820 28 'point symmetry operation' ? ? -0.252031 0.967719 0.000000 -0.00000 -0.967719 -0.252031 -0.000000 0.00000 0.000000 0.000000 1.000000 14.19390 29 'point symmetry operation' ? ? -0.316837 0.948480 0.000000 -0.00000 -0.948480 -0.316837 -0.000000 0.00000 0.000000 0.000000 1.000000 14.71960 30 'point symmetry operation' ? ? -0.380194 0.924907 0.000000 -0.00000 -0.924907 -0.380194 -0.000000 0.00000 0.000000 0.000000 1.000000 15.24530 31 'point symmetry operation' ? ? -0.441814 0.897107 0.000000 -0.00000 -0.897107 -0.441814 -0.000000 0.00000 0.000000 0.000000 1.000000 15.77100 32 'point symmetry operation' ? ? -0.501415 0.865207 0.000000 -0.00000 -0.865207 -0.501415 -0.000000 0.00000 0.000000 0.000000 1.000000 16.29670 33 'point symmetry operation' ? ? -0.558725 0.829353 0.000000 -0.00000 -0.829353 -0.558725 -0.000000 0.00000 0.000000 0.000000 1.000000 16.82240 34 'point symmetry operation' ? ? -0.613482 0.789709 0.000000 -0.00000 -0.789709 -0.613482 -0.000000 0.00000 0.000000 0.000000 1.000000 17.34810 35 'point symmetry operation' ? ? -0.665434 0.746456 0.000000 -0.00000 -0.746456 -0.665434 -0.000000 0.00000 0.000000 0.000000 1.000000 17.87380 36 'point symmetry operation' ? ? -0.714346 0.699792 0.000000 0.00000 -0.699792 -0.714346 -0.000000 0.00000 0.000000 0.000000 1.000000 18.39950 37 'point symmetry operation' ? ? -0.759994 0.649930 0.000000 0.00000 -0.649930 -0.759994 -0.000000 0.00000 0.000000 0.000000 1.000000 18.92520 38 'point symmetry operation' ? ? -0.802168 0.597098 0.000000 0.00000 -0.597098 -0.802168 -0.000000 0.00000 0.000000 0.000000 1.000000 19.45090 39 'point symmetry operation' ? ? -0.840676 0.541538 0.000000 0.00000 -0.541538 -0.840676 -0.000000 0.00000 0.000000 0.000000 1.000000 19.97660 40 'point symmetry operation' ? ? -0.875343 0.483502 0.000000 0.00000 -0.483502 -0.875343 -0.000000 0.00000 0.000000 0.000000 1.000000 20.50230 41 'point symmetry operation' ? ? -0.906010 0.423257 0.000000 0.00000 -0.423257 -0.906010 -0.000000 0.00000 0.000000 0.000000 1.000000 21.02800 42 'point symmetry operation' ? ? -0.932536 0.361078 0.000000 0.00000 -0.361078 -0.932536 -0.000000 0.00000 0.000000 0.000000 1.000000 21.55370 43 'point symmetry operation' ? ? -0.954800 0.297249 0.000000 0.00000 -0.297249 -0.954800 -0.000000 0.00000 0.000000 0.000000 1.000000 22.07940 44 'point symmetry operation' ? ? -0.972701 0.232061 0.000000 0.00000 -0.232061 -0.972701 -0.000000 0.00000 0.000000 0.000000 1.000000 22.60510 45 'point symmetry operation' ? ? -0.986157 0.165813 0.000000 0.00000 -0.165813 -0.986157 -0.000000 0.00000 -0.000000 0.000000 1.000000 23.13080 46 'point symmetry operation' ? ? -0.995107 0.098807 0.000000 0.00000 -0.098807 -0.995107 -0.000000 0.00000 -0.000000 0.000000 1.000000 23.65650 47 'point symmetry operation' ? ? -0.999508 0.031349 0.000000 0.00000 -0.031349 -0.999508 -0.000000 0.00000 -0.000000 0.000000 1.000000 24.18220 48 'point symmetry operation' ? ? -0.999343 -0.036252 -0.000000 0.00000 0.036252 -0.999343 0.000000 0.00000 0.000000 -0.000000 1.000000 24.70790 49 'point symmetry operation' ? ? -0.994610 -0.103687 -0.000000 0.00000 0.103687 -0.994610 0.000000 0.00000 0.000000 -0.000000 1.000000 25.23360 50 'point symmetry operation' ? ? -0.985332 -0.170648 -0.000000 0.00000 0.170648 -0.985332 0.000000 0.00000 0.000000 -0.000000 1.000000 25.75930 51 'point symmetry operation' ? ? -0.971551 -0.236830 0.000000 0.00000 0.236830 -0.971551 0.000000 0.00000 0.000000 -0.000000 1.000000 26.28500 52 'point symmetry operation' ? ? -0.953330 -0.301929 0.000000 0.00000 0.301929 -0.953330 0.000000 0.00000 0.000000 -0.000000 1.000000 26.81070 53 'point symmetry operation' ? ? -0.930753 -0.365648 0.000000 0.00000 0.365648 -0.930753 0.000000 0.00000 0.000000 -0.000000 1.000000 27.33640 54 'point symmetry operation' ? ? -0.903922 -0.427697 0.000000 0.00000 0.427697 -0.903922 0.000000 0.00000 0.000000 -0.000000 1.000000 27.86210 55 'point symmetry operation' ? ? -0.872961 -0.487790 0.000000 0.00000 0.487790 -0.872961 0.000000 0.00000 0.000000 -0.000000 1.000000 28.38780 56 'point symmetry operation' ? ? -0.838010 -0.545655 0.000000 0.00000 0.545655 -0.838010 0.000000 0.00000 0.000000 -0.000000 1.000000 28.91350 57 'point symmetry operation' ? ? -0.799229 -0.601026 0.000000 0.00000 0.601026 -0.799229 0.000000 0.00000 0.000000 -0.000000 1.000000 29.43920 58 'point symmetry operation' ? ? -0.756796 -0.653651 0.000000 0.00000 0.653651 -0.756796 0.000000 0.00000 0.000000 -0.000000 1.000000 29.96490 59 'point symmetry operation' ? ? -0.710905 -0.703288 0.000000 0.00000 0.703288 -0.710905 0.000000 0.00000 0.000000 -0.000000 1.000000 30.49060 60 'point symmetry operation' ? ? -0.661765 -0.749712 0.000000 0.00000 0.749712 -0.661765 0.000000 0.00000 0.000000 -0.000000 1.000000 31.01630 61 'point symmetry operation' ? ? -0.609600 -0.792709 0.000000 0.00000 0.792709 -0.609600 0.000000 0.00000 0.000000 -0.000000 1.000000 31.54200 62 'point symmetry operation' ? ? -0.554650 -0.832084 0.000000 0.00000 0.832084 -0.554650 0.000000 0.00000 0.000000 -0.000000 1.000000 32.06770 63 'point symmetry operation' ? ? -0.497165 -0.867656 0.000000 0.00000 0.867656 -0.497165 0.000000 0.00000 0.000000 -0.000000 1.000000 32.59340 64 'point symmetry operation' ? ? -0.437408 -0.899263 0.000000 0.00000 0.899263 -0.437408 0.000000 0.00000 0.000000 -0.000000 1.000000 33.11910 65 'point symmetry operation' ? ? -0.375652 -0.926761 0.000000 0.00000 0.926761 -0.375652 0.000000 0.00000 0.000000 -0.000000 1.000000 33.64480 66 'point symmetry operation' ? ? -0.312180 -0.950023 0.000000 0.00000 0.950023 -0.312180 0.000000 0.00000 0.000000 -0.000000 1.000000 34.17050 67 'point symmetry operation' ? ? -0.247281 -0.968944 0.000000 0.00000 0.968944 -0.247281 0.000000 0.00000 0.000000 -0.000000 1.000000 34.69620 68 'point symmetry operation' ? ? -0.181252 -0.983437 0.000000 0.00000 0.983437 -0.181252 0.000000 0.00000 0.000000 -0.000000 1.000000 35.22190 69 'point symmetry operation' ? ? -0.114394 -0.993435 0.000000 0.00000 0.993435 -0.114394 0.000000 0.00000 0.000000 -0.000000 1.000000 35.74760 70 'point symmetry operation' ? ? -0.047014 -0.998894 0.000000 0.00000 0.998894 -0.047014 0.000000 0.00000 0.000000 -0.000000 1.000000 36.27330 71 'point symmetry operation' ? ? 0.020581 -0.999788 0.000000 0.00000 0.999788 0.020581 0.000000 0.00000 0.000000 -0.000000 1.000000 36.79900 72 'point symmetry operation' ? ? 0.088082 -0.996113 0.000000 0.00000 0.996113 0.088082 0.000000 0.00000 0.000000 -0.000000 1.000000 37.32470 73 'point symmetry operation' ? ? 0.155181 -0.987886 0.000000 0.00000 0.987886 0.155181 0.000000 0.00000 0.000000 -0.000000 1.000000 37.85040 74 'point symmetry operation' ? ? 0.221570 -0.975144 0.000000 0.00000 0.975144 0.221570 0.000000 0.00000 0.000000 -0.000000 1.000000 38.37610 75 'point symmetry operation' ? ? 0.286947 -0.957946 0.000000 0.00000 0.957946 0.286947 0.000000 0.00000 0.000000 -0.000000 1.000000 38.90180 76 'point symmetry operation' ? ? 0.351012 -0.936371 0.000000 0.00000 0.936371 0.351012 0.000000 0.00000 0.000000 -0.000000 1.000000 39.42750 77 'point symmetry operation' ? ? 0.413474 -0.910516 0.000000 0.00000 0.910516 0.413474 0.000000 0.00000 0.000000 -0.000000 1.000000 39.95320 78 'point symmetry operation' ? ? 0.474046 -0.880500 0.000000 0.00000 0.880500 0.474046 0.000000 0.00000 0.000000 -0.000000 1.000000 40.47890 79 'point symmetry operation' ? ? 0.532451 -0.846461 0.000000 0.00000 0.846461 0.532451 0.000000 0.00000 0.000000 -0.000000 1.000000 41.00460 80 'point symmetry operation' ? ? 0.588423 -0.808553 0.000000 0.00000 0.808553 0.588423 0.000000 0.00000 0.000000 -0.000000 1.000000 41.53030 81 'point symmetry operation' ? ? 0.641707 -0.766950 0.000000 0.00000 0.766950 0.641707 0.000000 0.00000 0.000000 -0.000000 1.000000 42.05600 82 'point symmetry operation' ? ? 0.692057 -0.721842 0.000000 0.00000 0.721842 0.692057 0.000000 0.00000 0.000000 -0.000000 1.000000 42.58170 83 'point symmetry operation' ? ? 0.739245 -0.673436 0.000000 0.00000 0.673436 0.739245 0.000000 0.00000 0.000000 -0.000000 1.000000 43.10740 84 'point symmetry operation' ? ? 0.783055 -0.621952 0.000000 0.00000 0.621952 0.783055 0.000000 0.00000 0.000000 -0.000000 1.000000 43.63310 85 'point symmetry operation' ? ? 0.823287 -0.567626 0.000000 0.00000 0.567626 0.823287 0.000000 0.00000 0.000000 -0.000000 1.000000 44.15880 86 'point symmetry operation' ? ? 0.859756 -0.510706 0.000000 0.00000 0.510706 0.859756 0.000000 0.00000 0.000000 -0.000000 1.000000 44.68450 87 'point symmetry operation' ? ? 0.892296 -0.451452 0.000000 0.00000 0.451452 0.892296 0.000000 0.00000 0.000000 -0.000000 1.000000 45.21020 88 'point symmetry operation' ? ? 0.920758 -0.390135 0.000000 0.00000 0.390135 0.920758 0.000000 0.00000 0.000000 -0.000000 1.000000 45.73590 89 'point symmetry operation' ? ? 0.945012 -0.327034 0.000000 0.00000 0.327034 0.945012 0.000000 0.00000 0.000000 -0.000000 1.000000 46.26160 90 'point symmetry operation' ? ? 0.964948 -0.262440 0.000000 0.00000 0.262440 0.964948 0.000000 0.00000 0.000000 -0.000000 1.000000 46.78730 91 'point symmetry operation' ? ? 0.980475 -0.196646 0.000000 0.00000 0.196646 0.980475 0.000000 0.00000 0.000000 0.000000 1.000000 47.31300 92 'point symmetry operation' ? ? 0.991520 -0.129954 0.000000 0.00000 0.129954 0.991520 0.000000 0.00000 0.000000 0.000000 1.000000 47.83870 93 'point symmetry operation' ? ? 0.998034 -0.062667 0.000000 0.00000 0.062667 0.998034 0.000000 0.00000 0.000000 0.000000 1.000000 48.36440 94 'point symmetry operation' ? ? 0.999988 0.004906 0.000000 0.00000 -0.004906 0.999988 0.000000 0.00000 0.000000 0.000000 1.000000 48.89010 95 'point symmetry operation' ? ? 0.997372 0.072456 0.000000 0.00000 -0.072456 0.997372 0.000000 0.00000 0.000000 0.000000 1.000000 49.41580 96 'point symmetry operation' ? ? 0.990197 0.139675 0.000000 0.00000 -0.139675 0.990197 0.000000 0.00000 0.000000 0.000000 1.000000 49.94150 97 'point symmetry operation' ? ? 0.978498 0.206256 0.000000 0.00000 -0.206256 0.978498 -0.000000 0.00000 0.000000 0.000000 1.000000 50.46720 98 'point symmetry operation' ? ? 0.962327 0.271894 0.000000 0.00000 -0.271894 0.962327 -0.000000 0.00000 0.000000 0.000000 1.000000 50.99290 99 'point symmetry operation' ? ? 0.941758 0.336290 0.000000 0.00000 -0.336290 0.941758 -0.000000 0.00000 0.000000 0.000000 1.000000 51.51860 100 'point symmetry operation' ? ? 0.916886 0.399149 0.000000 0.00000 -0.399149 0.916886 -0.000000 0.00000 0.000000 0.000000 1.000000 52.04430 101 'point symmetry operation' ? ? 0.887823 0.460184 -0.000000 -0.00000 -0.460184 0.887823 0.000000 0.00000 -0.000000 -0.000000 1.000000 52.57000 102 'point symmetry operation' ? ? 0.854704 0.519116 -0.000000 -0.00000 -0.519116 0.854704 0.000000 0.00000 -0.000000 -0.000000 1.000000 53.09570 103 'point symmetry operation' ? ? 0.817678 0.575676 -0.000000 -0.00000 -0.575676 0.817678 0.000000 0.00000 -0.000000 -0.000000 1.000000 53.62140 104 'point symmetry operation' ? ? 0.776916 0.629605 -0.000000 -0.00000 -0.629605 0.776916 0.000000 0.00000 -0.000000 -0.000000 1.000000 54.14710 105 'point symmetry operation' ? ? 0.732603 0.680656 -0.000000 -0.00000 -0.680656 0.732603 0.000000 0.00000 -0.000000 -0.000000 1.000000 54.67280 106 'point symmetry operation' ? ? 0.684942 0.728598 -0.000000 -0.00000 -0.728598 0.684942 0.000000 0.00000 -0.000000 -0.000000 1.000000 55.19850 107 'point symmetry operation' ? ? 0.634151 0.773209 -0.000000 -0.00000 -0.773209 0.634151 0.000000 0.00000 -0.000000 -0.000000 1.000000 55.72420 108 'point symmetry operation' ? ? 0.580462 0.814287 -0.000000 -0.00000 -0.814287 0.580462 0.000000 0.00000 -0.000000 -0.000000 1.000000 56.24990 109 'point symmetry operation' ? ? 0.524121 0.851644 -0.000000 -0.00000 -0.851644 0.524121 0.000000 0.00000 -0.000000 -0.000000 1.000000 56.77560 110 'point symmetry operation' ? ? 0.465384 0.885109 -0.000000 -0.00000 -0.885109 0.465384 0.000000 0.00000 -0.000000 -0.000000 1.000000 57.30130 111 'point symmetry operation' ? ? 0.404521 0.914529 -0.000000 -0.00000 -0.914529 0.404521 0.000000 0.00000 -0.000000 -0.000000 1.000000 57.82700 112 'point symmetry operation' ? ? 0.341809 0.939770 -0.000000 -0.00000 -0.939770 0.341809 0.000000 0.00000 -0.000000 -0.000000 1.000000 58.35270 113 'point symmetry operation' ? ? 0.277535 0.960716 -0.000000 -0.00000 -0.960716 0.277535 0.000000 0.00000 -0.000000 -0.000000 1.000000 58.87840 114 'point symmetry operation' ? ? 0.211992 0.977271 -0.000000 -0.00000 -0.977271 0.211992 0.000000 0.00000 -0.000000 -0.000000 1.000000 59.40410 115 'point symmetry operation' ? ? 0.145481 0.989361 -0.000000 -0.00000 -0.989361 0.145481 0.000000 0.00000 -0.000000 -0.000000 1.000000 59.92980 116 'point symmetry operation' ? ? 0.078305 0.996929 -0.000000 -0.00000 -0.996929 0.078305 0.000000 0.00000 -0.000000 -0.000000 1.000000 60.45550 117 'point symmetry operation' ? ? 0.010771 0.999942 -0.000000 -0.00000 -0.999942 0.010771 0.000000 0.00000 -0.000000 -0.000000 1.000000 60.98120 118 'point symmetry operation' ? ? -0.056812 0.998385 -0.000000 -0.00000 -0.998385 -0.056812 0.000000 0.00000 -0.000000 -0.000000 1.000000 61.50690 119 'point symmetry operation' ? ? -0.124135 0.992265 -0.000000 -0.00000 -0.992265 -0.124135 0.000000 0.00000 -0.000000 -0.000000 1.000000 62.03260 120 'point symmetry operation' ? ? -0.190891 0.981611 -0.000000 -0.00000 -0.981611 -0.190891 0.000000 0.00000 -0.000000 -0.000000 1.000000 62.55830 121 'point symmetry operation' ? ? -0.256775 0.966471 -0.000000 -0.00000 -0.966471 -0.256775 0.000000 0.00000 -0.000000 -0.000000 1.000000 63.08400 122 'point symmetry operation' ? ? -0.321486 0.946914 -0.000000 -0.00000 -0.946914 -0.321486 0.000000 0.00000 -0.000000 -0.000000 1.000000 63.60970 123 'point symmetry operation' ? ? -0.384727 0.923030 -0.000000 -0.00000 -0.923030 -0.384727 0.000000 0.00000 -0.000000 -0.000000 1.000000 64.13540 124 'point symmetry operation' ? ? -0.446210 0.894928 -0.000000 -0.00000 -0.894928 -0.446210 0.000000 0.00000 -0.000000 -0.000000 1.000000 64.66110 125 'point symmetry operation' ? ? -0.505654 0.862737 -0.000000 -0.00000 -0.862737 -0.505654 0.000000 0.00000 -0.000000 -0.000000 1.000000 65.18680 126 'point symmetry operation' ? ? -0.562787 0.826602 -0.000000 -0.00000 -0.826602 -0.562787 0.000000 0.00000 -0.000000 -0.000000 1.000000 65.71250 127 'point symmetry operation' ? ? -0.617348 0.786690 -0.000000 -0.00000 -0.786690 -0.617348 0.000000 0.00000 -0.000000 -0.000000 1.000000 66.23820 128 'point symmetry operation' ? ? -0.669088 0.743183 -0.000000 0.00000 -0.743183 -0.669088 0.000000 0.00000 -0.000000 -0.000000 1.000000 66.76390 129 'point symmetry operation' ? ? -0.717771 0.696280 -0.000000 0.00000 -0.696280 -0.717771 0.000000 0.00000 -0.000000 -0.000000 1.000000 67.28960 130 'point symmetry operation' ? ? -0.763173 0.646194 -0.000000 0.00000 -0.646194 -0.763173 0.000000 0.00000 -0.000000 -0.000000 1.000000 67.81530 131 'point symmetry operation' ? ? -0.805087 0.593156 -0.000000 0.00000 -0.593156 -0.805087 0.000000 0.00000 -0.000000 -0.000000 1.000000 68.34100 132 'point symmetry operation' ? ? -0.843323 0.537407 -0.000000 0.00000 -0.537407 -0.843323 0.000000 0.00000 -0.000000 -0.000000 1.000000 68.86670 133 'point symmetry operation' ? ? -0.877704 0.479202 -0.000000 0.00000 -0.479202 -0.877704 0.000000 0.00000 -0.000000 -0.000000 1.000000 69.39240 134 'point symmetry operation' ? ? -0.908075 0.418808 -0.000000 0.00000 -0.418808 -0.908075 0.000000 0.00000 -0.000000 -0.000000 1.000000 69.91810 135 'point symmetry operation' ? ? -0.934296 0.356499 -0.000000 0.00000 -0.356499 -0.934296 0.000000 0.00000 -0.000000 -0.000000 1.000000 70.44380 136 'point symmetry operation' ? ? -0.956247 0.292561 -0.000000 0.00000 -0.292561 -0.956247 0.000000 0.00000 -0.000000 -0.000000 1.000000 70.96950 137 'point symmetry operation' ? ? -0.973828 0.227286 -0.000000 0.00000 -0.227286 -0.973828 0.000000 0.00000 -0.000000 -0.000000 1.000000 71.49520 138 'point symmetry operation' ? ? -0.986959 0.160973 -0.000000 0.00000 -0.160973 -0.986959 0.000000 0.00000 -0.000000 -0.000000 1.000000 72.02090 139 'point symmetry operation' ? ? -0.995579 0.093924 -0.000000 0.00000 -0.093924 -0.995579 0.000000 0.00000 0.000000 -0.000000 1.000000 72.54660 140 'point symmetry operation' ? ? -0.999650 0.026445 -0.000000 0.00000 -0.026445 -0.999650 0.000000 0.00000 0.000000 -0.000000 1.000000 73.07230 141 'point symmetry operation' ? ? -0.999153 -0.041154 0.000000 0.00000 0.041154 -0.999153 -0.000000 0.00000 -0.000000 0.000000 1.000000 73.59800 142 'point symmetry operation' ? ? -0.994089 -0.108565 0.000000 0.00000 0.108565 -0.994089 -0.000000 0.00000 -0.000000 0.000000 1.000000 74.12370 143 'point symmetry operation' ? ? -0.984483 -0.175480 -0.000000 0.00000 0.175480 -0.984483 -0.000000 -0.00000 -0.000000 0.000000 1.000000 74.64940 144 'point symmetry operation' ? ? -0.970378 -0.241593 -0.000000 0.00000 0.241593 -0.970378 -0.000000 -0.00000 -0.000000 0.000000 1.000000 75.17510 145 'point symmetry operation' ? ? -0.951838 -0.306602 -0.000000 0.00000 0.306602 -0.951838 -0.000000 -0.00000 -0.000000 0.000000 1.000000 75.70080 146 'point symmetry operation' ? ? -0.928948 -0.370210 -0.000000 0.00000 0.370210 -0.928948 -0.000000 -0.00000 -0.000000 0.000000 1.000000 76.22650 147 'point symmetry operation' ? ? -0.901813 -0.432126 -0.000000 0.00000 0.432126 -0.901813 -0.000000 -0.00000 -0.000000 0.000000 1.000000 76.75220 148 'point symmetry operation' ? ? -0.870557 -0.492067 -0.000000 0.00000 0.492067 -0.870557 -0.000000 -0.00000 -0.000000 0.000000 1.000000 77.27790 149 'point symmetry operation' ? ? -0.835323 -0.549760 -0.000000 0.00000 0.549760 -0.835323 -0.000000 -0.00000 -0.000000 0.000000 1.000000 77.80360 150 'point symmetry operation' ? ? -0.796271 -0.604940 -0.000000 0.00000 0.604940 -0.796271 -0.000000 -0.00000 -0.000000 0.000000 1.000000 78.32930 151 'point symmetry operation' ? ? -0.753581 -0.657356 -0.000000 -0.00000 0.657356 -0.753581 -0.000000 -0.00000 -0.000000 0.000000 1.000000 78.85500 152 'point symmetry operation' ? ? -0.707446 -0.706767 -0.000000 -0.00000 0.706767 -0.707446 -0.000000 -0.00000 -0.000000 0.000000 1.000000 79.38070 153 'point symmetry operation' ? ? -0.658079 -0.752949 -0.000000 -0.00000 0.752949 -0.658079 -0.000000 -0.00000 -0.000000 0.000000 1.000000 79.90640 154 'point symmetry operation' ? ? -0.605704 -0.795690 -0.000000 -0.00000 0.795690 -0.605704 -0.000000 -0.00000 -0.000000 0.000000 1.000000 80.43210 155 'point symmetry operation' ? ? -0.550561 -0.834795 -0.000000 -0.00000 0.834795 -0.550561 -0.000000 -0.00000 -0.000000 0.000000 1.000000 80.95780 156 'point symmetry operation' ? ? -0.492903 -0.870084 -0.000000 -0.00000 0.870084 -0.492903 -0.000000 -0.00000 -0.000000 0.000000 1.000000 81.48350 157 'point symmetry operation' ? ? -0.432992 -0.901398 -0.000000 -0.00000 0.901398 -0.432992 -0.000000 -0.00000 -0.000000 0.000000 1.000000 82.00920 158 'point symmetry operation' ? ? -0.371102 -0.928592 -0.000000 -0.00000 0.928592 -0.371102 -0.000000 -0.00000 -0.000000 0.000000 1.000000 82.53490 159 'point symmetry operation' ? ? -0.307516 -0.951543 -0.000000 -0.00000 0.951543 -0.307516 -0.000000 -0.00000 -0.000000 0.000000 1.000000 83.06060 160 'point symmetry operation' ? ? -0.242525 -0.970145 -0.000000 -0.00000 0.970145 -0.242525 -0.000000 -0.00000 -0.000000 0.000000 1.000000 83.58630 161 'point symmetry operation' ? ? -0.176425 -0.984314 -0.000000 -0.00000 0.984314 -0.176425 -0.000000 -0.00000 -0.000000 0.000000 1.000000 84.11200 162 'point symmetry operation' ? ? -0.109519 -0.993985 -0.000000 -0.00000 0.993985 -0.109519 -0.000000 -0.00000 -0.000000 0.000000 1.000000 84.63770 163 'point symmetry operation' ? ? -0.042113 -0.999113 -0.000000 -0.00000 0.999113 -0.042113 -0.000000 -0.00000 -0.000000 0.000000 1.000000 85.16340 164 'point symmetry operation' ? ? 0.025486 -0.999675 -0.000000 -0.00000 0.999675 0.025486 -0.000000 -0.00000 -0.000000 0.000000 1.000000 85.68910 165 'point symmetry operation' ? ? 0.092968 -0.995669 -0.000000 -0.00000 0.995669 0.092968 -0.000000 -0.00000 -0.000000 0.000000 1.000000 86.21480 166 'point symmetry operation' ? ? 0.160025 -0.987113 -0.000000 -0.00000 0.987113 0.160025 -0.000000 -0.00000 -0.000000 0.000000 1.000000 86.74050 167 'point symmetry operation' ? ? 0.226351 -0.974046 -0.000000 -0.00000 0.974046 0.226351 -0.000000 -0.00000 -0.000000 0.000000 1.000000 87.26620 168 'point symmetry operation' ? ? 0.291643 -0.956527 -0.000000 -0.00000 0.956527 0.291643 -0.000000 -0.00000 -0.000000 0.000000 1.000000 87.79190 169 'point symmetry operation' ? ? 0.355602 -0.934638 -0.000000 -0.00000 0.934638 0.355602 -0.000000 -0.00000 -0.000000 0.000000 1.000000 88.31760 170 'point symmetry operation' ? ? 0.417935 -0.908477 -0.000000 -0.00000 0.908477 0.417935 -0.000000 -0.00000 -0.000000 0.000000 1.000000 88.84330 171 'point symmetry operation' ? ? 0.478359 -0.878164 -0.000000 -0.00000 0.878164 0.478359 -0.000000 -0.00000 -0.000000 0.000000 1.000000 89.36900 172 'point symmetry operation' ? ? 0.536597 -0.843839 -0.000000 -0.00000 0.843839 0.536597 -0.000000 -0.00000 -0.000000 0.000000 1.000000 89.89470 173 'point symmetry operation' ? ? 0.592383 -0.805657 -0.000000 -0.00000 0.805657 0.592383 -0.000000 -0.00000 -0.000000 0.000000 1.000000 90.42040 174 'point symmetry operation' ? ? 0.645461 -0.763793 -0.000000 -0.00000 0.763793 0.645461 -0.000000 -0.00000 -0.000000 0.000000 1.000000 90.94610 175 'point symmetry operation' ? ? 0.695590 -0.718439 -0.000000 -0.00000 0.718439 0.695590 -0.000000 -0.00000 -0.000000 0.000000 1.000000 91.47180 176 'point symmetry operation' ? ? 0.742540 -0.669802 -0.000000 -0.00000 0.669802 0.742540 -0.000000 -0.00000 -0.000000 0.000000 1.000000 91.99750 177 'point symmetry operation' ? ? 0.786097 -0.618103 -0.000000 -0.00000 0.618103 0.786097 -0.000000 -0.00000 -0.000000 0.000000 1.000000 92.52320 178 'point symmetry operation' ? ? 0.826061 -0.563580 -0.000000 -0.00000 0.563580 0.826061 -0.000000 -0.00000 -0.000000 0.000000 1.000000 93.04890 179 'point symmetry operation' ? ? 0.862251 -0.506482 -0.000000 -0.00000 0.506482 0.862251 -0.000000 -0.00000 -0.000000 0.000000 1.000000 93.57460 180 'point symmetry operation' ? ? 0.894499 -0.447069 -0.000000 -0.00000 0.447069 0.894499 -0.000000 -0.00000 -0.000000 0.000000 1.000000 94.10030 181 'point symmetry operation' ? ? 0.922661 -0.385613 -0.000000 -0.00000 0.385613 0.922661 -0.000000 -0.00000 -0.000000 0.000000 1.000000 94.62600 182 'point symmetry operation' ? ? 0.946605 -0.322395 -0.000000 -0.00000 0.322395 0.946605 -0.000000 -0.00000 -0.000000 0.000000 1.000000 95.15170 183 'point symmetry operation' ? ? 0.966224 -0.257703 -0.000000 -0.00000 0.257703 0.966224 -0.000000 -0.00000 -0.000000 0.000000 1.000000 95.67740 184 'point symmetry operation' ? ? 0.981427 -0.191834 -0.000000 -0.00000 0.191834 0.981427 -0.000000 -0.00000 -0.000000 0.000000 1.000000 96.20310 185 'point symmetry operation' ? ? 0.992146 -0.125088 -0.000000 -0.00000 0.125088 0.992146 -0.000000 -0.00000 -0.000000 0.000000 1.000000 96.72880 186 'point symmetry operation' ? ? 0.998330 -0.057771 -0.000000 -0.00000 0.057771 0.998330 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 97.25450 187 'point symmetry operation' ? ? 0.999952 0.009811 -0.000000 -0.00000 -0.009811 0.999952 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 97.78020 188 'point symmetry operation' ? ? 0.997004 0.077348 -0.000000 -0.00000 -0.077348 0.997004 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 98.30590 189 'point symmetry operation' ? ? 0.989500 0.144531 -0.000000 -0.00000 -0.144531 0.989500 0.000000 0.00000 -0.000000 -0.000000 1.000000 98.83160 190 'point symmetry operation' ? ? 0.977474 0.211054 -0.000000 -0.00000 -0.211054 0.977474 0.000000 0.00000 -0.000000 -0.000000 1.000000 99.35730 191 'point symmetry operation' ? ? 0.960982 0.276612 -0.000000 -0.00000 -0.276612 0.960982 0.000000 0.00000 -0.000000 -0.000000 1.000000 99.88300 192 'point symmetry operation' ? ? 0.940097 0.340906 -0.000000 -0.00000 -0.340906 0.940097 0.000000 0.00000 -0.000000 -0.000000 1.000000 100.40870 193 'point symmetry operation' ? ? 0.914917 0.403642 -0.000000 -0.00000 -0.403642 0.914917 0.000000 0.00000 -0.000000 -0.000000 1.000000 100.93440 194 'point symmetry operation' ? ? 0.885555 0.464534 -0.000000 -0.00000 -0.464534 0.885555 0.000000 0.00000 -0.000000 -0.000000 1.000000 101.46010 195 'point symmetry operation' ? ? 0.852147 0.523303 -0.000000 -0.00000 -0.523303 0.852147 0.000000 0.00000 -0.000000 -0.000000 1.000000 101.98580 196 'point symmetry operation' ? ? 0.814844 0.579680 -0.000000 -0.00000 -0.579680 0.814844 0.000000 0.00000 -0.000000 -0.000000 1.000000 102.51150 197 'point symmetry operation' ? ? 0.773818 0.633408 -0.000000 -0.00000 -0.633408 0.773818 0.000000 0.00000 -0.000000 -0.000000 1.000000 103.03720 198 'point symmetry operation' ? ? 0.729255 0.684242 -0.000000 -0.00000 -0.684242 0.729255 0.000000 0.00000 -0.000000 -0.000000 1.000000 103.56290 199 'point symmetry operation' ? ? 0.681360 0.731949 -0.000000 -0.00000 -0.731949 0.681360 0.000000 0.00000 -0.000000 -0.000000 1.000000 104.08860 200 'point symmetry operation' ? ? 0.630351 0.776311 -0.000000 -0.00000 -0.776311 0.630351 0.000000 0.00000 -0.000000 -0.000000 1.000000 104.61430 201 'point symmetry operation' ? ? 0.576461 0.817125 -0.000000 -0.00000 -0.817125 0.576461 0.000000 0.00000 -0.000000 -0.000000 1.000000 105.14000 202 'point symmetry operation' ? ? 0.519937 0.854205 -0.000000 -0.00000 -0.854205 0.519937 0.000000 0.00000 -0.000000 -0.000000 1.000000 105.66570 203 'point symmetry operation' ? ? 0.461037 0.887381 -0.000000 -0.00000 -0.887381 0.461037 0.000000 0.00000 -0.000000 -0.000000 1.000000 106.19140 204 'point symmetry operation' ? ? 0.400030 0.916502 -0.000000 -0.00000 -0.916502 0.400030 0.000000 0.00000 -0.000000 -0.000000 1.000000 106.71710 205 'point symmetry operation' ? ? 0.337195 0.941435 -0.000000 -0.00000 -0.941435 0.337195 0.000000 0.00000 -0.000000 -0.000000 1.000000 107.24280 206 'point symmetry operation' ? ? 0.272818 0.962066 -0.000000 -0.00000 -0.962066 0.272818 0.000000 0.00000 -0.000000 -0.000000 1.000000 107.76850 207 'point symmetry operation' ? ? 0.207196 0.978300 -0.000000 -0.00000 -0.978300 0.207196 0.000000 0.00000 -0.000000 -0.000000 1.000000 108.29420 208 'point symmetry operation' ? ? 0.140626 0.990063 -0.000000 -0.00000 -0.990063 0.140626 0.000000 0.00000 -0.000000 -0.000000 1.000000 108.81990 209 'point symmetry operation' ? ? 0.073414 0.997302 -0.000000 -0.00000 -0.997302 0.073414 0.000000 0.00000 -0.000000 -0.000000 1.000000 109.34560 210 'point symmetry operation' ? ? 0.005866 0.999983 -0.000000 -0.00000 -0.999983 0.005866 0.000000 0.00000 -0.000000 -0.000000 1.000000 109.87130 211 'point symmetry operation' ? ? -0.061709 0.998094 -0.000000 -0.00000 -0.998094 -0.061709 0.000000 0.00000 -0.000000 -0.000000 1.000000 110.39700 212 'point symmetry operation' ? ? -0.129001 0.991644 -0.000000 -0.00000 -0.991644 -0.129001 0.000000 0.00000 -0.000000 -0.000000 1.000000 110.92270 213 'point symmetry operation' ? ? -0.195704 0.980663 -0.000000 -0.00000 -0.980663 -0.195704 0.000000 0.00000 -0.000000 -0.000000 1.000000 111.44840 214 'point symmetry operation' ? ? -0.261513 0.965200 -0.000000 -0.00000 -0.965200 -0.261513 0.000000 0.00000 -0.000000 -0.000000 1.000000 111.97410 215 'point symmetry operation' ? ? -0.326127 0.945326 -0.000000 -0.00000 -0.945326 -0.326127 0.000000 0.00000 -0.000000 -0.000000 1.000000 112.49980 216 'point symmetry operation' ? ? -0.389250 0.921132 -0.000000 -0.00000 -0.921132 -0.389250 0.000000 0.00000 -0.000000 -0.000000 1.000000 113.02550 217 'point symmetry operation' ? ? -0.450595 0.892729 -0.000000 -0.00000 -0.892729 -0.450595 0.000000 0.00000 -0.000000 -0.000000 1.000000 113.55120 218 'point symmetry operation' ? ? -0.509880 0.860246 -0.000000 -0.00000 -0.860246 -0.509880 0.000000 0.00000 -0.000000 -0.000000 1.000000 114.07690 219 'point symmetry operation' ? ? -0.566835 0.823831 -0.000000 -0.00000 -0.823831 -0.566835 0.000000 0.00000 -0.000000 -0.000000 1.000000 114.60260 220 'point symmetry operation' ? ? -0.621200 0.783652 -0.000000 -0.00000 -0.783652 -0.621200 0.000000 0.00000 -0.000000 -0.000000 1.000000 115.12830 221 'point symmetry operation' ? ? -0.672726 0.739892 -0.000000 -0.00000 -0.739892 -0.672726 0.000000 0.00000 -0.000000 -0.000000 1.000000 115.65400 222 'point symmetry operation' ? ? -0.721178 0.692750 -0.000000 -0.00000 -0.692750 -0.721178 0.000000 0.00000 -0.000000 -0.000000 1.000000 116.17970 223 'point symmetry operation' ? ? -0.766334 0.642443 -0.000000 -0.00000 -0.642443 -0.766334 0.000000 0.00000 -0.000000 -0.000000 1.000000 116.70540 224 'point symmetry operation' ? ? -0.807988 0.589200 -0.000000 -0.00000 -0.589200 -0.807988 0.000000 0.00000 -0.000000 -0.000000 1.000000 117.23110 225 'point symmetry operation' ? ? -0.845949 0.533264 -0.000000 -0.00000 -0.533264 -0.845949 0.000000 0.00000 -0.000000 -0.000000 1.000000 117.75680 226 'point symmetry operation' ? ? -0.880045 0.474891 -0.000000 -0.00000 -0.474891 -0.880045 0.000000 0.00000 -0.000000 -0.000000 1.000000 118.28250 227 'point symmetry operation' ? ? -0.910119 0.414348 -0.000000 -0.00000 -0.414348 -0.910119 0.000000 0.00000 -0.000000 -0.000000 1.000000 118.80820 228 'point symmetry operation' ? ? -0.936033 0.351911 -0.000000 -0.00000 -0.351911 -0.936033 0.000000 0.00000 -0.000000 -0.000000 1.000000 119.33390 229 'point symmetry operation' ? ? -0.957670 0.287867 -0.000000 -0.00000 -0.287867 -0.957670 0.000000 0.00000 -0.000000 -0.000000 1.000000 119.85960 230 'point symmetry operation' ? ? -0.974931 0.222506 -0.000000 -0.00000 -0.222506 -0.974931 0.000000 0.00000 -0.000000 -0.000000 1.000000 120.38530 231 'point symmetry operation' ? ? -0.987737 0.156129 -0.000000 -0.00000 -0.156129 -0.987737 0.000000 0.00000 -0.000000 -0.000000 1.000000 120.91100 232 'point symmetry operation' ? ? -0.996028 0.089039 -0.000000 -0.00000 -0.089039 -0.996028 0.000000 0.00000 0.000000 -0.000000 1.000000 121.43670 233 'point symmetry operation' ? ? -0.999768 0.021541 -0.000000 -0.00000 -0.021541 -0.999768 0.000000 0.00000 0.000000 -0.000000 1.000000 121.96240 234 'point symmetry operation' ? ? -0.998939 -0.046055 0.000000 -0.00000 0.046055 -0.998939 -0.000000 0.00000 -0.000000 0.000000 1.000000 122.48810 235 'point symmetry operation' ? ? -0.993545 -0.113440 0.000000 -0.00000 0.113440 -0.993545 -0.000000 -0.00000 -0.000000 0.000000 1.000000 123.01380 236 'point symmetry operation' ? ? -0.983610 -0.180307 -0.000000 -0.00000 0.180307 -0.983610 -0.000000 -0.00000 -0.000000 0.000000 1.000000 123.53950 237 'point symmetry operation' ? ? -0.969181 -0.246350 -0.000000 -0.00000 0.246350 -0.969181 -0.000000 -0.00000 -0.000000 0.000000 1.000000 124.06520 238 'point symmetry operation' ? ? -0.950322 -0.311267 -0.000000 -0.00000 0.311267 -0.950322 -0.000000 -0.00000 -0.000000 0.000000 1.000000 124.59090 239 'point symmetry operation' ? ? -0.927121 -0.374762 -0.000000 -0.00000 0.374762 -0.927121 -0.000000 -0.00000 -0.000000 0.000000 1.000000 125.11660 240 'point symmetry operation' ? ? -0.899683 -0.436544 -0.000000 -0.00000 0.436544 -0.899683 -0.000000 -0.00000 -0.000000 0.000000 1.000000 125.64230 241 'point symmetry operation' ? ? -0.868133 -0.496332 -0.000000 -0.00000 0.496332 -0.868133 -0.000000 -0.00000 -0.000000 0.000000 1.000000 126.16800 242 'point symmetry operation' ? ? -0.832616 -0.553851 -0.000000 -0.00000 0.553851 -0.832616 -0.000000 -0.00000 -0.000000 0.000000 1.000000 126.69370 243 'point symmetry operation' ? ? -0.793294 -0.608839 -0.000000 -0.00000 0.608839 -0.793294 -0.000000 -0.00000 -0.000000 0.000000 1.000000 127.21940 244 'point symmetry operation' ? ? -0.750347 -0.661044 -0.000000 -0.00000 0.661044 -0.750347 -0.000000 -0.00000 -0.000000 0.000000 1.000000 127.74510 245 'point symmetry operation' ? ? -0.703971 -0.710229 -0.000000 -0.00000 0.710229 -0.703971 -0.000000 -0.00000 -0.000000 0.000000 1.000000 128.27080 246 'point symmetry operation' ? ? -0.654377 -0.756168 -0.000000 -0.00000 0.756168 -0.654377 -0.000000 -0.00000 -0.000000 0.000000 1.000000 128.79650 247 'point symmetry operation' ? ? -0.601794 -0.798652 -0.000000 -0.00000 0.798652 -0.601794 -0.000000 -0.00000 -0.000000 0.000000 1.000000 129.32220 248 'point symmetry operation' ? ? -0.546460 -0.837485 -0.000000 -0.00000 0.837485 -0.546460 -0.000000 -0.00000 -0.000000 0.000000 1.000000 129.84790 249 'point symmetry operation' ? ? -0.488629 -0.872492 -0.000000 -0.00000 0.872492 -0.488629 -0.000000 -0.00000 -0.000000 0.000000 1.000000 130.37360 250 'point symmetry operation' ? ? -0.428564 -0.903511 -0.000000 -0.00000 0.903511 -0.428564 -0.000000 -0.00000 -0.000000 0.000000 1.000000 130.89930 251 'point symmetry operation' ? ? -0.366542 -0.930402 -0.000000 -0.00000 0.930402 -0.366542 -0.000000 -0.00000 -0.000000 0.000000 1.000000 131.42500 252 'point symmetry operation' ? ? -0.302844 -0.953040 -0.000000 -0.00000 0.953040 -0.302844 -0.000000 -0.00000 -0.000000 0.000000 1.000000 131.95070 253 'point symmetry operation' ? ? -0.237763 -0.971323 -0.000000 -0.00000 0.971323 -0.237763 -0.000000 -0.00000 -0.000000 0.000000 1.000000 132.47640 254 'point symmetry operation' ? ? -0.171594 -0.985168 -0.000000 -0.00000 0.985168 -0.171594 -0.000000 -0.00000 -0.000000 0.000000 1.000000 133.00210 255 'point symmetry operation' ? ? -0.104642 -0.994510 -0.000000 -0.00000 0.994510 -0.104642 -0.000000 -0.00000 -0.000000 0.000000 1.000000 133.52780 256 'point symmetry operation' ? ? -0.037211 -0.999307 -0.000000 -0.00000 0.999307 -0.037211 -0.000000 -0.00000 -0.000000 0.000000 1.000000 134.05350 257 'point symmetry operation' ? ? 0.030389 -0.999538 -0.000000 -0.00000 0.999538 0.030389 -0.000000 -0.00000 -0.000000 0.000000 1.000000 134.57920 258 'point symmetry operation' ? ? 0.097851 -0.995201 -0.000000 -0.00000 0.995201 0.097851 -0.000000 -0.00000 -0.000000 0.000000 1.000000 135.10490 259 'point symmetry operation' ? ? 0.164865 -0.986316 -0.000000 -0.00000 0.986316 0.164865 -0.000000 -0.00000 -0.000000 0.000000 1.000000 135.63060 260 'point symmetry operation' ? ? 0.231127 -0.972924 -0.000000 -0.00000 0.972924 0.231127 -0.000000 -0.00000 -0.000000 0.000000 1.000000 136.15630 261 'point symmetry operation' ? ? 0.296332 -0.955085 -0.000000 -0.00000 0.955085 0.296332 -0.000000 -0.00000 -0.000000 0.000000 1.000000 136.68200 262 'point symmetry operation' ? ? 0.360182 -0.932882 -0.000000 -0.00000 0.932882 0.360182 -0.000000 -0.00000 -0.000000 0.000000 1.000000 137.20770 263 'point symmetry operation' ? ? 0.422387 -0.906416 -0.000000 -0.00000 0.906416 0.422387 -0.000000 -0.00000 -0.000000 0.000000 1.000000 137.73340 264 'point symmetry operation' ? ? 0.482661 -0.875807 -0.000000 -0.00000 0.875807 0.482661 -0.000000 -0.00000 -0.000000 0.000000 1.000000 138.25910 265 'point symmetry operation' ? ? 0.540730 -0.841196 -0.000000 -0.00000 0.841196 0.540730 -0.000000 -0.00000 -0.000000 0.000000 1.000000 138.78480 266 'point symmetry operation' ? ? 0.596328 -0.802741 -0.000000 -0.00000 0.802741 0.596328 -0.000000 -0.00000 -0.000000 0.000000 1.000000 139.31050 267 'point symmetry operation' ? ? 0.649200 -0.760617 -0.000000 -0.00000 0.760617 0.649200 -0.000000 -0.00000 -0.000000 0.000000 1.000000 139.83620 268 'point symmetry operation' ? ? 0.699106 -0.715018 -0.000000 -0.00000 0.715018 0.699106 -0.000000 -0.00000 -0.000000 0.000000 1.000000 140.36190 269 'point symmetry operation' ? ? 0.745817 -0.666151 -0.000000 -0.00000 0.666151 0.745817 -0.000000 -0.00000 -0.000000 0.000000 1.000000 140.88760 270 'point symmetry operation' ? ? 0.789120 -0.614240 -0.000000 -0.00000 0.614240 0.789120 -0.000000 -0.00000 -0.000000 0.000000 1.000000 141.41330 271 'point symmetry operation' ? ? 0.828816 -0.559521 -0.000000 -0.00000 0.559521 0.828816 -0.000000 -0.00000 -0.000000 0.000000 1.000000 141.93900 272 'point symmetry operation' ? ? 0.864725 -0.502246 -0.000000 -0.00000 0.502246 0.864725 -0.000000 -0.00000 -0.000000 0.000000 1.000000 142.46470 273 'point symmetry operation' ? ? 0.896682 -0.442676 -0.000000 -0.00000 0.442676 0.896682 -0.000000 -0.00000 -0.000000 0.000000 1.000000 142.99040 274 'point symmetry operation' ? ? 0.924541 -0.381082 -0.000000 -0.00000 0.381082 0.924541 -0.000000 -0.00000 -0.000000 0.000000 1.000000 143.51610 275 'point symmetry operation' ? ? 0.948175 -0.317747 -0.000000 -0.00000 0.317747 0.948175 -0.000000 -0.00000 -0.000000 0.000000 1.000000 144.04180 276 'point symmetry operation' ? ? 0.967477 -0.252960 -0.000000 -0.00000 0.252960 0.967477 -0.000000 -0.00000 -0.000000 0.000000 1.000000 144.56750 277 'point symmetry operation' ? ? 0.982357 -0.187017 -0.000000 -0.00000 0.187017 0.982357 -0.000000 -0.00000 -0.000000 0.000000 1.000000 145.09320 278 'point symmetry operation' ? ? 0.992747 -0.120219 -0.000000 -0.00000 0.120219 0.992747 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 145.61890 279 'point symmetry operation' ? ? 0.998601 -0.052872 -0.000000 -0.00000 0.052872 0.998601 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 146.14460 280 'point symmetry operation' ? ? 0.999892 0.014716 -0.000000 -0.00000 -0.014716 0.999892 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 146.67030 281 'point symmetry operation' ? ? 0.996613 0.082238 -0.000000 -0.00000 -0.082238 0.996613 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 147.19600 282 'point symmetry operation' ? ? 0.988779 0.149383 -0.000000 -0.00000 -0.149383 0.988779 0.000000 -0.00000 -0.000000 -0.000000 1.000000 147.72170 283 'point symmetry operation' ? ? 0.976427 0.215846 -0.000000 -0.00000 -0.215846 0.976427 0.000000 0.00000 -0.000000 -0.000000 1.000000 148.24740 284 'point symmetry operation' ? ? 0.959613 0.281323 -0.000000 -0.00000 -0.281323 0.959613 0.000000 0.00000 -0.000000 -0.000000 1.000000 148.77310 285 'point symmetry operation' ? ? 0.938414 0.345514 -0.000000 -0.00000 -0.345514 0.938414 0.000000 0.00000 -0.000000 -0.000000 1.000000 149.29880 286 'point symmetry operation' ? ? 0.912926 0.408126 -0.000000 -0.00000 -0.408126 0.912926 0.000000 0.00000 -0.000000 -0.000000 1.000000 149.82450 287 'point symmetry operation' ? ? 0.883266 0.468873 -0.000000 -0.00000 -0.468873 0.883266 0.000000 0.00000 -0.000000 -0.000000 1.000000 150.35020 288 'point symmetry operation' ? ? 0.849569 0.527477 -0.000000 -0.00000 -0.527477 0.849569 0.000000 0.00000 -0.000000 -0.000000 1.000000 150.87590 289 'point symmetry operation' ? ? 0.811991 0.583670 -0.000000 -0.00000 -0.583670 0.811991 0.000000 0.00000 -0.000000 -0.000000 1.000000 151.40160 290 'point symmetry operation' ? ? 0.770701 0.637197 -0.000000 -0.00000 -0.637197 0.770701 0.000000 0.00000 -0.000000 -0.000000 1.000000 151.92730 291 'point symmetry operation' ? ? 0.725890 0.687811 -0.000000 -0.00000 -0.687811 0.725890 0.000000 0.00000 -0.000000 -0.000000 1.000000 152.45300 292 'point symmetry operation' ? ? 0.677761 0.735282 -0.000000 -0.00000 -0.735282 0.677761 0.000000 0.00000 -0.000000 -0.000000 1.000000 152.97870 293 'point symmetry operation' ? ? 0.626535 0.779394 -0.000000 -0.00000 -0.779394 0.626535 0.000000 0.00000 -0.000000 -0.000000 1.000000 153.50440 294 'point symmetry operation' ? ? 0.572445 0.819943 -0.000000 -0.00000 -0.819943 0.572445 0.000000 0.00000 -0.000000 -0.000000 1.000000 154.03010 295 'point symmetry operation' ? ? 0.515740 0.856745 -0.000000 -0.00000 -0.856745 0.515740 0.000000 0.00000 -0.000000 -0.000000 1.000000 154.55580 296 'point symmetry operation' ? ? 0.456678 0.889632 -0.000000 -0.00000 -0.889632 0.456678 0.000000 0.00000 -0.000000 -0.000000 1.000000 155.08150 297 'point symmetry operation' ? ? 0.395529 0.918454 -0.000000 -0.00000 -0.918454 0.395529 0.000000 0.00000 -0.000000 -0.000000 1.000000 155.60720 298 'point symmetry operation' ? ? 0.332572 0.943078 -0.000000 -0.00000 -0.943078 0.332572 0.000000 0.00000 -0.000000 -0.000000 1.000000 156.13290 299 'point symmetry operation' ? ? 0.268096 0.963392 -0.000000 -0.00000 -0.963392 0.268096 0.000000 0.00000 -0.000000 -0.000000 1.000000 156.65860 300 'point symmetry operation' ? ? 0.202394 0.979304 -0.000000 -0.00000 -0.979304 0.202394 0.000000 0.00000 -0.000000 -0.000000 1.000000 157.18430 301 'point symmetry operation' ? ? 0.135767 0.990741 -0.000000 -0.00000 -0.990741 0.135767 0.000000 0.00000 -0.000000 -0.000000 1.000000 157.71000 302 'point symmetry operation' ? ? 0.068520 0.997650 -0.000000 -0.00000 -0.997650 0.068520 0.000000 0.00000 -0.000000 -0.000000 1.000000 158.23570 303 'point symmetry operation' ? ? 0.000960 1.000000 -0.000000 -0.00000 -1.000000 0.000960 0.000000 0.00000 -0.000000 -0.000000 1.000000 158.76140 304 'point symmetry operation' ? ? -0.066604 0.997779 -0.000000 -0.00000 -0.997779 -0.066604 0.000000 0.00000 -0.000000 -0.000000 1.000000 159.28710 305 'point symmetry operation' ? ? -0.133864 0.991000 -0.000000 -0.00000 -0.991000 -0.133864 0.000000 0.00000 -0.000000 -0.000000 1.000000 159.81280 306 'point symmetry operation' ? ? -0.200513 0.979691 -0.000000 -0.00000 -0.979691 -0.200513 0.000000 0.00000 -0.000000 -0.000000 1.000000 160.33850 307 'point symmetry operation' ? ? -0.266245 0.963905 -0.000000 -0.00000 -0.963905 -0.266245 0.000000 0.00000 -0.000000 -0.000000 1.000000 160.86420 308 'point symmetry operation' ? ? -0.330760 0.943715 -0.000000 -0.00000 -0.943715 -0.330760 0.000000 0.00000 -0.000000 -0.000000 1.000000 161.38990 309 'point symmetry operation' ? ? -0.393764 0.919212 -0.000000 -0.00000 -0.919212 -0.393764 0.000000 0.00000 -0.000000 -0.000000 1.000000 161.91560 310 'point symmetry operation' ? ? -0.454969 0.890508 -0.000000 -0.00000 -0.890508 -0.454969 0.000000 0.00000 -0.000000 -0.000000 1.000000 162.44130 311 'point symmetry operation' ? ? -0.514094 0.857734 -0.000000 -0.00000 -0.857734 -0.514094 0.000000 0.00000 -0.000000 -0.000000 1.000000 162.96700 312 'point symmetry operation' ? ? -0.570870 0.821041 -0.000000 -0.00000 -0.821041 -0.570870 0.000000 0.00000 -0.000000 -0.000000 1.000000 163.49270 313 'point symmetry operation' ? ? -0.625037 0.780595 -0.000000 -0.00000 -0.780595 -0.625037 0.000000 0.00000 -0.000000 -0.000000 1.000000 164.01840 314 'point symmetry operation' ? ? -0.676347 0.736583 -0.000000 -0.00000 -0.736583 -0.676347 0.000000 0.00000 -0.000000 -0.000000 1.000000 164.54410 315 'point symmetry operation' ? ? -0.724567 0.689204 -0.000000 -0.00000 -0.689204 -0.724567 0.000000 0.00000 -0.000000 -0.000000 1.000000 165.06980 316 'point symmetry operation' ? ? -0.769476 0.638676 -0.000000 -0.00000 -0.638676 -0.769476 0.000000 0.00000 -0.000000 -0.000000 1.000000 165.59550 317 'point symmetry operation' ? ? -0.810868 0.585229 -0.000000 -0.00000 -0.585229 -0.810868 0.000000 0.00000 -0.000000 -0.000000 1.000000 166.12120 318 'point symmetry operation' ? ? -0.848555 0.529107 -0.000000 -0.00000 -0.529107 -0.848555 0.000000 0.00000 -0.000000 -0.000000 1.000000 166.64690 319 'point symmetry operation' ? ? -0.882364 0.470568 -0.000000 -0.00000 -0.470568 -0.882364 0.000000 0.00000 -0.000000 -0.000000 1.000000 167.17260 320 'point symmetry operation' ? ? -0.912140 0.409878 -0.000000 -0.00000 -0.409878 -0.912140 0.000000 0.00000 -0.000000 -0.000000 1.000000 167.69830 321 'point symmetry operation' ? ? -0.937748 0.347315 -0.000000 -0.00000 -0.347315 -0.937748 0.000000 0.00000 -0.000000 -0.000000 1.000000 168.22400 322 'point symmetry operation' ? ? -0.959071 0.283165 -0.000000 -0.00000 -0.283165 -0.959071 0.000000 0.00000 -0.000000 -0.000000 1.000000 168.74970 323 'point symmetry operation' ? ? -0.976011 0.217721 -0.000000 -0.00000 -0.217721 -0.976011 0.000000 0.00000 -0.000000 -0.000000 1.000000 169.27540 324 'point symmetry operation' ? ? -0.988491 0.151282 -0.000000 -0.00000 -0.151282 -0.988491 0.000000 0.00000 -0.000000 -0.000000 1.000000 169.80110 325 'point symmetry operation' ? ? -0.996453 0.084152 -0.000000 -0.00000 -0.084152 -0.996453 0.000000 0.00000 0.000000 -0.000000 1.000000 170.32680 326 'point symmetry operation' ? ? -0.999862 0.016637 -0.000000 -0.00000 -0.016637 -0.999862 0.000000 0.00000 0.000000 -0.000000 1.000000 170.85250 327 'point symmetry operation' ? ? -0.998701 -0.050954 0.000000 -0.00000 0.050954 -0.998701 -0.000000 -0.00000 -0.000000 0.000000 1.000000 171.37820 328 'point symmetry operation' ? ? -0.992976 -0.118313 0.000000 -0.00000 0.118313 -0.992976 -0.000000 -0.00000 -0.000000 0.000000 1.000000 171.90390 329 'point symmetry operation' ? ? -0.982714 -0.185130 -0.000000 -0.00000 0.185130 -0.982714 -0.000000 -0.00000 -0.000000 0.000000 1.000000 172.42960 330 'point symmetry operation' ? ? -0.967961 -0.251102 -0.000000 -0.00000 0.251102 -0.967961 -0.000000 -0.00000 -0.000000 0.000000 1.000000 172.95530 331 'point symmetry operation' ? ? -0.948784 -0.315926 -0.000000 -0.00000 0.315926 -0.948784 -0.000000 -0.00000 -0.000000 0.000000 1.000000 173.48100 332 'point symmetry operation' ? ? -0.925271 -0.379306 -0.000000 -0.00000 0.379306 -0.925271 -0.000000 -0.00000 -0.000000 0.000000 1.000000 174.00670 333 'point symmetry operation' ? ? -0.897530 -0.440953 -0.000000 -0.00000 0.440953 -0.897530 -0.000000 -0.00000 -0.000000 0.000000 1.000000 174.53240 334 'point symmetry operation' ? ? -0.865688 -0.500584 -0.000000 -0.00000 0.500584 -0.865688 -0.000000 -0.00000 -0.000000 0.000000 1.000000 175.05810 335 'point symmetry operation' ? ? -0.829889 -0.557928 -0.000000 -0.00000 0.557928 -0.829889 -0.000000 -0.00000 -0.000000 0.000000 1.000000 175.58380 336 'point symmetry operation' ? ? -0.790298 -0.612723 -0.000000 -0.00000 0.612723 -0.790298 -0.000000 -0.00000 -0.000000 0.000000 1.000000 176.10950 337 'point symmetry operation' ? ? -0.747095 -0.664717 -0.000000 -0.00000 0.664717 -0.747095 -0.000000 -0.00000 -0.000000 0.000000 1.000000 176.63520 338 'point symmetry operation' ? ? -0.700478 -0.713674 -0.000000 -0.00000 0.713674 -0.700478 -0.000000 -0.00000 -0.000000 0.000000 1.000000 177.16090 339 'point symmetry operation' ? ? -0.650660 -0.759369 -0.000000 -0.00000 0.759369 -0.650660 -0.000000 -0.00000 -0.000000 0.000000 1.000000 177.68660 340 'point symmetry operation' ? ? -0.597868 -0.801594 -0.000000 -0.00000 0.801594 -0.597868 -0.000000 -0.00000 -0.000000 0.000000 1.000000 178.21230 341 'point symmetry operation' ? ? -0.542345 -0.840156 -0.000000 -0.00000 0.840156 -0.542345 -0.000000 -0.00000 -0.000000 0.000000 1.000000 178.73800 342 'point symmetry operation' ? ? -0.484343 -0.874878 -0.000000 -0.00000 0.874878 -0.484343 -0.000000 -0.00000 -0.000000 0.000000 1.000000 179.26370 343 'point symmetry operation' ? ? -0.424127 -0.905603 -0.000000 -0.00000 0.905603 -0.424127 -0.000000 -0.00000 -0.000000 0.000000 1.000000 179.78940 344 'point symmetry operation' ? ? -0.361973 -0.932188 -0.000000 -0.00000 0.932188 -0.361973 -0.000000 -0.00000 -0.000000 0.000000 1.000000 180.31510 345 'point symmetry operation' ? ? -0.298165 -0.954514 -0.000000 -0.00000 0.954514 -0.298165 -0.000000 -0.00000 -0.000000 0.000000 1.000000 180.84080 346 'point symmetry operation' ? ? -0.232995 -0.972478 -0.000000 -0.00000 0.972478 -0.232995 -0.000000 -0.00000 -0.000000 0.000000 1.000000 181.36650 347 'point symmetry operation' ? ? -0.166759 -0.985998 -0.000000 -0.00000 0.985998 -0.166759 -0.000000 -0.00000 -0.000000 0.000000 1.000000 181.89220 348 'point symmetry operation' ? ? -0.099762 -0.995011 -0.000000 -0.00000 0.995011 -0.099762 -0.000000 -0.00000 -0.000000 0.000000 1.000000 182.41790 349 'point symmetry operation' ? ? -0.032309 -0.999478 -0.000000 -0.00000 0.999478 -0.032309 -0.000000 -0.00000 -0.000000 0.000000 1.000000 182.94360 350 'point symmetry operation' ? ? 0.035292 -0.999377 -0.000000 -0.00000 0.999377 0.035292 -0.000000 -0.00000 -0.000000 0.000000 1.000000 183.46930 351 'point symmetry operation' ? ? 0.102732 -0.994709 -0.000000 -0.00000 0.994709 0.102732 -0.000000 -0.00000 -0.000000 0.000000 1.000000 183.99500 352 'point symmetry operation' ? ? 0.169702 -0.985495 -0.000000 -0.00000 0.985495 0.169702 -0.000000 -0.00000 -0.000000 0.000000 1.000000 184.52070 353 'point symmetry operation' ? ? 0.235897 -0.971778 -0.000000 -0.00000 0.971778 0.235897 -0.000000 -0.00000 -0.000000 0.000000 1.000000 185.04640 354 'point symmetry operation' ? ? 0.301013 -0.953620 -0.000000 -0.00000 0.953620 0.301013 -0.000000 -0.00000 -0.000000 0.000000 1.000000 185.57210 355 'point symmetry operation' ? ? 0.364754 -0.931104 -0.000000 -0.00000 0.931104 0.364754 -0.000000 -0.00000 -0.000000 0.000000 1.000000 186.09780 356 'point symmetry operation' ? ? 0.426828 -0.904333 -0.000000 -0.00000 0.904333 0.426828 -0.000000 -0.00000 -0.000000 0.000000 1.000000 186.62350 357 'point symmetry operation' ? ? 0.486952 -0.873429 -0.000000 -0.00000 0.873429 0.486952 -0.000000 -0.00000 -0.000000 0.000000 1.000000 187.14920 358 'point symmetry operation' ? ? 0.544850 -0.838533 -0.000000 -0.00000 0.838533 0.544850 -0.000000 -0.00000 -0.000000 0.000000 1.000000 187.67490 359 'point symmetry operation' ? ? 0.600259 -0.799806 -0.000000 -0.00000 0.799806 0.600259 -0.000000 -0.00000 -0.000000 0.000000 1.000000 188.20060 360 'point symmetry operation' ? ? 0.652924 -0.757424 -0.000000 -0.00000 0.757424 0.652924 -0.000000 -0.00000 -0.000000 0.000000 1.000000 188.72630 361 'point symmetry operation' ? ? 0.702605 -0.711580 -0.000000 -0.00000 0.711580 0.702605 -0.000000 -0.00000 -0.000000 0.000000 1.000000 189.25200 362 'point symmetry operation' ? ? 0.749076 -0.662484 -0.000000 -0.00000 0.662484 0.749076 -0.000000 -0.00000 -0.000000 0.000000 1.000000 189.77770 363 'point symmetry operation' ? ? 0.792123 -0.610361 -0.000000 -0.00000 0.610361 0.792123 -0.000000 -0.00000 -0.000000 0.000000 1.000000 190.30340 364 'point symmetry operation' ? ? 0.831551 -0.555449 -0.000000 -0.00000 0.555449 0.831551 -0.000000 -0.00000 -0.000000 0.000000 1.000000 190.82910 365 'point symmetry operation' ? ? 0.867178 -0.497998 -0.000000 -0.00000 0.497998 0.867178 -0.000000 -0.00000 -0.000000 0.000000 1.000000 191.35480 366 'point symmetry operation' ? ? 0.898843 -0.438272 -0.000000 -0.00000 0.438272 0.898843 -0.000000 -0.00000 -0.000000 0.000000 1.000000 191.88050 367 'point symmetry operation' ? ? 0.926399 -0.376542 -0.000000 -0.00000 0.376542 0.926399 -0.000000 -0.00000 -0.000000 0.000000 1.000000 192.40620 368 'point symmetry operation' ? ? 0.949723 -0.313092 -0.000000 -0.00000 0.313092 0.949723 -0.000000 -0.00000 -0.000000 0.000000 1.000000 192.93190 369 'point symmetry operation' ? ? 0.968706 -0.248211 -0.000000 -0.00000 0.248211 0.968706 -0.000000 -0.00000 -0.000000 0.000000 1.000000 193.45760 370 'point symmetry operation' ? ? 0.983262 -0.182196 -0.000000 -0.00000 0.182196 0.983262 -0.000000 -0.00000 -0.000000 0.000000 1.000000 193.98330 371 'point symmetry operation' ? ? 0.993325 -0.115348 -0.000000 -0.00000 0.115348 0.993325 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 194.50900 372 'point symmetry operation' ? ? 0.998849 -0.047973 -0.000000 -0.00000 0.047973 0.998849 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 195.03470 373 'point symmetry operation' ? ? 0.999807 0.019621 -0.000000 -0.00000 -0.019621 0.999807 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 195.56040 374 'point symmetry operation' ? ? 0.996197 0.087126 -0.000000 -0.00000 -0.087126 0.996197 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 196.08610 375 'point symmetry operation' ? ? 0.988035 0.154232 -0.000000 -0.00000 -0.154232 0.988035 0.000000 -0.00000 -0.000000 -0.000000 1.000000 196.61180 376 'point symmetry operation' ? ? 0.975357 0.220634 -0.000000 -0.00000 -0.220634 0.975357 0.000000 -0.00000 -0.000000 -0.000000 1.000000 197.13750 377 'point symmetry operation' ? ? 0.958222 0.286027 -0.000000 -0.00000 -0.286027 0.958222 0.000000 0.00000 -0.000000 -0.000000 1.000000 197.66320 378 'point symmetry operation' ? ? 0.936707 0.350113 -0.000000 -0.00000 -0.350113 0.936707 0.000000 0.00000 -0.000000 -0.000000 1.000000 198.18890 379 'point symmetry operation' ? ? 0.910913 0.412599 -0.000000 -0.00000 -0.412599 0.910913 0.000000 0.00000 -0.000000 -0.000000 1.000000 198.71460 380 'point symmetry operation' ? ? 0.880955 0.473200 -0.000000 -0.00000 -0.473200 0.880955 0.000000 0.00000 -0.000000 -0.000000 1.000000 199.24030 381 'point symmetry operation' ? ? 0.846972 0.531638 -0.000000 -0.00000 -0.531638 0.846972 0.000000 0.00000 -0.000000 -0.000000 1.000000 199.76600 382 'point symmetry operation' ? ? 0.809118 0.587647 -0.000000 -0.00000 -0.587647 0.809118 0.000000 0.00000 -0.000000 -0.000000 1.000000 200.29170 383 'point symmetry operation' ? ? 0.767566 0.640970 -0.000000 -0.00000 -0.640970 0.767566 0.000000 0.00000 -0.000000 -0.000000 1.000000 200.81740 384 'point symmetry operation' ? ? 0.722507 0.691364 -0.000000 -0.00000 -0.691364 0.722507 0.000000 0.00000 -0.000000 -0.000000 1.000000 201.34310 385 'point symmetry operation' ? ? 0.674146 0.738598 -0.000000 -0.00000 -0.738598 0.674146 0.000000 0.00000 -0.000000 -0.000000 1.000000 201.86880 386 'point symmetry operation' ? ? 0.622704 0.782458 -0.000000 -0.00000 -0.782458 0.622704 0.000000 0.00000 -0.000000 -0.000000 1.000000 202.39450 387 'point symmetry operation' ? ? 0.568416 0.822741 -0.000000 -0.00000 -0.822741 0.568416 0.000000 0.00000 -0.000000 -0.000000 1.000000 202.92020 388 'point symmetry operation' ? ? 0.511531 0.859265 -0.000000 -0.00000 -0.859265 0.511531 0.000000 0.00000 -0.000000 -0.000000 1.000000 203.44590 389 'point symmetry operation' ? ? 0.452308 0.891862 -0.000000 -0.00000 -0.891862 0.452308 0.000000 0.00000 -0.000000 -0.000000 1.000000 203.97160 390 'point symmetry operation' ? ? 0.391019 0.920383 -0.000000 -0.00000 -0.920383 0.391019 0.000000 0.00000 -0.000000 -0.000000 1.000000 204.49730 391 'point symmetry operation' ? ? 0.327942 0.944698 -0.000000 -0.00000 -0.944698 0.327942 0.000000 0.00000 -0.000000 -0.000000 1.000000 205.02300 392 'point symmetry operation' ? ? 0.263366 0.964696 -0.000000 -0.00000 -0.964696 0.263366 0.000000 0.00000 -0.000000 -0.000000 1.000000 205.54870 393 'point symmetry operation' ? ? 0.197588 0.980285 -0.000000 -0.00000 -0.980285 0.197588 0.000000 0.00000 -0.000000 -0.000000 1.000000 206.07440 394 'point symmetry operation' ? ? 0.130906 0.991395 -0.000000 -0.00000 -0.991395 0.130906 0.000000 0.00000 -0.000000 -0.000000 1.000000 206.60010 395 'point symmetry operation' ? ? 0.063626 0.997974 -0.000000 -0.00000 -0.997974 0.063626 0.000000 0.00000 -0.000000 -0.000000 1.000000 207.12580 396 'point symmetry operation' ? ? -0.003945 0.999992 -0.000000 -0.00000 -0.999992 -0.003945 0.000000 0.00000 -0.000000 -0.000000 1.000000 207.65150 397 'point symmetry operation' ? ? -0.071498 0.997441 -0.000000 -0.00000 -0.997441 -0.071498 0.000000 0.00000 -0.000000 -0.000000 1.000000 208.17720 398 'point symmetry operation' ? ? -0.138724 0.990331 -0.000000 -0.00000 -0.990331 -0.138724 0.000000 0.00000 -0.000000 -0.000000 1.000000 208.70290 399 'point symmetry operation' ? ? -0.205316 0.978696 -0.000000 -0.00000 -0.978696 -0.205316 0.000000 0.00000 -0.000000 -0.000000 1.000000 209.22860 400 'point symmetry operation' ? ? -0.270970 0.962588 -0.000000 -0.00000 -0.962588 -0.270970 0.000000 0.00000 -0.000000 -0.000000 1.000000 209.75430 401 'point symmetry operation' ? ? -0.335386 0.942081 -0.000000 -0.00000 -0.942081 -0.335386 0.000000 0.00000 -0.000000 -0.000000 1.000000 210.28000 402 'point symmetry operation' ? ? -0.398269 0.917269 -0.000000 -0.00000 -0.917269 -0.398269 0.000000 0.00000 -0.000000 -0.000000 1.000000 210.80570 403 'point symmetry operation' ? ? -0.459332 0.888265 -0.000000 -0.00000 -0.888265 -0.459332 0.000000 0.00000 -0.000000 -0.000000 1.000000 211.33140 404 'point symmetry operation' ? ? -0.518295 0.855202 -0.000000 -0.00000 -0.855202 -0.518295 0.000000 0.00000 -0.000000 -0.000000 1.000000 211.85710 405 'point symmetry operation' ? ? -0.574890 0.818230 -0.000000 -0.00000 -0.818230 -0.574890 0.000000 0.00000 -0.000000 -0.000000 1.000000 212.38280 406 'point symmetry operation' ? ? -0.628858 0.777520 -0.000000 -0.00000 -0.777520 -0.628858 0.000000 0.00000 -0.000000 -0.000000 1.000000 212.90850 407 'point symmetry operation' ? ? -0.679953 0.733256 -0.000000 -0.00000 -0.733256 -0.679953 0.000000 0.00000 -0.000000 -0.000000 1.000000 213.43420 408 'point symmetry operation' ? ? -0.727939 0.685641 -0.000000 -0.00000 -0.685641 -0.727939 0.000000 0.00000 -0.000000 -0.000000 1.000000 213.95990 409 'point symmetry operation' ? ? -0.772600 0.634893 -0.000000 -0.00000 -0.634893 -0.772600 0.000000 0.00000 -0.000000 -0.000000 1.000000 214.48560 410 'point symmetry operation' ? ? -0.813729 0.581244 -0.000000 -0.00000 -0.581244 -0.813729 0.000000 0.00000 -0.000000 -0.000000 1.000000 215.01130 411 'point symmetry operation' ? ? -0.851140 0.524938 -0.000000 -0.00000 -0.524938 -0.851140 0.000000 0.00000 -0.000000 -0.000000 1.000000 215.53700 412 'point symmetry operation' ? ? -0.884661 0.466234 -0.000000 -0.00000 -0.466234 -0.884661 0.000000 0.00000 -0.000000 -0.000000 1.000000 216.06270 413 'point symmetry operation' ? ? -0.914140 0.405399 -0.000000 -0.00000 -0.405399 -0.914140 0.000000 0.00000 -0.000000 -0.000000 1.000000 216.58840 414 'point symmetry operation' ? ? -0.939441 0.342711 -0.000000 -0.00000 -0.342711 -0.939441 0.000000 0.00000 -0.000000 -0.000000 1.000000 217.11410 415 'point symmetry operation' ? ? -0.960449 0.278457 -0.000000 -0.00000 -0.278457 -0.960449 0.000000 0.00000 -0.000000 -0.000000 1.000000 217.63980 416 'point symmetry operation' ? ? -0.977067 0.212931 -0.000000 -0.00000 -0.212931 -0.977067 0.000000 0.00000 -0.000000 -0.000000 1.000000 218.16550 417 'point symmetry operation' ? ? -0.989221 0.146431 -0.000000 -0.00000 -0.146431 -0.989221 0.000000 0.00000 -0.000000 -0.000000 1.000000 218.69120 418 'point symmetry operation' ? ? -0.996854 0.079262 -0.000000 -0.00000 -0.079262 -0.996854 0.000000 0.00000 0.000000 -0.000000 1.000000 219.21690 419 'point symmetry operation' ? ? -0.999931 0.011731 -0.000000 -0.00000 -0.011731 -0.999931 0.000000 -0.00000 0.000000 -0.000000 1.000000 219.74260 420 'point symmetry operation' ? ? -0.998439 -0.055853 0.000000 -0.00000 0.055853 -0.998439 -0.000000 -0.00000 -0.000000 0.000000 1.000000 220.26830 421 'point symmetry operation' ? ? -0.992384 -0.123182 0.000000 -0.00000 0.123182 -0.992384 -0.000000 -0.00000 -0.000000 0.000000 1.000000 220.79400 422 'point symmetry operation' ? ? -0.981794 -0.189949 -0.000000 -0.00000 0.189949 -0.981794 -0.000000 -0.00000 -0.000000 0.000000 1.000000 221.31970 423 'point symmetry operation' ? ? -0.966717 -0.255847 -0.000000 -0.00000 0.255847 -0.966717 -0.000000 -0.00000 -0.000000 0.000000 1.000000 221.84540 424 'point symmetry operation' ? ? -0.947223 -0.320576 -0.000000 -0.00000 0.320576 -0.947223 -0.000000 -0.00000 -0.000000 0.000000 1.000000 222.37110 425 'point symmetry operation' ? ? -0.923400 -0.383840 -0.000000 -0.00000 0.383840 -0.923400 -0.000000 -0.00000 -0.000000 0.000000 1.000000 222.89680 426 'point symmetry operation' ? ? -0.895356 -0.445350 -0.000000 -0.00000 0.445350 -0.895356 -0.000000 -0.00000 -0.000000 0.000000 1.000000 223.42250 427 'point symmetry operation' ? ? -0.863222 -0.504825 -0.000000 -0.00000 0.504825 -0.863222 -0.000000 -0.00000 -0.000000 0.000000 1.000000 223.94820 428 'point symmetry operation' ? ? -0.827142 -0.561993 -0.000000 -0.00000 0.561993 -0.827142 -0.000000 -0.00000 -0.000000 0.000000 1.000000 224.47390 429 'point symmetry operation' ? ? -0.787283 -0.616592 -0.000000 -0.00000 0.616592 -0.787283 -0.000000 -0.00000 -0.000000 0.000000 1.000000 224.99960 430 'point symmetry operation' ? ? -0.743825 -0.668374 -0.000000 -0.00000 0.668374 -0.743825 -0.000000 -0.00000 -0.000000 0.000000 1.000000 225.52530 431 'point symmetry operation' ? ? -0.696969 -0.717102 -0.000000 -0.00000 0.717102 -0.696969 -0.000000 -0.00000 -0.000000 0.000000 1.000000 226.05100 432 'point symmetry operation' ? ? -0.646927 -0.762552 -0.000000 -0.00000 0.762552 -0.646927 -0.000000 -0.00000 -0.000000 0.000000 1.000000 226.57670 433 'point symmetry operation' ? ? -0.593929 -0.804517 -0.000000 -0.00000 0.804517 -0.593929 -0.000000 -0.00000 -0.000000 0.000000 1.000000 227.10240 434 'point symmetry operation' ? ? -0.538217 -0.842806 -0.000000 -0.00000 0.842806 -0.538217 -0.000000 -0.00000 -0.000000 0.000000 1.000000 227.62810 435 'point symmetry operation' ? ? -0.480045 -0.877244 -0.000000 -0.00000 0.877244 -0.480045 -0.000000 -0.00000 -0.000000 0.000000 1.000000 228.15380 436 'point symmetry operation' ? ? -0.419679 -0.907672 -0.000000 -0.00000 0.907672 -0.419679 -0.000000 -0.00000 -0.000000 0.000000 1.000000 228.67950 437 'point symmetry operation' ? ? -0.357396 -0.933953 -0.000000 -0.00000 0.933953 -0.357396 -0.000000 -0.00000 -0.000000 0.000000 1.000000 229.20520 438 'point symmetry operation' ? ? -0.293479 -0.955965 -0.000000 -0.00000 0.955965 -0.293479 -0.000000 -0.00000 -0.000000 0.000000 1.000000 229.73090 439 'point symmetry operation' ? ? -0.228221 -0.973609 -0.000000 -0.00000 0.973609 -0.228221 -0.000000 -0.00000 -0.000000 0.000000 1.000000 230.25660 440 'point symmetry operation' ? ? -0.161921 -0.986804 -0.000000 -0.00000 0.986804 -0.161921 -0.000000 -0.00000 -0.000000 0.000000 1.000000 230.78230 441 'point symmetry operation' ? ? -0.094880 -0.995489 -0.000000 -0.00000 0.995489 -0.094880 -0.000000 -0.00000 -0.000000 0.000000 1.000000 231.30800 442 'point symmetry operation' ? ? -0.027405 -0.999624 -0.000000 -0.00000 0.999624 -0.027405 -0.000000 -0.00000 -0.000000 0.000000 1.000000 231.83370 443 'point symmetry operation' ? ? 0.040194 -0.999192 -0.000000 -0.00000 0.999192 0.040194 -0.000000 -0.00000 -0.000000 0.000000 1.000000 232.35940 444 'point symmetry operation' ? ? 0.107610 -0.994193 -0.000000 -0.00000 0.994193 0.107610 -0.000000 -0.00000 -0.000000 0.000000 1.000000 232.88510 445 'point symmetry operation' ? ? 0.174534 -0.984651 -0.000000 -0.00000 0.984651 0.174534 -0.000000 -0.00000 -0.000000 0.000000 1.000000 233.41080 446 'point symmetry operation' ? ? 0.240661 -0.970609 -0.000000 -0.00000 0.970609 0.240661 -0.000000 -0.00000 -0.000000 0.000000 1.000000 233.93650 447 'point symmetry operation' ? ? 0.305688 -0.952132 -0.000000 -0.00000 0.952132 0.305688 -0.000000 -0.00000 -0.000000 0.000000 1.000000 234.46220 448 'point symmetry operation' ? ? 0.369317 -0.929303 -0.000000 -0.00000 0.929303 0.369317 -0.000000 -0.00000 -0.000000 0.000000 1.000000 234.98790 449 'point symmetry operation' ? ? 0.431260 -0.902228 -0.000000 -0.00000 0.902228 0.431260 -0.000000 -0.00000 -0.000000 0.000000 1.000000 235.51360 450 'point symmetry operation' ? ? 0.491231 -0.871029 -0.000000 -0.00000 0.871029 0.491231 -0.000000 -0.00000 -0.000000 0.000000 1.000000 236.03930 451 'point symmetry operation' ? ? 0.548957 -0.835850 -0.000000 -0.00000 0.835850 0.548957 -0.000000 -0.00000 -0.000000 0.000000 1.000000 236.56500 452 'point symmetry operation' ? ? 0.604175 -0.796852 -0.000000 -0.00000 0.796852 0.604175 -0.000000 -0.00000 -0.000000 0.000000 1.000000 237.09070 453 'point symmetry operation' ? ? 0.656632 -0.754211 -0.000000 -0.00000 0.754211 0.656632 -0.000000 -0.00000 -0.000000 0.000000 1.000000 237.61640 454 'point symmetry operation' ? ? 0.706088 -0.708125 -0.000000 -0.00000 0.708125 0.706088 -0.000000 -0.00000 -0.000000 0.000000 1.000000 238.14210 455 'point symmetry operation' ? ? 0.752317 -0.658802 -0.000000 -0.00000 0.658802 0.752317 -0.000000 -0.00000 -0.000000 0.000000 1.000000 238.66780 456 'point symmetry operation' ? ? 0.795108 -0.606468 -0.000000 -0.00000 0.606468 0.795108 -0.000000 -0.00000 -0.000000 0.000000 1.000000 239.19350 457 'point symmetry operation' ? ? 0.834266 -0.551363 -0.000000 -0.00000 0.551363 0.834266 -0.000000 -0.00000 -0.000000 0.000000 1.000000 239.71920 458 'point symmetry operation' ? ? 0.869611 -0.493738 -0.000000 -0.00000 0.493738 0.869611 -0.000000 -0.00000 -0.000000 0.000000 1.000000 240.24490 459 'point symmetry operation' ? ? 0.900982 -0.433857 -0.000000 -0.00000 0.433857 0.900982 -0.000000 -0.00000 -0.000000 0.000000 1.000000 240.77060 460 'point symmetry operation' ? ? 0.928235 -0.371993 -0.000000 -0.00000 0.371993 0.928235 -0.000000 -0.00000 -0.000000 0.000000 1.000000 241.29630 461 'point symmetry operation' ? ? 0.951247 -0.308429 -0.000000 -0.00000 0.308429 0.951247 -0.000000 -0.00000 -0.000000 0.000000 1.000000 241.82200 462 'point symmetry operation' ? ? 0.969912 -0.243456 -0.000000 -0.00000 0.243456 0.969912 -0.000000 -0.00000 -0.000000 0.000000 1.000000 242.34770 463 'point symmetry operation' ? ? 0.984144 -0.177370 -0.000000 -0.00000 0.177370 0.984144 -0.000000 -0.00000 -0.000000 0.000000 1.000000 242.87340 464 'point symmetry operation' ? ? 0.993879 -0.110474 -0.000000 -0.00000 0.110474 0.993879 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 243.39910 465 'point symmetry operation' ? ? 0.999072 -0.043073 -0.000000 -0.00000 0.043073 0.999072 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 243.92480 466 'point symmetry operation' ? ? 0.999699 0.024526 -0.000000 -0.00000 -0.024526 0.999699 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 244.45050 467 'point symmetry operation' ? ? 0.995758 0.092012 -0.000000 -0.00000 -0.092012 0.995758 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 244.97620 468 'point symmetry operation' ? ? 0.987266 0.159077 -0.000000 -0.00000 -0.159077 0.987266 0.000000 -0.00000 -0.000000 -0.000000 1.000000 245.50190 469 'point symmetry operation' ? ? 0.974263 0.225416 -0.000000 -0.00000 -0.225416 0.974263 0.000000 -0.00000 -0.000000 -0.000000 1.000000 246.02760 470 'point symmetry operation' ? ? 0.956807 0.290724 -0.000000 -0.00000 -0.290724 0.956807 0.000000 -0.00000 -0.000000 -0.000000 1.000000 246.55330 471 'point symmetry operation' ? ? 0.934979 0.354704 -0.000000 -0.00000 -0.354704 0.934979 0.000000 0.00000 -0.000000 -0.000000 1.000000 247.07900 472 'point symmetry operation' ? ? 0.908878 0.417063 -0.000000 -0.00000 -0.417063 0.908878 0.000000 0.00000 -0.000000 -0.000000 1.000000 247.60470 473 'point symmetry operation' ? ? 0.878623 0.477516 -0.000000 -0.00000 -0.477516 0.878623 0.000000 0.00000 -0.000000 -0.000000 1.000000 248.13040 474 'point symmetry operation' ? ? 0.844353 0.535787 -0.000000 -0.00000 -0.535787 0.844353 0.000000 0.00000 -0.000000 -0.000000 1.000000 248.65610 475 'point symmetry operation' ? ? 0.806225 0.591609 -0.000000 -0.00000 -0.591609 0.806225 0.000000 0.00000 -0.000000 -0.000000 1.000000 249.18180 476 'point symmetry operation' ? ? 0.764412 0.644728 -0.000000 -0.00000 -0.644728 0.764412 0.000000 0.00000 -0.000000 -0.000000 1.000000 249.70750 477 'point symmetry operation' ? ? 0.719106 0.694900 -0.000000 -0.00000 -0.694900 0.719106 0.000000 0.00000 -0.000000 -0.000000 1.000000 250.23320 478 'point symmetry operation' ? ? 0.670514 0.741897 -0.000000 -0.00000 -0.741897 0.670514 0.000000 0.00000 -0.000000 -0.000000 1.000000 250.75890 479 'point symmetry operation' ? ? 0.618858 0.785503 -0.000000 -0.00000 -0.785503 0.618858 0.000000 0.00000 -0.000000 -0.000000 1.000000 251.28460 480 'point symmetry operation' ? ? 0.564373 0.825520 -0.000000 -0.00000 -0.825520 0.564373 0.000000 0.00000 -0.000000 -0.000000 1.000000 251.81030 481 'point symmetry operation' ? ? 0.507310 0.861764 -0.000000 -0.00000 -0.861764 0.507310 0.000000 0.00000 -0.000000 -0.000000 1.000000 252.33600 482 'point symmetry operation' ? ? 0.447928 0.894070 -0.000000 -0.00000 -0.894070 0.447928 0.000000 0.00000 -0.000000 -0.000000 1.000000 252.86170 483 'point symmetry operation' ? ? 0.386499 0.922290 -0.000000 -0.00000 -0.922290 0.386499 0.000000 0.00000 -0.000000 -0.000000 1.000000 253.38740 484 'point symmetry operation' ? ? 0.323304 0.946295 -0.000000 -0.00000 -0.946295 0.323304 0.000000 0.00000 -0.000000 -0.000000 1.000000 253.91310 485 'point symmetry operation' ? ? 0.258631 0.965976 -0.000000 -0.00000 -0.965976 0.258631 0.000000 0.00000 -0.000000 -0.000000 1.000000 254.43880 486 'point symmetry operation' ? ? 0.192776 0.981243 -0.000000 -0.00000 -0.981243 0.192776 0.000000 0.00000 -0.000000 -0.000000 1.000000 254.96450 487 'point symmetry operation' ? ? 0.126041 0.992025 -0.000000 -0.00000 -0.992025 0.126041 0.000000 0.00000 -0.000000 -0.000000 1.000000 255.49020 488 'point symmetry operation' ? ? 0.058729 0.998274 -0.000000 -0.00000 -0.998274 0.058729 0.000000 0.00000 -0.000000 -0.000000 1.000000 256.01590 489 'point symmetry operation' ? ? -0.008851 0.999961 -0.000000 -0.00000 -0.999961 -0.008851 0.000000 0.00000 -0.000000 -0.000000 1.000000 256.54160 490 'point symmetry operation' ? ? -0.076390 0.997078 -0.000000 -0.00000 -0.997078 -0.076390 0.000000 0.00000 -0.000000 -0.000000 1.000000 257.06730 491 'point symmetry operation' ? ? -0.143581 0.989639 -0.000000 -0.00000 -0.989639 -0.143581 0.000000 0.00000 -0.000000 -0.000000 1.000000 257.59300 492 'point symmetry operation' ? ? -0.210115 0.977677 -0.000000 -0.00000 -0.977677 -0.210115 0.000000 0.00000 -0.000000 -0.000000 1.000000 258.11870 493 'point symmetry operation' ? ? -0.275689 0.961247 -0.000000 -0.00000 -0.961247 -0.275689 0.000000 0.00000 -0.000000 -0.000000 1.000000 258.64440 494 'point symmetry operation' ? ? -0.340003 0.940424 -0.000000 -0.00000 -0.940424 -0.340003 0.000000 0.00000 -0.000000 -0.000000 1.000000 259.17010 495 'point symmetry operation' ? ? -0.402764 0.915304 -0.000000 -0.00000 -0.915304 -0.402764 0.000000 0.00000 -0.000000 -0.000000 1.000000 259.69580 496 'point symmetry operation' ? ? -0.463683 0.886001 -0.000000 -0.00000 -0.886001 -0.463683 0.000000 0.00000 -0.000000 -0.000000 1.000000 260.22150 497 'point symmetry operation' ? ? -0.522484 0.852649 -0.000000 -0.00000 -0.852649 -0.522484 0.000000 0.00000 -0.000000 -0.000000 1.000000 260.74720 498 'point symmetry operation' ? ? -0.578897 0.815400 -0.000000 -0.00000 -0.815400 -0.578897 0.000000 0.00000 -0.000000 -0.000000 1.000000 261.27290 499 'point symmetry operation' ? ? -0.632665 0.774426 -0.000000 -0.00000 -0.774426 -0.632665 0.000000 0.00000 -0.000000 -0.000000 1.000000 261.79860 500 'point symmetry operation' ? ? -0.683541 0.729912 -0.000000 -0.00000 -0.729912 -0.683541 0.000000 0.00000 -0.000000 -0.000000 1.000000 262.32430 501 'point symmetry operation' ? ? -0.731294 0.682062 -0.000000 -0.00000 -0.682062 -0.731294 0.000000 0.00000 -0.000000 -0.000000 1.000000 262.85000 502 'point symmetry operation' ? ? -0.775705 0.631096 -0.000000 -0.00000 -0.631096 -0.775705 0.000000 0.00000 -0.000000 -0.000000 1.000000 263.37570 503 'point symmetry operation' ? ? -0.816571 0.577245 -0.000000 -0.00000 -0.577245 -0.816571 0.000000 0.00000 -0.000000 -0.000000 1.000000 263.90140 504 'point symmetry operation' ? ? -0.853705 0.520757 -0.000000 -0.00000 -0.520757 -0.853705 0.000000 0.00000 -0.000000 -0.000000 1.000000 264.42710 505 'point symmetry operation' ? ? -0.886938 0.461889 -0.000000 -0.00000 -0.461889 -0.886938 0.000000 0.00000 -0.000000 -0.000000 1.000000 264.95280 506 'point symmetry operation' ? ? -0.916118 0.400910 -0.000000 -0.00000 -0.400910 -0.916118 0.000000 0.00000 -0.000000 -0.000000 1.000000 265.47850 507 'point symmetry operation' ? ? -0.941111 0.338098 -0.000000 -0.00000 -0.338098 -0.941111 0.000000 0.00000 -0.000000 -0.000000 1.000000 266.00420 508 'point symmetry operation' ? ? -0.961803 0.273742 -0.000000 -0.00000 -0.273742 -0.961803 0.000000 0.00000 -0.000000 -0.000000 1.000000 266.52990 509 'point symmetry operation' ? ? -0.978100 0.208135 -0.000000 -0.00000 -0.208135 -0.978100 0.000000 0.00000 -0.000000 -0.000000 1.000000 267.05560 510 'point symmetry operation' ? ? -0.989927 0.141577 -0.000000 -0.00000 -0.141577 -0.989927 0.000000 -0.00000 -0.000000 -0.000000 1.000000 267.58130 511 'point symmetry operation' ? ? -0.997231 0.074371 -0.000000 -0.00000 -0.074371 -0.997231 0.000000 -0.00000 0.000000 -0.000000 1.000000 268.10700 512 'point symmetry operation' ? ? -0.999977 0.006826 -0.000000 -0.00000 -0.006826 -0.999977 0.000000 -0.00000 0.000000 -0.000000 1.000000 268.63270 513 'point symmetry operation' ? ? -0.998153 -0.060750 0.000000 -0.00000 0.060750 -0.998153 -0.000000 -0.00000 -0.000000 0.000000 1.000000 269.15840 514 'point symmetry operation' ? ? -0.991768 -0.128049 -0.000000 -0.00000 0.128049 -0.991768 -0.000000 -0.00000 -0.000000 0.000000 1.000000 269.68410 515 'point symmetry operation' ? ? -0.980850 -0.194763 -0.000000 -0.00000 0.194763 -0.980850 -0.000000 -0.00000 -0.000000 0.000000 1.000000 270.20980 516 'point symmetry operation' ? ? -0.965451 -0.260586 -0.000000 -0.00000 0.260586 -0.965451 -0.000000 -0.00000 -0.000000 0.000000 1.000000 270.73550 517 'point symmetry operation' ? ? -0.945639 -0.325219 -0.000000 -0.00000 0.325219 -0.945639 -0.000000 -0.00000 -0.000000 0.000000 1.000000 271.26120 518 'point symmetry operation' ? ? -0.921505 -0.388365 -0.000000 -0.00000 0.388365 -0.921505 -0.000000 -0.00000 -0.000000 0.000000 1.000000 271.78690 519 'point symmetry operation' ? ? -0.893161 -0.449737 -0.000000 -0.00000 0.449737 -0.893161 -0.000000 -0.00000 -0.000000 0.000000 1.000000 272.31260 520 'point symmetry operation' ? ? -0.860735 -0.509054 -0.000000 -0.00000 0.509054 -0.860735 -0.000000 -0.00000 -0.000000 0.000000 1.000000 272.83830 521 'point symmetry operation' ? ? -0.824375 -0.566044 -0.000000 -0.00000 0.566044 -0.824375 -0.000000 -0.00000 -0.000000 0.000000 1.000000 273.36400 522 'point symmetry operation' ? ? -0.784248 -0.620447 -0.000000 -0.00000 0.620447 -0.784248 -0.000000 -0.00000 -0.000000 0.000000 1.000000 273.88970 523 'point symmetry operation' ? ? -0.740537 -0.672015 -0.000000 -0.00000 0.672015 -0.740537 -0.000000 -0.00000 -0.000000 0.000000 1.000000 274.41540 524 'point symmetry operation' ? ? -0.693442 -0.720512 -0.000000 -0.00000 0.720512 -0.693442 -0.000000 -0.00000 -0.000000 0.000000 1.000000 274.94110 525 'point symmetry operation' ? ? -0.643178 -0.765716 -0.000000 -0.00000 0.765716 -0.643178 -0.000000 -0.00000 -0.000000 0.000000 1.000000 275.46680 526 'point symmetry operation' ? ? -0.589975 -0.807421 -0.000000 -0.00000 0.807421 -0.589975 -0.000000 -0.00000 -0.000000 0.000000 1.000000 275.99250 527 'point symmetry operation' ? ? -0.534076 -0.845437 -0.000000 -0.00000 0.845437 -0.534076 -0.000000 -0.00000 -0.000000 0.000000 1.000000 276.51820 528 'point symmetry operation' ? ? -0.475736 -0.879588 -0.000000 -0.00000 0.879588 -0.475736 -0.000000 -0.00000 -0.000000 0.000000 1.000000 277.04390 529 'point symmetry operation' ? ? -0.415222 -0.909720 -0.000000 -0.00000 0.909720 -0.415222 -0.000000 -0.00000 -0.000000 0.000000 1.000000 277.56960 530 'point symmetry operation' ? ? -0.352810 -0.935695 -0.000000 -0.00000 0.935695 -0.352810 -0.000000 -0.00000 -0.000000 0.000000 1.000000 278.09530 531 'point symmetry operation' ? ? -0.288786 -0.957394 -0.000000 -0.00000 0.957394 -0.288786 -0.000000 -0.00000 -0.000000 0.000000 1.000000 278.62100 532 'point symmetry operation' ? ? -0.223443 -0.974717 -0.000000 -0.00000 0.974717 -0.223443 -0.000000 -0.00000 -0.000000 0.000000 1.000000 279.14670 533 'point symmetry operation' ? ? -0.157078 -0.987586 -0.000000 -0.00000 0.987586 -0.157078 -0.000000 -0.00000 -0.000000 0.000000 1.000000 279.67240 534 'point symmetry operation' ? ? -0.089995 -0.995942 -0.000000 -0.00000 0.995942 -0.089995 -0.000000 -0.00000 -0.000000 0.000000 1.000000 280.19810 535 'point symmetry operation' ? ? -0.022501 -0.999747 -0.000000 -0.00000 0.999747 -0.022501 -0.000000 -0.00000 -0.000000 0.000000 1.000000 280.72380 536 'point symmetry operation' ? ? 0.045095 -0.998983 -0.000000 -0.00000 0.998983 0.045095 -0.000000 -0.00000 -0.000000 0.000000 1.000000 281.24950 537 'point symmetry operation' ? ? 0.112486 -0.993653 -0.000000 -0.00000 0.993653 0.112486 -0.000000 -0.00000 -0.000000 0.000000 1.000000 281.77520 538 'point symmetry operation' ? ? 0.179363 -0.983783 -0.000000 -0.00000 0.983783 0.179363 -0.000000 -0.00000 -0.000000 0.000000 1.000000 282.30090 539 'point symmetry operation' ? ? 0.245419 -0.969417 -0.000000 -0.00000 0.969417 0.245419 -0.000000 -0.00000 -0.000000 0.000000 1.000000 282.82660 540 'point symmetry operation' ? ? 0.310355 -0.950621 -0.000000 -0.00000 0.950621 0.310355 -0.000000 -0.00000 -0.000000 0.000000 1.000000 283.35230 541 'point symmetry operation' ? ? 0.373872 -0.927480 -0.000000 -0.00000 0.927480 0.373872 -0.000000 -0.00000 -0.000000 0.000000 1.000000 283.87800 542 'point symmetry operation' ? ? 0.435680 -0.900101 -0.000000 -0.00000 0.900101 0.435680 -0.000000 -0.00000 -0.000000 0.000000 1.000000 284.40370 543 'point symmetry operation' ? ? 0.495498 -0.868609 -0.000000 -0.00000 0.868609 0.495498 -0.000000 -0.00000 -0.000000 0.000000 1.000000 284.92940 544 'point symmetry operation' ? ? 0.553051 -0.833147 -0.000000 -0.00000 0.833147 0.553051 -0.000000 -0.00000 -0.000000 0.000000 1.000000 285.45510 545 'point symmetry operation' ? ? 0.608077 -0.793878 -0.000000 -0.00000 0.793878 0.608077 -0.000000 -0.00000 -0.000000 0.000000 1.000000 285.98080 546 'point symmetry operation' ? ? 0.660324 -0.750981 -0.000000 -0.00000 0.750981 0.660324 -0.000000 -0.00000 -0.000000 0.000000 1.000000 286.50650 547 'point symmetry operation' ? ? 0.709553 -0.704652 -0.000000 -0.00000 0.704652 0.709553 -0.000000 -0.00000 -0.000000 0.000000 1.000000 287.03220 548 'point symmetry operation' ? ? 0.755539 -0.655103 -0.000000 -0.00000 0.655103 0.755539 -0.000000 -0.00000 -0.000000 0.000000 1.000000 287.55790 549 'point symmetry operation' ? ? 0.798073 -0.602560 -0.000000 -0.00000 0.602560 0.798073 -0.000000 -0.00000 -0.000000 0.000000 1.000000 288.08360 550 'point symmetry operation' ? ? 0.836960 -0.547264 -0.000000 -0.00000 0.547264 0.836960 -0.000000 -0.00000 -0.000000 0.000000 1.000000 288.60930 551 'point symmetry operation' ? ? 0.872022 -0.489466 -0.000000 -0.00000 0.489466 0.872022 -0.000000 -0.00000 -0.000000 0.000000 1.000000 289.13500 552 'point symmetry operation' ? ? 0.903099 -0.429432 -0.000000 -0.00000 0.429432 0.903099 -0.000000 -0.00000 -0.000000 0.000000 1.000000 289.66070 553 'point symmetry operation' ? ? 0.930049 -0.367435 -0.000000 -0.00000 0.367435 0.930049 -0.000000 -0.00000 -0.000000 0.000000 1.000000 290.18640 554 'point symmetry operation' ? ? 0.952749 -0.303759 -0.000000 -0.00000 0.303759 0.952749 -0.000000 -0.00000 -0.000000 0.000000 1.000000 290.71210 555 'point symmetry operation' ? ? 0.971095 -0.238695 -0.000000 -0.00000 0.238695 0.971095 -0.000000 -0.00000 -0.000000 0.000000 1.000000 291.23780 556 'point symmetry operation' ? ? 0.985002 -0.172540 -0.000000 -0.00000 0.172540 0.985002 -0.000000 -0.00000 -0.000000 0.000000 1.000000 291.76350 557 'point symmetry operation' ? ? 0.994409 -0.105597 -0.000000 -0.00000 0.105597 0.994409 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 292.28920 558 'point symmetry operation' ? ? 0.999271 -0.038171 -0.000000 -0.00000 0.038171 0.999271 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 292.81490 559 'point symmetry operation' ? ? 0.999567 0.029429 -0.000000 -0.00000 -0.029429 0.999567 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 293.34060 560 'point symmetry operation' ? ? 0.995295 0.096895 -0.000000 -0.00000 -0.096895 0.995295 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 293.86630 561 'point symmetry operation' ? ? 0.986474 0.163918 -0.000000 -0.00000 -0.163918 0.986474 0.000000 -0.00000 -0.000000 -0.000000 1.000000 294.39200 562 'point symmetry operation' ? ? 0.973145 0.230192 -0.000000 -0.00000 -0.230192 0.973145 0.000000 -0.00000 -0.000000 -0.000000 1.000000 294.91770 563 'point symmetry operation' ? ? 0.955369 0.295414 -0.000000 -0.00000 -0.295414 0.955369 0.000000 -0.00000 -0.000000 -0.000000 1.000000 295.44340 564 'point symmetry operation' ? ? 0.933227 0.359286 -0.000000 -0.00000 -0.359286 0.933227 0.000000 -0.00000 -0.000000 -0.000000 1.000000 295.96910 565 'point symmetry operation' ? ? 0.906821 0.421516 -0.000000 -0.00000 -0.421516 0.906821 0.000000 -0.00000 -0.000000 -0.000000 1.000000 296.49480 566 'point symmetry operation' ? ? 0.876270 0.481820 -0.000000 -0.00000 -0.481820 0.876270 0.000000 0.00000 -0.000000 -0.000000 1.000000 297.02050 567 'point symmetry operation' ? ? 0.841715 0.539922 -0.000000 -0.00000 -0.539922 0.841715 0.000000 0.00000 -0.000000 -0.000000 1.000000 297.54620 568 'point symmetry operation' ? ? 0.803313 0.595557 -0.000000 -0.00000 -0.595557 0.803313 0.000000 0.00000 -0.000000 -0.000000 1.000000 298.07190 569 'point symmetry operation' ? ? 0.761240 0.648470 -0.000000 -0.00000 -0.648470 0.761240 0.000000 0.00000 -0.000000 -0.000000 1.000000 298.59760 570 'point symmetry operation' ? ? 0.715689 0.698419 -0.000000 -0.00000 -0.698419 0.715689 0.000000 0.00000 -0.000000 -0.000000 1.000000 299.12330 571 'point symmetry operation' ? ? 0.666867 0.745177 -0.000000 -0.00000 -0.745177 0.666867 0.000000 0.00000 -0.000000 -0.000000 1.000000 299.64900 572 'point symmetry operation' ? ? 0.614997 0.788529 -0.000000 -0.00000 -0.788529 0.614997 0.000000 0.00000 -0.000000 -0.000000 1.000000 300.17470 573 'point symmetry operation' ? ? 0.560317 0.828278 -0.000000 -0.00000 -0.828278 0.560317 0.000000 0.00000 -0.000000 -0.000000 1.000000 300.70040 574 'point symmetry operation' ? ? 0.503076 0.864242 -0.000000 -0.00000 -0.864242 0.503076 0.000000 0.00000 -0.000000 -0.000000 1.000000 301.22610 575 'point symmetry operation' ? ? 0.443536 0.896256 -0.000000 -0.00000 -0.896256 0.443536 0.000000 0.00000 -0.000000 -0.000000 1.000000 301.75180 576 'point symmetry operation' ? ? 0.381970 0.924175 -0.000000 -0.00000 -0.924175 0.381970 0.000000 0.00000 -0.000000 -0.000000 1.000000 302.27750 577 'point symmetry operation' ? ? 0.318658 0.947870 -0.000000 -0.00000 -0.947870 0.318658 0.000000 0.00000 -0.000000 -0.000000 1.000000 302.80320 578 'point symmetry operation' ? ? 0.253889 0.967233 -0.000000 -0.00000 -0.967233 0.253889 0.000000 0.00000 -0.000000 -0.000000 1.000000 303.32890 579 'point symmetry operation' ? ? 0.187960 0.982177 -0.000000 -0.00000 -0.982177 0.187960 0.000000 0.00000 -0.000000 -0.000000 1.000000 303.85460 580 'point symmetry operation' ? ? 0.121173 0.992631 -0.000000 -0.00000 -0.992631 0.121173 0.000000 0.00000 -0.000000 -0.000000 1.000000 304.38030 581 'point symmetry operation' ? ? 0.053831 0.998550 -0.000000 -0.00000 -0.998550 0.053831 0.000000 0.00000 -0.000000 -0.000000 1.000000 304.90600 582 'point symmetry operation' ? ? -0.013756 0.999905 -0.000000 -0.00000 -0.999905 -0.013756 0.000000 0.00000 -0.000000 -0.000000 1.000000 305.43170 583 'point symmetry operation' ? ? -0.081281 0.996691 -0.000000 -0.00000 -0.996691 -0.081281 0.000000 0.00000 -0.000000 -0.000000 1.000000 305.95740 584 'point symmetry operation' ? ? -0.148434 0.988922 -0.000000 -0.00000 -0.988922 -0.148434 0.000000 0.00000 -0.000000 -0.000000 1.000000 306.48310 585 'point symmetry operation' ? ? -0.214909 0.976634 -0.000000 -0.00000 -0.976634 -0.214909 0.000000 0.00000 -0.000000 -0.000000 1.000000 307.00880 586 'point symmetry operation' ? ? -0.280401 0.959883 -0.000000 -0.00000 -0.959883 -0.280401 0.000000 0.00000 -0.000000 -0.000000 1.000000 307.53450 587 'point symmetry operation' ? ? -0.344612 0.938745 -0.000000 -0.00000 -0.938745 -0.344612 0.000000 0.00000 -0.000000 -0.000000 1.000000 308.06020 588 'point symmetry operation' ? ? -0.407249 0.913317 -0.000000 -0.00000 -0.913317 -0.407249 0.000000 0.00000 -0.000000 -0.000000 1.000000 308.58590 589 'point symmetry operation' ? ? -0.468024 0.883716 -0.000000 -0.00000 -0.883716 -0.468024 0.000000 0.00000 -0.000000 -0.000000 1.000000 309.11160 590 'point symmetry operation' ? ? -0.526661 0.850076 -0.000000 -0.00000 -0.850076 -0.526661 0.000000 0.00000 -0.000000 -0.000000 1.000000 309.63730 591 'point symmetry operation' ? ? -0.582890 0.812551 -0.000000 -0.00000 -0.812551 -0.582890 0.000000 0.00000 -0.000000 -0.000000 1.000000 310.16300 592 'point symmetry operation' ? ? -0.636456 0.771313 -0.000000 -0.00000 -0.771313 -0.636456 0.000000 0.00000 -0.000000 -0.000000 1.000000 310.68870 593 'point symmetry operation' ? ? -0.687114 0.726550 -0.000000 -0.00000 -0.726550 -0.687114 0.000000 0.00000 -0.000000 -0.000000 1.000000 311.21440 594 'point symmetry operation' ? ? -0.734631 0.678467 -0.000000 -0.00000 -0.678467 -0.734631 0.000000 0.00000 -0.000000 -0.000000 1.000000 311.74010 595 'point symmetry operation' ? ? -0.778792 0.627283 -0.000000 -0.00000 -0.627283 -0.778792 0.000000 0.00000 -0.000000 -0.000000 1.000000 312.26580 596 'point symmetry operation' ? ? -0.819393 0.573233 -0.000000 -0.00000 -0.573233 -0.819393 0.000000 0.00000 -0.000000 -0.000000 1.000000 312.79150 597 'point symmetry operation' ? ? -0.856249 0.516563 -0.000000 -0.00000 -0.516563 -0.856249 0.000000 0.00000 -0.000000 -0.000000 1.000000 313.31720 598 'point symmetry operation' ? ? -0.889193 0.457532 -0.000000 -0.00000 -0.457532 -0.889193 0.000000 0.00000 -0.000000 -0.000000 1.000000 313.84290 599 'point symmetry operation' ? ? -0.918073 0.396411 -0.000000 -0.00000 -0.396411 -0.918073 0.000000 0.00000 -0.000000 -0.000000 1.000000 314.36860 600 'point symmetry operation' ? ? -0.942758 0.333478 -0.000000 -0.00000 -0.333478 -0.942758 0.000000 0.00000 -0.000000 -0.000000 1.000000 314.89430 601 'point symmetry operation' ? ? -0.963134 0.269021 -0.000000 -0.00000 -0.269021 -0.963134 0.000000 0.00000 -0.000000 -0.000000 1.000000 315.42000 602 'point symmetry operation' ? ? -0.979109 0.203334 -0.000000 -0.00000 -0.203334 -0.979109 0.000000 -0.00000 -0.000000 -0.000000 1.000000 315.94570 603 'point symmetry operation' ? ? -0.990610 0.136719 -0.000000 -0.00000 -0.136719 -0.990610 0.000000 -0.00000 -0.000000 -0.000000 1.000000 316.47140 604 'point symmetry operation' ? ? -0.997583 0.069478 -0.000000 -0.00000 -0.069478 -0.997583 0.000000 -0.00000 0.000000 -0.000000 1.000000 316.99710 605 'point symmetry operation' ? ? -0.999998 0.001921 -0.000000 -0.00000 -0.001921 -0.999998 0.000000 -0.00000 0.000000 -0.000000 1.000000 317.52280 606 'point symmetry operation' ? ? -0.997843 -0.065646 0.000000 -0.00000 0.065646 -0.997843 -0.000000 -0.00000 -0.000000 0.000000 1.000000 318.04850 607 'point symmetry operation' ? ? -0.991128 -0.132913 -0.000000 -0.00000 0.132913 -0.991128 -0.000000 -0.00000 -0.000000 0.000000 1.000000 318.57420 608 'point symmetry operation' ? ? -0.979883 -0.199572 -0.000000 -0.00000 0.199572 -0.979883 -0.000000 -0.00000 -0.000000 0.000000 1.000000 319.09990 609 'point symmetry operation' ? ? -0.964161 -0.265319 -0.000000 -0.00000 0.265319 -0.964161 -0.000000 -0.00000 -0.000000 0.000000 1.000000 319.62560 610 'point symmetry operation' ? ? -0.944032 -0.329854 -0.000000 -0.00000 0.329854 -0.944032 -0.000000 -0.00000 -0.000000 0.000000 1.000000 320.15130 611 'point symmetry operation' ? ? -0.919589 -0.392881 -0.000000 -0.00000 0.392881 -0.919589 -0.000000 -0.00000 -0.000000 0.000000 1.000000 320.67700 612 'point symmetry operation' ? ? -0.890944 -0.454113 -0.000000 -0.00000 0.454113 -0.890944 -0.000000 -0.00000 -0.000000 0.000000 1.000000 321.20270 613 'point symmetry operation' ? ? -0.858227 -0.513270 -0.000000 -0.00000 0.513270 -0.858227 -0.000000 -0.00000 -0.000000 0.000000 1.000000 321.72840 614 'point symmetry operation' ? ? -0.821589 -0.570081 -0.000000 -0.00000 0.570081 -0.821589 -0.000000 -0.00000 -0.000000 0.000000 1.000000 322.25410 615 'point symmetry operation' ? ? -0.781195 -0.624287 -0.000000 -0.00000 0.624287 -0.781195 -0.000000 -0.00000 -0.000000 0.000000 1.000000 322.77980 616 'point symmetry operation' ? ? -0.737232 -0.675640 -0.000000 -0.00000 0.675640 -0.737232 -0.000000 -0.00000 -0.000000 0.000000 1.000000 323.30550 617 'point symmetry operation' ? ? -0.689900 -0.723905 -0.000000 -0.00000 0.723905 -0.689900 -0.000000 -0.00000 -0.000000 0.000000 1.000000 323.83120 618 'point symmetry operation' ? ? -0.639414 -0.768862 -0.000000 -0.00000 0.768862 -0.639414 -0.000000 -0.00000 -0.000000 0.000000 1.000000 324.35690 619 'point symmetry operation' ? ? -0.586007 -0.810306 -0.000000 -0.00000 0.810306 -0.586007 -0.000000 -0.00000 -0.000000 0.000000 1.000000 324.88260 620 'point symmetry operation' ? ? -0.529922 -0.848046 -0.000000 -0.00000 0.848046 -0.529922 -0.000000 -0.00000 -0.000000 0.000000 1.000000 325.40830 621 'point symmetry operation' ? ? -0.471415 -0.881911 -0.000000 -0.00000 0.881911 -0.471415 -0.000000 -0.00000 -0.000000 0.000000 1.000000 325.93400 622 'point symmetry operation' ? ? -0.410754 -0.911746 -0.000000 -0.00000 0.911746 -0.410754 -0.000000 -0.00000 -0.000000 0.000000 1.000000 326.45970 623 'point symmetry operation' ? ? -0.348216 -0.937414 -0.000000 -0.00000 0.937414 -0.348216 -0.000000 -0.00000 -0.000000 0.000000 1.000000 326.98540 624 'point symmetry operation' ? ? -0.284086 -0.958799 -0.000000 -0.00000 0.958799 -0.284086 -0.000000 -0.00000 -0.000000 0.000000 1.000000 327.51110 625 'point symmetry operation' ? ? -0.218658 -0.975801 -0.000000 -0.00000 0.975801 -0.218658 -0.000000 -0.00000 -0.000000 0.000000 1.000000 328.03680 626 'point symmetry operation' ? ? -0.152231 -0.988345 -0.000000 -0.00000 0.988345 -0.152231 -0.000000 -0.00000 -0.000000 0.000000 1.000000 328.56250 627 'point symmetry operation' ? ? -0.085108 -0.996372 -0.000000 -0.00000 0.996372 -0.085108 -0.000000 -0.00000 -0.000000 0.000000 1.000000 329.08820 628 'point symmetry operation' ? ? -0.017597 -0.999845 -0.000000 -0.00000 0.999845 -0.017597 -0.000000 -0.00000 -0.000000 0.000000 1.000000 329.61390 629 'point symmetry operation' ? ? 0.049995 -0.998749 -0.000000 -0.00000 0.998749 0.049995 -0.000000 -0.00000 -0.000000 0.000000 1.000000 330.13960 630 'point symmetry operation' ? ? 0.117359 -0.993090 -0.000000 -0.00000 0.993090 0.117359 -0.000000 -0.00000 -0.000000 0.000000 1.000000 330.66530 631 'point symmetry operation' ? ? 0.184186 -0.982891 -0.000000 -0.00000 0.982891 0.184186 -0.000000 -0.00000 -0.000000 0.000000 1.000000 331.19100 632 'point symmetry operation' ? ? 0.250172 -0.968201 -0.000000 -0.00000 0.968201 0.250172 -0.000000 -0.00000 -0.000000 0.000000 1.000000 331.71670 633 'point symmetry operation' ? ? 0.315014 -0.949087 -0.000000 -0.00000 0.949087 0.315014 -0.000000 -0.00000 -0.000000 0.000000 1.000000 332.24240 634 'point symmetry operation' ? ? 0.378417 -0.925635 -0.000000 -0.00000 0.925635 0.378417 -0.000000 -0.00000 -0.000000 0.000000 1.000000 332.76810 635 'point symmetry operation' ? ? 0.440091 -0.897953 -0.000000 -0.00000 0.897953 0.440091 -0.000000 -0.00000 -0.000000 0.000000 1.000000 333.29380 636 'point symmetry operation' ? ? 0.499753 -0.866168 -0.000000 -0.00000 0.866168 0.499753 -0.000000 -0.00000 -0.000000 0.000000 1.000000 333.81950 637 'point symmetry operation' ? ? 0.557131 -0.830424 -0.000000 -0.00000 0.830424 0.557131 -0.000000 -0.00000 -0.000000 0.000000 1.000000 334.34520 638 'point symmetry operation' ? ? 0.611964 -0.790886 -0.000000 -0.00000 0.790886 0.611964 -0.000000 -0.00000 -0.000000 0.000000 1.000000 334.87090 639 'point symmetry operation' ? ? 0.664000 -0.747733 -0.000000 -0.00000 0.747733 0.664000 -0.000000 -0.00000 -0.000000 0.000000 1.000000 335.39660 640 'point symmetry operation' ? ? 0.713001 -0.701163 -0.000000 -0.00000 0.701163 0.713001 -0.000000 -0.00000 -0.000000 0.000000 1.000000 335.92230 641 'point symmetry operation' ? ? 0.758744 -0.651389 -0.000000 -0.00000 0.651389 0.758744 -0.000000 -0.00000 -0.000000 0.000000 1.000000 336.44800 642 'point symmetry operation' ? ? 0.801020 -0.598638 -0.000000 -0.00000 0.598638 0.801020 -0.000000 -0.00000 -0.000000 0.000000 1.000000 336.97370 643 'point symmetry operation' ? ? 0.839635 -0.543151 -0.000000 -0.00000 0.543151 0.839635 -0.000000 -0.00000 -0.000000 0.000000 1.000000 337.49940 644 'point symmetry operation' ? ? 0.874413 -0.485182 -0.000000 -0.00000 0.485182 0.874413 -0.000000 -0.00000 -0.000000 0.000000 1.000000 338.02510 645 'point symmetry operation' ? ? 0.905195 -0.424996 -0.000000 -0.00000 0.424996 0.905195 -0.000000 -0.00000 -0.000000 0.000000 1.000000 338.55080 646 'point symmetry operation' ? ? 0.931840 -0.362868 -0.000000 -0.00000 0.362868 0.931840 -0.000000 -0.00000 -0.000000 0.000000 1.000000 339.07650 647 'point symmetry operation' ? ? 0.954227 -0.299082 -0.000000 -0.00000 0.299082 0.954227 -0.000000 -0.00000 -0.000000 0.000000 1.000000 339.60220 648 'point symmetry operation' ? ? 0.972254 -0.233929 -0.000000 -0.00000 0.233929 0.972254 -0.000000 -0.00000 -0.000000 0.000000 1.000000 340.12790 649 'point symmetry operation' ? ? 0.985837 -0.167706 -0.000000 -0.00000 0.167706 0.985837 -0.000000 -0.00000 -0.000000 0.000000 1.000000 340.65360 650 'point symmetry operation' ? ? 0.994915 -0.100718 -0.000000 -0.00000 0.100718 0.994915 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 341.17930 651 'point symmetry operation' ? ? 0.999446 -0.033269 -0.000000 -0.00000 0.033269 0.999446 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 341.70500 652 'point symmetry operation' ? ? 0.999410 0.034332 -0.000000 -0.00000 -0.034332 0.999410 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 342.23070 653 'point symmetry operation' ? ? 0.994807 0.101777 -0.000000 -0.00000 -0.101777 0.994807 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 342.75640 654 'point symmetry operation' ? ? 0.985658 0.168756 -0.000000 -0.00000 -0.168756 0.985658 0.000000 -0.00000 -0.000000 -0.000000 1.000000 343.28210 655 'point symmetry operation' ? ? 0.972004 0.234963 -0.000000 -0.00000 -0.234963 0.972004 0.000000 -0.00000 -0.000000 -0.000000 1.000000 343.80780 656 'point symmetry operation' ? ? 0.953909 0.300097 -0.000000 -0.00000 -0.300097 0.953909 0.000000 -0.00000 -0.000000 -0.000000 1.000000 344.33350 657 'point symmetry operation' ? ? 0.931454 0.363860 -0.000000 -0.00000 -0.363860 0.931454 0.000000 -0.00000 -0.000000 -0.000000 1.000000 344.85920 658 'point symmetry operation' ? ? 0.904742 0.425960 -0.000000 -0.00000 -0.425960 0.904742 0.000000 -0.00000 -0.000000 -0.000000 1.000000 345.38490 659 'point symmetry operation' ? ? 0.873896 0.486113 -0.000000 -0.00000 -0.486113 0.873896 0.000000 -0.00000 -0.000000 -0.000000 1.000000 345.91060 660 'point symmetry operation' ? ? 0.839056 0.544045 -0.000000 -0.00000 -0.544045 0.839056 0.000000 0.00000 -0.000000 -0.000000 1.000000 346.43630 661 'point symmetry operation' ? ? 0.800382 0.599490 -0.000000 -0.00000 -0.599490 0.800382 0.000000 0.00000 -0.000000 -0.000000 1.000000 346.96200 662 'point symmetry operation' ? ? 0.758050 0.652196 -0.000000 -0.00000 -0.652196 0.758050 0.000000 0.00000 -0.000000 -0.000000 1.000000 347.48770 663 'point symmetry operation' ? ? 0.712254 0.701922 -0.000000 -0.00000 -0.701922 0.712254 0.000000 0.00000 -0.000000 -0.000000 1.000000 348.01340 664 'point symmetry operation' ? ? 0.663203 0.748439 -0.000000 -0.00000 -0.748439 0.663203 0.000000 0.00000 -0.000000 -0.000000 1.000000 348.53910 665 'point symmetry operation' ? ? 0.611122 0.791537 -0.000000 -0.00000 -0.791537 0.611122 0.000000 0.00000 -0.000000 -0.000000 1.000000 349.06480 666 'point symmetry operation' ? ? 0.556247 0.831017 -0.000000 -0.00000 -0.831017 0.556247 0.000000 0.00000 -0.000000 -0.000000 1.000000 349.59050 667 'point symmetry operation' ? ? 0.498831 0.866700 -0.000000 -0.00000 -0.866700 0.498831 0.000000 0.00000 -0.000000 -0.000000 1.000000 350.11620 668 'point symmetry operation' ? ? 0.439134 0.898421 -0.000000 -0.00000 -0.898421 0.439134 0.000000 0.00000 -0.000000 -0.000000 1.000000 350.64190 669 'point symmetry operation' ? ? 0.377432 0.926037 -0.000000 -0.00000 -0.926037 0.377432 0.000000 0.00000 -0.000000 -0.000000 1.000000 351.16760 670 'point symmetry operation' ? ? 0.314004 0.949422 -0.000000 -0.00000 -0.949422 0.314004 0.000000 0.00000 -0.000000 -0.000000 1.000000 351.69330 671 'point symmetry operation' ? ? 0.249141 0.968467 -0.000000 -0.00000 -0.968467 0.249141 0.000000 0.00000 -0.000000 -0.000000 1.000000 352.21900 672 'point symmetry operation' ? ? 0.183140 0.983087 -0.000000 -0.00000 -0.983087 0.183140 0.000000 0.00000 -0.000000 -0.000000 1.000000 352.74470 673 'point symmetry operation' ? ? 0.116302 0.993214 -0.000000 -0.00000 -0.993214 0.116302 0.000000 0.00000 -0.000000 -0.000000 1.000000 353.27040 674 'point symmetry operation' ? ? 0.048932 0.998802 -0.000000 -0.00000 -0.998802 0.048932 0.000000 0.00000 -0.000000 -0.000000 1.000000 353.79610 675 'point symmetry operation' ? ? -0.018661 0.999826 -0.000000 -0.00000 -0.999826 -0.018661 0.000000 0.00000 -0.000000 -0.000000 1.000000 354.32180 676 'point symmetry operation' ? ? -0.086169 0.996281 -0.000000 -0.00000 -0.996281 -0.086169 0.000000 0.00000 -0.000000 -0.000000 1.000000 354.84750 677 'point symmetry operation' ? ? -0.153283 0.988182 -0.000000 -0.00000 -0.988182 -0.153283 0.000000 0.00000 -0.000000 -0.000000 1.000000 355.37320 678 'point symmetry operation' ? ? -0.219697 0.975568 -0.000000 -0.00000 -0.975568 -0.219697 0.000000 0.00000 -0.000000 -0.000000 1.000000 355.89890 679 'point symmetry operation' ? ? -0.285107 0.958496 -0.000000 -0.00000 -0.958496 -0.285107 0.000000 0.00000 -0.000000 -0.000000 1.000000 356.42460 680 'point symmetry operation' ? ? -0.349213 0.937043 -0.000000 -0.00000 -0.937043 -0.349213 0.000000 0.00000 -0.000000 -0.000000 1.000000 356.95030 681 'point symmetry operation' ? ? -0.411724 0.911308 -0.000000 -0.00000 -0.911308 -0.411724 0.000000 0.00000 -0.000000 -0.000000 1.000000 357.47600 682 'point symmetry operation' ? ? -0.472354 0.881409 -0.000000 -0.00000 -0.881409 -0.472354 0.000000 0.00000 -0.000000 -0.000000 1.000000 358.00170 683 'point symmetry operation' ? ? -0.530825 0.847482 -0.000000 -0.00000 -0.847482 -0.530825 0.000000 0.00000 -0.000000 -0.000000 1.000000 358.52740 684 'point symmetry operation' ? ? -0.586869 0.809682 -0.000000 -0.00000 -0.809682 -0.586869 0.000000 0.00000 -0.000000 -0.000000 1.000000 359.05310 685 'point symmetry operation' ? ? -0.640233 0.768181 -0.000000 -0.00000 -0.768181 -0.640233 0.000000 0.00000 -0.000000 -0.000000 1.000000 359.57880 686 'point symmetry operation' ? ? -0.690670 0.723170 -0.000000 -0.00000 -0.723170 -0.690670 0.000000 0.00000 -0.000000 -0.000000 1.000000 360.10450 687 'point symmetry operation' ? ? -0.737951 0.674855 -0.000000 -0.00000 -0.674855 -0.737951 0.000000 0.00000 -0.000000 -0.000000 1.000000 360.63020 688 'point symmetry operation' ? ? -0.781859 0.623455 -0.000000 -0.00000 -0.623455 -0.781859 0.000000 0.00000 -0.000000 -0.000000 1.000000 361.15590 689 'point symmetry operation' ? ? -0.822195 0.569206 -0.000000 -0.00000 -0.569206 -0.822195 0.000000 0.00000 -0.000000 -0.000000 1.000000 361.68160 690 'point symmetry operation' ? ? -0.858773 0.512356 -0.000000 -0.00000 -0.512356 -0.858773 0.000000 0.00000 -0.000000 -0.000000 1.000000 362.20730 691 'point symmetry operation' ? ? -0.891427 0.453165 -0.000000 -0.00000 -0.453165 -0.891427 0.000000 0.00000 -0.000000 -0.000000 1.000000 362.73300 692 'point symmetry operation' ? ? -0.920007 0.391902 -0.000000 -0.00000 -0.391902 -0.920007 0.000000 0.00000 -0.000000 -0.000000 1.000000 363.25870 693 'point symmetry operation' ? ? -0.944383 0.328849 -0.000000 -0.00000 -0.328849 -0.944383 0.000000 0.00000 -0.000000 -0.000000 1.000000 363.78440 694 'point symmetry operation' ? ? -0.964443 0.264293 -0.000000 -0.00000 -0.264293 -0.964443 0.000000 -0.00000 -0.000000 -0.000000 1.000000 364.31010 695 'point symmetry operation' ? ? -0.980095 0.198529 -0.000000 -0.00000 -0.198529 -0.980095 0.000000 -0.00000 -0.000000 -0.000000 1.000000 364.83580 696 'point symmetry operation' ? ? -0.991269 0.131858 -0.000000 -0.00000 -0.131858 -0.991269 0.000000 -0.00000 -0.000000 -0.000000 1.000000 365.36150 697 'point symmetry operation' ? ? -0.997912 0.064584 -0.000000 -0.00000 -0.064584 -0.997912 0.000000 -0.00000 0.000000 -0.000000 1.000000 365.88720 698 'point symmetry operation' ? ? -0.999996 -0.002985 0.000000 -0.00000 0.002985 -0.999996 -0.000000 -0.00000 -0.000000 0.000000 1.000000 366.41290 699 'point symmetry operation' ? ? -0.997509 -0.070540 0.000000 -0.00000 0.070540 -0.997509 -0.000000 -0.00000 -0.000000 0.000000 1.000000 366.93860 700 'point symmetry operation' ? ? -0.990464 -0.137773 -0.000000 -0.00000 0.137773 -0.990464 -0.000000 -0.00000 -0.000000 0.000000 1.000000 367.46430 701 'point symmetry operation' ? ? -0.978892 -0.204376 -0.000000 -0.00000 0.204376 -0.978892 -0.000000 -0.00000 -0.000000 0.000000 1.000000 367.99000 702 'point symmetry operation' ? ? -0.962847 -0.270046 -0.000000 -0.00000 0.270046 -0.962847 -0.000000 -0.00000 -0.000000 0.000000 1.000000 368.51570 703 'point symmetry operation' ? ? -0.942402 -0.334481 -0.000000 -0.00000 0.334481 -0.942402 -0.000000 -0.00000 -0.000000 0.000000 1.000000 369.04140 704 'point symmetry operation' ? ? -0.917651 -0.397388 -0.000000 -0.00000 0.397388 -0.917651 -0.000000 -0.00000 -0.000000 0.000000 1.000000 369.56710 705 'point symmetry operation' ? ? -0.888706 -0.458478 -0.000000 -0.00000 0.458478 -0.888706 -0.000000 -0.00000 -0.000000 0.000000 1.000000 370.09280 706 'point symmetry operation' ? ? -0.855699 -0.517474 -0.000000 -0.00000 0.517474 -0.855699 -0.000000 -0.00000 -0.000000 0.000000 1.000000 370.61850 707 'point symmetry operation' ? ? -0.818782 -0.574104 -0.000000 -0.00000 0.574104 -0.818782 -0.000000 -0.00000 -0.000000 0.000000 1.000000 371.14420 708 'point symmetry operation' ? ? -0.778123 -0.628112 -0.000000 -0.00000 0.628112 -0.778123 -0.000000 -0.00000 -0.000000 0.000000 1.000000 371.66990 709 'point symmetry operation' ? ? -0.733909 -0.679248 -0.000000 -0.00000 0.679248 -0.733909 -0.000000 -0.00000 -0.000000 0.000000 1.000000 372.19560 710 'point symmetry operation' ? ? -0.686340 -0.727281 -0.000000 -0.00000 0.727281 -0.686340 -0.000000 -0.00000 -0.000000 0.000000 1.000000 372.72130 711 'point symmetry operation' ? ? -0.635635 -0.771990 -0.000000 -0.00000 0.771990 -0.635635 -0.000000 -0.00000 -0.000000 0.000000 1.000000 373.24700 712 'point symmetry operation' ? ? -0.582025 -0.813171 -0.000000 -0.00000 0.813171 -0.582025 -0.000000 -0.00000 -0.000000 0.000000 1.000000 373.77270 713 'point symmetry operation' ? ? -0.525756 -0.850636 -0.000000 -0.00000 0.850636 -0.525756 -0.000000 -0.00000 -0.000000 0.000000 1.000000 374.29840 714 'point symmetry operation' ? ? -0.467083 -0.884213 -0.000000 -0.00000 0.884213 -0.467083 -0.000000 -0.00000 -0.000000 0.000000 1.000000 374.82410 715 'point symmetry operation' ? ? -0.406276 -0.913750 -0.000000 -0.00000 0.913750 -0.406276 -0.000000 -0.00000 -0.000000 0.000000 1.000000 375.34980 716 'point symmetry operation' ? ? -0.343613 -0.939111 -0.000000 -0.00000 0.939111 -0.343613 -0.000000 -0.00000 -0.000000 0.000000 1.000000 375.87550 717 'point symmetry operation' ? ? -0.279379 -0.960181 -0.000000 -0.00000 0.960181 -0.279379 -0.000000 -0.00000 -0.000000 0.000000 1.000000 376.40120 718 'point symmetry operation' ? ? -0.213869 -0.976862 -0.000000 -0.00000 0.976862 -0.213869 -0.000000 -0.00000 -0.000000 0.000000 1.000000 376.92690 719 'point symmetry operation' ? ? -0.147381 -0.989080 -0.000000 -0.00000 0.989080 -0.147381 -0.000000 -0.00000 -0.000000 0.000000 1.000000 377.45260 720 'point symmetry operation' ? ? -0.080220 -0.996777 -0.000000 -0.00000 0.996777 -0.080220 -0.000000 -0.00000 -0.000000 0.000000 1.000000 377.97830 721 'point symmetry operation' ? ? -0.012692 -0.999919 -0.000000 -0.00000 0.999919 -0.012692 -0.000000 -0.00000 -0.000000 0.000000 1.000000 378.50400 722 'point symmetry operation' ? ? 0.054894 -0.998492 -0.000000 -0.00000 0.998492 0.054894 -0.000000 -0.00000 -0.000000 0.000000 1.000000 379.02970 723 'point symmetry operation' ? ? 0.122229 -0.992502 -0.000000 -0.00000 0.992502 0.122229 -0.000000 -0.00000 -0.000000 0.000000 1.000000 379.55540 724 'point symmetry operation' ? ? 0.189006 -0.981976 -0.000000 -0.00000 0.981976 0.189006 -0.000000 -0.00000 -0.000000 0.000000 1.000000 380.08110 725 'point symmetry operation' ? ? 0.254919 -0.966963 -0.000000 -0.00000 0.966963 0.254919 -0.000000 -0.00000 -0.000000 0.000000 1.000000 380.60680 726 'point symmetry operation' ? ? 0.319666 -0.947530 -0.000000 -0.00000 0.947530 0.319666 -0.000000 -0.00000 -0.000000 0.000000 1.000000 381.13250 727 'point symmetry operation' ? ? 0.382953 -0.923768 -0.000000 -0.00000 0.923768 0.382953 -0.000000 -0.00000 -0.000000 0.000000 1.000000 381.65820 728 'point symmetry operation' ? ? 0.444490 -0.895784 -0.000000 -0.00000 0.895784 0.444490 -0.000000 -0.00000 -0.000000 0.000000 1.000000 382.18390 729 'point symmetry operation' ? ? 0.503996 -0.863706 -0.000000 -0.00000 0.863706 0.503996 -0.000000 -0.00000 -0.000000 0.000000 1.000000 382.70960 730 'point symmetry operation' ? ? 0.561198 -0.827681 -0.000000 -0.00000 0.827681 0.561198 -0.000000 -0.00000 -0.000000 0.000000 1.000000 383.23530 731 'point symmetry operation' ? ? 0.615836 -0.787874 -0.000000 -0.00000 0.787874 0.615836 -0.000000 -0.00000 -0.000000 0.000000 1.000000 383.76100 732 'point symmetry operation' ? ? 0.667660 -0.744467 -0.000000 -0.00000 0.744467 0.667660 -0.000000 -0.00000 -0.000000 0.000000 1.000000 384.28670 733 'point symmetry operation' ? ? 0.716432 -0.697657 -0.000000 -0.00000 0.697657 0.716432 -0.000000 -0.00000 -0.000000 0.000000 1.000000 384.81240 734 'point symmetry operation' ? ? 0.761930 -0.647659 -0.000000 -0.00000 0.647659 0.761930 -0.000000 -0.00000 -0.000000 0.000000 1.000000 385.33810 735 'point symmetry operation' ? ? 0.803947 -0.594701 -0.000000 -0.00000 0.594701 0.803947 -0.000000 -0.00000 -0.000000 0.000000 1.000000 385.86380 736 'point symmetry operation' ? ? 0.842289 -0.539026 -0.000000 -0.00000 0.539026 0.842289 -0.000000 -0.00000 -0.000000 0.000000 1.000000 386.38950 737 'point symmetry operation' ? ? 0.876782 -0.480887 -0.000000 -0.00000 0.480887 0.876782 -0.000000 -0.00000 -0.000000 0.000000 1.000000 386.91520 738 'point symmetry operation' ? ? 0.907269 -0.420551 -0.000000 -0.00000 0.420551 0.907269 -0.000000 -0.00000 -0.000000 0.000000 1.000000 387.44090 739 'point symmetry operation' ? ? 0.933609 -0.358293 -0.000000 -0.00000 0.358293 0.933609 -0.000000 -0.00000 -0.000000 0.000000 1.000000 387.96660 740 'point symmetry operation' ? ? 0.955683 -0.294397 -0.000000 -0.00000 0.294397 0.955683 -0.000000 -0.00000 -0.000000 0.000000 1.000000 388.49230 741 'point symmetry operation' ? ? 0.973390 -0.229156 -0.000000 -0.00000 0.229156 0.973390 -0.000000 -0.00000 -0.000000 0.000000 1.000000 389.01800 742 'point symmetry operation' ? ? 0.986648 -0.162868 -0.000000 -0.00000 0.162868 0.986648 -0.000000 -0.00000 -0.000000 0.000000 1.000000 389.54370 743 'point symmetry operation' ? ? 0.995397 -0.095836 -0.000000 -0.00000 0.095836 0.995397 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 390.06940 744 'point symmetry operation' ? ? 0.999598 -0.028365 -0.000000 -0.00000 0.028365 0.999598 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 390.59510 745 'point symmetry operation' ? ? 0.999230 0.039235 -0.000000 -0.00000 -0.039235 0.999230 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 391.12080 746 'point symmetry operation' ? ? 0.994296 0.106655 -0.000000 -0.00000 -0.106655 0.994296 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 391.64650 747 'point symmetry operation' ? ? 0.984818 0.173589 -0.000000 -0.00000 -0.173589 0.984818 0.000000 -0.00000 -0.000000 -0.000000 1.000000 392.17220 748 'point symmetry operation' ? ? 0.970840 0.239729 -0.000000 -0.00000 -0.239729 0.970840 0.000000 -0.00000 -0.000000 -0.000000 1.000000 392.69790 749 'point symmetry operation' ? ? 0.952425 0.304773 -0.000000 -0.00000 -0.304773 0.952425 0.000000 -0.00000 -0.000000 -0.000000 1.000000 393.22360 750 'point symmetry operation' ? ? 0.929658 0.368425 -0.000000 -0.00000 -0.368425 0.929658 0.000000 -0.00000 -0.000000 -0.000000 1.000000 393.74930 751 'point symmetry operation' ? ? 0.902642 0.430393 -0.000000 -0.00000 -0.430393 0.902642 0.000000 -0.00000 -0.000000 -0.000000 1.000000 394.27500 752 'point symmetry operation' ? ? 0.871501 0.490394 -0.000000 -0.00000 -0.490394 0.871501 0.000000 -0.00000 -0.000000 -0.000000 1.000000 394.80070 753 'point symmetry operation' ? ? 0.836377 0.548154 -0.000000 -0.00000 -0.548154 0.836377 0.000000 -0.00000 -0.000000 -0.000000 1.000000 395.32640 754 'point symmetry operation' ? ? 0.797432 0.603409 -0.000000 -0.00000 -0.603409 0.797432 0.000000 0.00000 -0.000000 -0.000000 1.000000 395.85210 755 'point symmetry operation' ? ? 0.754842 0.655907 -0.000000 -0.00000 -0.655907 0.754842 0.000000 0.00000 -0.000000 -0.000000 1.000000 396.37780 756 'point symmetry operation' ? ? 0.708802 0.705407 -0.000000 -0.00000 -0.705407 0.708802 0.000000 0.00000 -0.000000 -0.000000 1.000000 396.90350 757 'point symmetry operation' ? ? 0.659524 0.751684 -0.000000 -0.00000 -0.751684 0.659524 0.000000 0.00000 -0.000000 -0.000000 1.000000 397.42920 758 'point symmetry operation' ? ? 0.607231 0.794525 -0.000000 -0.00000 -0.794525 0.607231 0.000000 0.00000 -0.000000 -0.000000 1.000000 397.95490 759 'point symmetry operation' ? ? 0.552164 0.833736 -0.000000 -0.00000 -0.833736 0.552164 0.000000 0.00000 -0.000000 -0.000000 1.000000 398.48060 760 'point symmetry operation' ? ? 0.494573 0.869136 -0.000000 -0.00000 -0.869136 0.494573 0.000000 0.00000 -0.000000 -0.000000 1.000000 399.00630 761 'point symmetry operation' ? ? 0.434722 0.900565 -0.000000 -0.00000 -0.900565 0.434722 0.000000 0.00000 -0.000000 -0.000000 1.000000 399.53200 762 'point symmetry operation' ? ? 0.372884 0.927878 -0.000000 -0.00000 -0.927878 0.372884 0.000000 0.00000 -0.000000 -0.000000 1.000000 400.05770 763 'point symmetry operation' ? ? 0.309343 0.950951 -0.000000 -0.00000 -0.950951 0.309343 0.000000 0.00000 -0.000000 -0.000000 1.000000 400.58340 764 'point symmetry operation' ? ? 0.244387 0.969678 -0.000000 -0.00000 -0.969678 0.244387 0.000000 0.00000 -0.000000 -0.000000 1.000000 401.10910 765 'point symmetry operation' ? ? 0.178315 0.983973 -0.000000 -0.00000 -0.983973 0.178315 0.000000 0.00000 -0.000000 -0.000000 1.000000 401.63480 766 'point symmetry operation' ? ? 0.111428 0.993772 -0.000000 -0.00000 -0.993772 0.111428 0.000000 0.00000 -0.000000 -0.000000 1.000000 402.16050 767 'point symmetry operation' ? ? 0.044032 0.999030 -0.000000 -0.00000 -0.999030 0.044032 0.000000 0.00000 -0.000000 -0.000000 1.000000 402.68620 768 'point symmetry operation' ? ? -0.023566 0.999722 -0.000000 -0.00000 -0.999722 -0.023566 0.000000 0.00000 -0.000000 -0.000000 1.000000 403.21190 769 'point symmetry operation' ? ? -0.091055 0.995846 -0.000000 -0.00000 -0.995846 -0.091055 0.000000 0.00000 -0.000000 -0.000000 1.000000 403.73760 770 'point symmetry operation' ? ? -0.158129 0.987418 -0.000000 -0.00000 -0.987418 -0.158129 0.000000 0.00000 -0.000000 -0.000000 1.000000 404.26330 771 'point symmetry operation' ? ? -0.224480 0.974479 -0.000000 -0.00000 -0.974479 -0.224480 0.000000 0.00000 -0.000000 -0.000000 1.000000 404.78900 772 'point symmetry operation' ? ? -0.289805 0.957086 -0.000000 -0.00000 -0.957086 -0.289805 0.000000 0.00000 -0.000000 -0.000000 1.000000 405.31470 773 'point symmetry operation' ? ? -0.353806 0.935319 -0.000000 -0.00000 -0.935319 -0.353806 0.000000 0.00000 -0.000000 -0.000000 1.000000 405.84040 774 'point symmetry operation' ? ? -0.416190 0.909278 -0.000000 -0.00000 -0.909278 -0.416190 0.000000 0.00000 -0.000000 -0.000000 1.000000 406.36610 775 'point symmetry operation' ? ? -0.476672 0.879081 -0.000000 -0.00000 -0.879081 -0.476672 0.000000 0.00000 -0.000000 -0.000000 1.000000 406.89180 776 'point symmetry operation' ? ? -0.534976 0.844868 -0.000000 -0.00000 -0.844868 -0.534976 0.000000 0.00000 -0.000000 -0.000000 1.000000 407.41750 777 'point symmetry operation' ? ? -0.590834 0.806793 -0.000000 -0.00000 -0.806793 -0.590834 0.000000 0.00000 -0.000000 -0.000000 1.000000 407.94320 778 'point symmetry operation' ? ? -0.643993 0.765031 -0.000000 -0.00000 -0.765031 -0.643993 0.000000 0.00000 -0.000000 -0.000000 1.000000 408.46890 779 'point symmetry operation' ? ? -0.694209 0.719773 -0.000000 -0.00000 -0.719773 -0.694209 0.000000 0.00000 -0.000000 -0.000000 1.000000 408.99460 780 'point symmetry operation' ? ? -0.741252 0.671226 -0.000000 -0.00000 -0.671226 -0.741252 0.000000 0.00000 -0.000000 -0.000000 1.000000 409.52030 781 'point symmetry operation' ? ? -0.784908 0.619612 -0.000000 -0.00000 -0.619612 -0.784908 0.000000 0.00000 -0.000000 -0.000000 1.000000 410.04600 782 'point symmetry operation' ? ? -0.824977 0.565166 -0.000000 -0.00000 -0.565166 -0.824977 0.000000 0.00000 -0.000000 -0.000000 1.000000 410.57170 783 'point symmetry operation' ? ? -0.861276 0.508137 -0.000000 -0.00000 -0.508137 -0.861276 0.000000 0.00000 -0.000000 -0.000000 1.000000 411.09740 784 'point symmetry operation' ? ? -0.893639 0.448786 -0.000000 -0.00000 -0.448786 -0.893639 0.000000 0.00000 -0.000000 -0.000000 1.000000 411.62310 785 'point symmetry operation' ? ? -0.921918 0.387384 -0.000000 -0.00000 -0.387384 -0.921918 0.000000 0.00000 -0.000000 -0.000000 1.000000 412.14880 786 'point symmetry operation' ? ? -0.945984 0.324212 -0.000000 -0.00000 -0.324212 -0.945984 0.000000 -0.00000 -0.000000 -0.000000 1.000000 412.67450 787 'point symmetry operation' ? ? -0.965727 0.259558 -0.000000 -0.00000 -0.259558 -0.965727 0.000000 -0.00000 -0.000000 -0.000000 1.000000 413.20020 788 'point symmetry operation' ? ? -0.981057 0.193718 -0.000000 -0.00000 -0.193718 -0.981057 0.000000 -0.00000 -0.000000 -0.000000 1.000000 413.72590 789 'point symmetry operation' ? ? -0.991904 0.126993 -0.000000 -0.00000 -0.126993 -0.991904 0.000000 -0.00000 -0.000000 -0.000000 1.000000 414.25160 790 'point symmetry operation' ? ? -0.998217 0.059688 -0.000000 -0.00000 -0.059688 -0.998217 0.000000 -0.00000 0.000000 -0.000000 1.000000 414.77730 791 'point symmetry operation' ? ? -0.999969 -0.007891 0.000000 -0.00000 0.007891 -0.999969 -0.000000 -0.00000 -0.000000 0.000000 1.000000 415.30300 792 'point symmetry operation' ? ? -0.997151 -0.075433 0.000000 -0.00000 0.075433 -0.997151 -0.000000 -0.00000 -0.000000 0.000000 1.000000 415.82870 793 'point symmetry operation' ? ? -0.989776 -0.142630 -0.000000 -0.00000 0.142630 -0.989776 -0.000000 -0.00000 -0.000000 0.000000 1.000000 416.35440 794 'point symmetry operation' ? ? -0.977878 -0.209176 -0.000000 -0.00000 0.209176 -0.977878 -0.000000 -0.00000 -0.000000 0.000000 1.000000 416.88010 795 'point symmetry operation' ? ? -0.961511 -0.274766 -0.000000 -0.00000 0.274766 -0.961511 -0.000000 -0.00000 -0.000000 0.000000 1.000000 417.40580 796 'point symmetry operation' ? ? -0.940750 -0.339100 -0.000000 -0.00000 0.339100 -0.940750 -0.000000 -0.00000 -0.000000 0.000000 1.000000 417.93150 797 'point symmetry operation' ? ? -0.915690 -0.401884 -0.000000 -0.00000 0.401884 -0.915690 -0.000000 -0.00000 -0.000000 0.000000 1.000000 418.45720 798 'point symmetry operation' ? ? -0.886446 -0.462832 -0.000000 -0.00000 0.462832 -0.886446 -0.000000 -0.00000 -0.000000 0.000000 1.000000 418.98290 799 'point symmetry operation' ? ? -0.853150 -0.521665 -0.000000 -0.00000 0.521665 -0.853150 -0.000000 -0.00000 -0.000000 0.000000 1.000000 419.50860 800 'point symmetry operation' ? ? -0.815956 -0.578114 -0.000000 -0.00000 0.578114 -0.815956 -0.000000 -0.00000 -0.000000 0.000000 1.000000 420.03430 801 'point symmetry operation' ? ? -0.775033 -0.631921 -0.000000 -0.00000 0.631921 -0.775033 -0.000000 -0.00000 -0.000000 0.000000 1.000000 420.56000 802 'point symmetry operation' ? ? -0.730568 -0.682840 -0.000000 -0.00000 0.682840 -0.730568 -0.000000 -0.00000 -0.000000 0.000000 1.000000 421.08570 803 'point symmetry operation' ? ? -0.682764 -0.730639 -0.000000 -0.00000 0.730639 -0.682764 -0.000000 -0.00000 -0.000000 0.000000 1.000000 421.61140 804 'point symmetry operation' ? ? -0.631840 -0.775099 -0.000000 -0.00000 0.775099 -0.631840 -0.000000 -0.00000 -0.000000 0.000000 1.000000 422.13710 805 'point symmetry operation' ? ? -0.578029 -0.816016 -0.000000 -0.00000 0.816016 -0.578029 -0.000000 -0.00000 -0.000000 0.000000 1.000000 422.66280 806 'point symmetry operation' ? ? -0.521576 -0.853205 -0.000000 -0.00000 0.853205 -0.521576 -0.000000 -0.00000 -0.000000 0.000000 1.000000 423.18850 807 'point symmetry operation' ? ? -0.462740 -0.886494 -0.000000 -0.00000 0.886494 -0.462740 -0.000000 -0.00000 -0.000000 0.000000 1.000000 423.71420 808 'point symmetry operation' ? ? -0.401789 -0.915732 -0.000000 -0.00000 0.915732 -0.401789 -0.000000 -0.00000 -0.000000 0.000000 1.000000 424.23990 809 'point symmetry operation' ? ? -0.339002 -0.940786 -0.000000 -0.00000 0.940786 -0.339002 -0.000000 -0.00000 -0.000000 0.000000 1.000000 424.76560 810 'point symmetry operation' ? ? -0.274666 -0.961540 -0.000000 -0.00000 0.961540 -0.274666 -0.000000 -0.00000 -0.000000 0.000000 1.000000 425.29130 811 'point symmetry operation' ? ? -0.209074 -0.977900 -0.000000 -0.00000 0.977900 -0.209074 -0.000000 -0.00000 -0.000000 0.000000 1.000000 425.81700 812 'point symmetry operation' ? ? -0.142527 -0.989791 -0.000000 -0.00000 0.989791 -0.142527 -0.000000 -0.00000 -0.000000 0.000000 1.000000 426.34270 813 'point symmetry operation' ? ? -0.075329 -0.997159 -0.000000 -0.00000 0.997159 -0.075329 -0.000000 -0.00000 -0.000000 0.000000 1.000000 426.86840 814 'point symmetry operation' ? ? -0.007786 -0.999970 -0.000000 -0.00000 0.999970 -0.007786 -0.000000 -0.00000 -0.000000 0.000000 1.000000 427.39410 815 'point symmetry operation' ? ? 0.059792 -0.998211 -0.000000 -0.00000 0.998211 0.059792 -0.000000 -0.00000 -0.000000 0.000000 1.000000 427.91980 816 'point symmetry operation' ? ? 0.127097 -0.991890 -0.000000 -0.00000 0.991890 0.127097 -0.000000 -0.00000 -0.000000 0.000000 1.000000 428.44550 817 'point symmetry operation' ? ? 0.193821 -0.981037 -0.000000 -0.00000 0.981037 0.193821 -0.000000 -0.00000 -0.000000 0.000000 1.000000 428.97120 818 'point symmetry operation' ? ? 0.259659 -0.965700 -0.000000 -0.00000 0.965700 0.259659 -0.000000 -0.00000 -0.000000 0.000000 1.000000 429.49690 819 'point symmetry operation' ? ? 0.324311 -0.945951 -0.000000 -0.00000 0.945951 0.324311 -0.000000 -0.00000 -0.000000 0.000000 1.000000 430.02260 820 'point symmetry operation' ? ? 0.387480 -0.921878 -0.000000 -0.00000 0.921878 0.387480 -0.000000 -0.00000 -0.000000 0.000000 1.000000 430.54830 821 'point symmetry operation' ? ? 0.448879 -0.893592 -0.000000 -0.00000 0.893592 0.448879 -0.000000 -0.00000 -0.000000 0.000000 1.000000 431.07400 822 'point symmetry operation' ? ? 0.508227 -0.861223 -0.000000 -0.00000 0.861223 0.508227 -0.000000 -0.00000 -0.000000 0.000000 1.000000 431.59970 823 'point symmetry operation' ? ? 0.565252 -0.824918 -0.000000 -0.00000 0.824918 0.565252 -0.000000 -0.00000 -0.000000 0.000000 1.000000 432.12540 824 'point symmetry operation' ? ? 0.619694 -0.784844 -0.000000 -0.00000 0.784844 0.619694 -0.000000 -0.00000 -0.000000 0.000000 1.000000 432.65110 825 'point symmetry operation' ? ? 0.671304 -0.741182 -0.000000 -0.00000 0.741182 0.671304 -0.000000 -0.00000 -0.000000 0.000000 1.000000 433.17680 826 'point symmetry operation' ? ? 0.719846 -0.694134 -0.000000 -0.00000 0.694134 0.719846 -0.000000 -0.00000 -0.000000 0.000000 1.000000 433.70250 827 'point symmetry operation' ? ? 0.765098 -0.643913 -0.000000 -0.00000 0.643913 0.765098 -0.000000 -0.00000 -0.000000 0.000000 1.000000 434.22820 828 'point symmetry operation' ? ? 0.806854 -0.590750 -0.000000 -0.00000 0.590750 0.806854 -0.000000 -0.00000 -0.000000 0.000000 1.000000 434.75390 829 'point symmetry operation' ? ? 0.844923 -0.534887 -0.000000 -0.00000 0.534887 0.844923 -0.000000 -0.00000 -0.000000 0.000000 1.000000 435.27960 830 'point symmetry operation' ? ? 0.879131 -0.476580 -0.000000 -0.00000 0.476580 0.879131 -0.000000 -0.00000 -0.000000 0.000000 1.000000 435.80530 831 'point symmetry operation' ? ? 0.909321 -0.416095 -0.000000 -0.00000 0.416095 0.909321 -0.000000 -0.00000 -0.000000 0.000000 1.000000 436.33100 832 'point symmetry operation' ? ? 0.935356 -0.353708 -0.000000 -0.00000 0.353708 0.935356 -0.000000 -0.00000 -0.000000 0.000000 1.000000 436.85670 833 'point symmetry operation' ? ? 0.957116 -0.289705 -0.000000 -0.00000 0.289705 0.957116 -0.000000 -0.00000 -0.000000 0.000000 1.000000 437.38240 834 'point symmetry operation' ? ? 0.974502 -0.224378 -0.000000 -0.00000 0.224378 0.974502 -0.000000 -0.00000 -0.000000 0.000000 1.000000 437.90810 835 'point symmetry operation' ? ? 0.987435 -0.158026 -0.000000 -0.00000 0.158026 0.987435 -0.000000 -0.00000 -0.000000 0.000000 1.000000 438.43380 836 'point symmetry operation' ? ? 0.995855 -0.090952 -0.000000 -0.00000 0.090952 0.995855 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 438.95950 837 'point symmetry operation' ? ? 0.999725 -0.023461 -0.000000 -0.00000 0.023461 0.999725 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 439.48520 838 'point symmetry operation' ? ? 0.999026 0.044136 -0.000000 -0.00000 -0.044136 0.999026 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 440.01090 839 'point symmetry operation' ? ? 0.993761 0.111532 -0.000000 -0.00000 -0.111532 0.993761 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 440.53660 840 'point symmetry operation' ? ? 0.983955 0.178418 -0.000000 -0.00000 -0.178418 0.983955 0.000000 -0.00000 -0.000000 -0.000000 1.000000 441.06230 841 'point symmetry operation' ? ? 0.969652 0.244488 -0.000000 -0.00000 -0.244488 0.969652 0.000000 -0.00000 -0.000000 -0.000000 1.000000 441.58800 842 'point symmetry operation' ? ? 0.950918 0.309442 -0.000000 -0.00000 -0.309442 0.950918 0.000000 -0.00000 -0.000000 -0.000000 1.000000 442.11370 843 'point symmetry operation' ? ? 0.927839 0.372981 -0.000000 -0.00000 -0.372981 0.927839 0.000000 -0.00000 -0.000000 -0.000000 1.000000 442.63940 844 'point symmetry operation' ? ? 0.900519 0.434816 -0.000000 -0.00000 -0.434816 0.900519 0.000000 -0.00000 -0.000000 -0.000000 1.000000 443.16510 845 'point symmetry operation' ? ? 0.869085 0.494663 -0.000000 -0.00000 -0.494663 0.869085 0.000000 -0.00000 -0.000000 -0.000000 1.000000 443.69080 846 'point symmetry operation' ? ? 0.833678 0.552251 -0.000000 -0.00000 -0.552251 0.833678 0.000000 -0.00000 -0.000000 -0.000000 1.000000 444.21650 847 'point symmetry operation' ? ? 0.794462 0.607314 -0.000000 -0.00000 -0.607314 0.794462 0.000000 -0.00000 -0.000000 -0.000000 1.000000 444.74220 848 'point symmetry operation' ? ? 0.751615 0.659602 -0.000000 -0.00000 -0.659602 0.751615 0.000000 0.00000 -0.000000 -0.000000 1.000000 445.26790 849 'point symmetry operation' ? ? 0.705333 0.708876 -0.000000 -0.00000 -0.708876 0.705333 0.000000 0.00000 -0.000000 -0.000000 1.000000 445.79360 850 'point symmetry operation' ? ? 0.655828 0.754910 -0.000000 -0.00000 -0.754910 0.655828 0.000000 0.00000 -0.000000 -0.000000 1.000000 446.31930 851 'point symmetry operation' ? ? 0.603326 0.797494 -0.000000 -0.00000 -0.797494 0.603326 0.000000 0.00000 -0.000000 -0.000000 1.000000 446.84500 852 'point symmetry operation' ? ? 0.548067 0.836434 -0.000000 -0.00000 -0.836434 0.548067 0.000000 0.00000 -0.000000 -0.000000 1.000000 447.37070 853 'point symmetry operation' ? ? 0.490303 0.871552 -0.000000 -0.00000 -0.871552 0.490303 0.000000 0.00000 -0.000000 -0.000000 1.000000 447.89640 854 'point symmetry operation' ? ? 0.430299 0.902686 -0.000000 -0.00000 -0.902686 0.430299 0.000000 0.00000 -0.000000 -0.000000 1.000000 448.42210 855 'point symmetry operation' ? ? 0.368328 0.929696 -0.000000 -0.00000 -0.929696 0.368328 0.000000 0.00000 -0.000000 -0.000000 1.000000 448.94780 856 'point symmetry operation' ? ? 0.304674 0.952457 -0.000000 -0.00000 -0.952457 0.304674 0.000000 0.00000 -0.000000 -0.000000 1.000000 449.47350 857 'point symmetry operation' ? ? 0.239628 0.970865 -0.000000 -0.00000 -0.970865 0.239628 0.000000 0.00000 -0.000000 -0.000000 1.000000 449.99920 858 'point symmetry operation' ? ? 0.173486 0.984836 -0.000000 -0.00000 -0.984836 0.173486 0.000000 0.00000 -0.000000 -0.000000 1.000000 450.52490 859 'point symmetry operation' ? ? 0.106552 0.994307 -0.000000 -0.00000 -0.994307 0.106552 0.000000 0.00000 -0.000000 -0.000000 1.000000 451.05060 860 'point symmetry operation' ? ? 0.039131 0.999234 -0.000000 -0.00000 -0.999234 0.039131 0.000000 0.00000 -0.000000 -0.000000 1.000000 451.57630 861 'point symmetry operation' ? ? -0.028469 0.999595 -0.000000 -0.00000 -0.999595 -0.028469 0.000000 0.00000 -0.000000 -0.000000 1.000000 452.10200 862 'point symmetry operation' ? ? -0.095939 0.995387 -0.000000 -0.00000 -0.995387 -0.095939 0.000000 0.00000 -0.000000 -0.000000 1.000000 452.62770 863 'point symmetry operation' ? ? -0.162971 0.986631 -0.000000 -0.00000 -0.986631 -0.162971 0.000000 0.00000 -0.000000 -0.000000 1.000000 453.15340 864 'point symmetry operation' ? ? -0.229258 0.973366 -0.000000 -0.00000 -0.973366 -0.229258 0.000000 0.00000 -0.000000 -0.000000 1.000000 453.67910 865 'point symmetry operation' ? ? -0.294497 0.955652 -0.000000 -0.00000 -0.955652 -0.294497 0.000000 0.00000 -0.000000 -0.000000 1.000000 454.20480 866 'point symmetry operation' ? ? -0.358390 0.933572 -0.000000 -0.00000 -0.933572 -0.358390 0.000000 0.00000 -0.000000 -0.000000 1.000000 454.73050 867 'point symmetry operation' ? ? -0.420645 0.907225 -0.000000 -0.00000 -0.907225 -0.420645 0.000000 0.00000 -0.000000 -0.000000 1.000000 455.25620 868 'point symmetry operation' ? ? -0.480979 0.876732 -0.000000 -0.00000 -0.876732 -0.480979 0.000000 0.00000 -0.000000 -0.000000 1.000000 455.78190 869 'point symmetry operation' ? ? -0.539114 0.842233 -0.000000 -0.00000 -0.842233 -0.539114 0.000000 0.00000 -0.000000 -0.000000 1.000000 456.30760 870 'point symmetry operation' ? ? -0.594785 0.803885 -0.000000 -0.00000 -0.803885 -0.594785 0.000000 0.00000 -0.000000 -0.000000 1.000000 456.83330 871 'point symmetry operation' ? ? -0.647738 0.761863 -0.000000 -0.00000 -0.761863 -0.647738 0.000000 0.00000 -0.000000 -0.000000 1.000000 457.35900 872 'point symmetry operation' ? ? -0.697732 0.716359 -0.000000 -0.00000 -0.716359 -0.697732 0.000000 0.00000 -0.000000 -0.000000 1.000000 457.88470 873 'point symmetry operation' ? ? -0.744536 0.667582 -0.000000 -0.00000 -0.667582 -0.744536 0.000000 0.00000 -0.000000 -0.000000 1.000000 458.41040 874 'point symmetry operation' ? ? -0.787938 0.615754 -0.000000 -0.00000 -0.615754 -0.787938 0.000000 0.00000 -0.000000 -0.000000 1.000000 458.93610 875 'point symmetry operation' ? ? -0.827740 0.561112 -0.000000 -0.00000 -0.561112 -0.827740 0.000000 0.00000 -0.000000 -0.000000 1.000000 459.46180 876 'point symmetry operation' ? ? -0.863759 0.503906 -0.000000 -0.00000 -0.503906 -0.863759 0.000000 0.00000 -0.000000 -0.000000 1.000000 459.98750 877 'point symmetry operation' ? ? -0.895830 0.444397 -0.000000 -0.00000 -0.444397 -0.895830 0.000000 0.00000 -0.000000 -0.000000 1.000000 460.51320 878 'point symmetry operation' ? ? -0.923808 0.382857 -0.000000 -0.00000 -0.382857 -0.923808 0.000000 -0.00000 -0.000000 -0.000000 1.000000 461.03890 879 'point symmetry operation' ? ? -0.947563 0.319568 -0.000000 -0.00000 -0.319568 -0.947563 0.000000 -0.00000 -0.000000 -0.000000 1.000000 461.56460 880 'point symmetry operation' ? ? -0.966989 0.254818 -0.000000 -0.00000 -0.254818 -0.966989 0.000000 -0.00000 -0.000000 -0.000000 1.000000 462.09030 881 'point symmetry operation' ? ? -0.981996 0.188903 -0.000000 -0.00000 -0.188903 -0.981996 0.000000 -0.00000 -0.000000 -0.000000 1.000000 462.61600 882 'point symmetry operation' ? ? -0.992515 0.122126 -0.000000 -0.00000 -0.122126 -0.992515 0.000000 -0.00000 0.000000 -0.000000 1.000000 463.14170 883 'point symmetry operation' ? ? -0.998498 0.054790 -0.000000 -0.00000 -0.054790 -0.998498 0.000000 -0.00000 0.000000 -0.000000 1.000000 463.66740 884 'point symmetry operation' ? ? -0.999918 -0.012796 0.000000 -0.00000 0.012796 -0.999918 -0.000000 -0.00000 -0.000000 0.000000 1.000000 464.19310 885 'point symmetry operation' ? ? -0.996769 -0.080323 0.000000 -0.00000 0.080323 -0.996769 -0.000000 -0.00000 -0.000000 0.000000 1.000000 464.71880 886 'point symmetry operation' ? ? -0.989064 -0.147484 -0.000000 -0.00000 0.147484 -0.989064 -0.000000 -0.00000 -0.000000 0.000000 1.000000 465.24450 887 'point symmetry operation' ? ? -0.976840 -0.213971 -0.000000 -0.00000 0.213971 -0.976840 -0.000000 -0.00000 -0.000000 0.000000 1.000000 465.77020 888 'point symmetry operation' ? ? -0.960152 -0.279479 -0.000000 -0.00000 0.279479 -0.960152 -0.000000 -0.00000 -0.000000 0.000000 1.000000 466.29590 889 'point symmetry operation' ? ? -0.939076 -0.343711 -0.000000 -0.00000 0.343711 -0.939076 -0.000000 -0.00000 -0.000000 0.000000 1.000000 466.82160 890 'point symmetry operation' ? ? -0.913708 -0.406372 -0.000000 -0.00000 0.406372 -0.913708 -0.000000 -0.00000 -0.000000 0.000000 1.000000 467.34730 891 'point symmetry operation' ? ? -0.884165 -0.467175 -0.000000 -0.00000 0.467175 -0.884165 -0.000000 -0.00000 -0.000000 0.000000 1.000000 467.87300 892 'point symmetry operation' ? ? -0.850581 -0.525844 -0.000000 -0.00000 0.525844 -0.850581 -0.000000 -0.00000 -0.000000 0.000000 1.000000 468.39870 893 'point symmetry operation' ? ? -0.813110 -0.582110 -0.000000 -0.00000 0.582110 -0.813110 -0.000000 -0.00000 -0.000000 0.000000 1.000000 468.92440 894 'point symmetry operation' ? ? -0.771923 -0.635715 -0.000000 -0.00000 0.635715 -0.771923 -0.000000 -0.00000 -0.000000 0.000000 1.000000 469.45010 895 'point symmetry operation' ? ? -0.727209 -0.686416 -0.000000 -0.00000 0.686416 -0.727209 -0.000000 -0.00000 -0.000000 0.000000 1.000000 469.97580 896 'point symmetry operation' ? ? -0.679172 -0.733979 -0.000000 -0.00000 0.733979 -0.679172 -0.000000 -0.00000 -0.000000 0.000000 1.000000 470.50150 897 'point symmetry operation' ? ? -0.628030 -0.778189 -0.000000 -0.00000 0.778189 -0.628030 -0.000000 -0.00000 -0.000000 0.000000 1.000000 471.02720 898 'point symmetry operation' ? ? -0.574019 -0.818842 -0.000000 -0.00000 0.818842 -0.574019 -0.000000 -0.00000 -0.000000 0.000000 1.000000 471.55290 899 'point symmetry operation' ? ? -0.517385 -0.855753 -0.000000 -0.00000 0.855753 -0.517385 -0.000000 -0.00000 -0.000000 0.000000 1.000000 472.07860 900 'point symmetry operation' ? ? -0.458386 -0.888753 -0.000000 -0.00000 0.888753 -0.458386 -0.000000 -0.00000 -0.000000 0.000000 1.000000 472.60430 901 'point symmetry operation' ? ? -0.397292 -0.917692 -0.000000 -0.00000 0.917692 -0.397292 -0.000000 -0.00000 -0.000000 0.000000 1.000000 473.13000 902 'point symmetry operation' ? ? -0.334383 -0.942437 -0.000000 -0.00000 0.942437 -0.334383 -0.000000 -0.00000 -0.000000 0.000000 1.000000 473.65570 903 'point symmetry operation' ? ? -0.269945 -0.962876 -0.000000 -0.00000 0.962876 -0.269945 -0.000000 -0.00000 -0.000000 0.000000 1.000000 474.18140 904 'point symmetry operation' ? ? -0.204274 -0.978914 -0.000000 -0.00000 0.978914 -0.204274 -0.000000 -0.00000 -0.000000 0.000000 1.000000 474.70710 905 'point symmetry operation' ? ? -0.137670 -0.990478 -0.000000 -0.00000 0.990478 -0.137670 -0.000000 -0.00000 -0.000000 0.000000 1.000000 475.23280 906 'point symmetry operation' ? ? -0.070436 -0.997516 -0.000000 -0.00000 0.997516 -0.070436 -0.000000 -0.00000 -0.000000 0.000000 1.000000 475.75850 907 'point symmetry operation' ? ? -0.002881 -0.999996 -0.000000 -0.00000 0.999996 -0.002881 -0.000000 -0.00000 -0.000000 0.000000 1.000000 476.28420 908 'point symmetry operation' ? ? 0.064688 -0.997906 -0.000000 -0.00000 0.997906 0.064688 -0.000000 -0.00000 -0.000000 0.000000 1.000000 476.80990 909 'point symmetry operation' ? ? 0.131961 -0.991255 -0.000000 -0.00000 0.991255 0.131961 -0.000000 -0.00000 -0.000000 0.000000 1.000000 477.33560 910 'point symmetry operation' ? ? 0.198631 -0.980074 -0.000000 -0.00000 0.980074 0.198631 -0.000000 -0.00000 -0.000000 0.000000 1.000000 477.86130 911 'point symmetry operation' ? ? 0.264393 -0.964415 -0.000000 -0.00000 0.964415 0.264393 -0.000000 -0.00000 -0.000000 0.000000 1.000000 478.38700 912 'point symmetry operation' ? ? 0.328947 -0.944348 -0.000000 -0.00000 0.944348 0.328947 -0.000000 -0.00000 -0.000000 0.000000 1.000000 478.91270 913 'point symmetry operation' ? ? 0.391998 -0.919966 -0.000000 -0.00000 0.919966 0.391998 -0.000000 -0.00000 -0.000000 0.000000 1.000000 479.43840 914 'point symmetry operation' ? ? 0.453257 -0.891380 -0.000000 -0.00000 0.891380 0.453257 -0.000000 -0.00000 -0.000000 0.000000 1.000000 479.96410 915 'point symmetry operation' ? ? 0.512445 -0.858720 -0.000000 -0.00000 0.858720 0.512445 -0.000000 -0.00000 -0.000000 0.000000 1.000000 480.48980 916 'point symmetry operation' ? ? 0.569292 -0.822136 -0.000000 -0.00000 0.822136 0.569292 -0.000000 -0.00000 -0.000000 0.000000 1.000000 481.01550 917 'point symmetry operation' ? ? 0.623536 -0.781794 -0.000000 -0.00000 0.781794 0.623536 -0.000000 -0.00000 -0.000000 0.000000 1.000000 481.54120 918 'point symmetry operation' ? ? 0.674931 -0.737880 -0.000000 -0.00000 0.737880 0.674931 -0.000000 -0.00000 -0.000000 0.000000 1.000000 482.06690 919 'point symmetry operation' ? ? 0.723242 -0.690594 -0.000000 -0.00000 0.690594 0.723242 -0.000000 -0.00000 -0.000000 0.000000 1.000000 482.59260 920 'point symmetry operation' ? ? 0.768248 -0.640152 -0.000000 -0.00000 0.640152 0.768248 -0.000000 -0.00000 -0.000000 0.000000 1.000000 483.11830 921 'point symmetry operation' ? ? 0.809743 -0.586785 -0.000000 -0.00000 0.586785 0.809743 -0.000000 -0.00000 -0.000000 0.000000 1.000000 483.64400 922 'point symmetry operation' ? ? 0.847537 -0.530736 -0.000000 -0.00000 0.530736 0.847537 -0.000000 -0.00000 -0.000000 0.000000 1.000000 484.16970 923 'point symmetry operation' ? ? 0.881458 -0.472262 -0.000000 -0.00000 0.472262 0.881458 -0.000000 -0.00000 -0.000000 0.000000 1.000000 484.69540 924 'point symmetry operation' ? ? 0.911351 -0.411629 -0.000000 -0.00000 0.411629 0.911351 -0.000000 -0.00000 -0.000000 0.000000 1.000000 485.22110 925 'point symmetry operation' ? ? 0.937080 -0.349116 -0.000000 -0.00000 0.349116 0.937080 -0.000000 -0.00000 -0.000000 0.000000 1.000000 485.74680 926 'point symmetry operation' ? ? 0.958526 -0.285007 -0.000000 -0.00000 0.285007 0.958526 -0.000000 -0.00000 -0.000000 0.000000 1.000000 486.27250 927 'point symmetry operation' ? ? 0.975591 -0.219595 -0.000000 -0.00000 0.219595 0.975591 -0.000000 -0.00000 -0.000000 0.000000 1.000000 486.79820 928 'point symmetry operation' ? ? 0.988198 -0.153180 -0.000000 -0.00000 0.153180 0.988198 -0.000000 -0.00000 -0.000000 0.000000 1.000000 487.32390 929 'point symmetry operation' ? ? 0.996290 -0.086065 -0.000000 -0.00000 0.086065 0.996290 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 487.84960 930 'point symmetry operation' ? ? 0.999828 -0.018557 -0.000000 -0.00000 0.018557 0.999828 -0.000000 -0.00000 -0.000000 -0.000000 1.000000 488.37530 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-15 2 'Structure model' 1 1 2023-03-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # _em_3d_fitting.entry_id 7R1C _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol 'AB INITIO MODEL' _em_3d_fitting.ref_space REAL _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 7R1C _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm 'BACK PROJECTION' _em_3d_reconstruction.details 'Final reconstruction in cryoSPARC 3.3 using local refinement in a small section of the cylinder' _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages 1 _em_3d_reconstruction.num_particles 1460 _em_3d_reconstruction.resolution 3.2 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type HELICAL _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 8.0 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name 'Helical assembly of GvpB monomers forming the gas vesicle wall' _em_entity_assembly.source RECOMBINANT _em_entity_assembly.type COMPLEX _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_image_scans.entry_id 7R1C _em_image_scans.id 1 _em_image_scans.dimension_height 4092 _em_image_scans.dimension_width 5760 _em_image_scans.frames_per_image ? _em_image_scans.image_recording_id 1 _em_image_scans.sampling_size ? _em_image_scans.scanner_model ? _em_image_scans.used_frames_per_image ? _em_image_scans.citation_id ? _em_image_scans.number_digital_images ? _em_image_scans.od_range ? _em_image_scans.quant_bit_size ? _em_image_scans.details ? # _em_imaging.id 1 _em_imaging.entry_id 7R1C _em_imaging.accelerating_voltage 300 _em_imaging.alignment_procedure 'COMA FREE' _em_imaging.c2_aperture_diameter ? _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification ? _em_imaging.cryogen NITROGEN _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs 2.7 _em_imaging.nominal_defocus_max 1250 _em_imaging.nominal_defocus_min 250 _em_imaging.nominal_magnification 64000 _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model 'FEI TITAN KRIOS AUTOGRID HOLDER' _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_sample_support.id 1 _em_sample_support.specimen_id 1 _em_sample_support.details ? _em_sample_support.grid_material COPPER _em_sample_support.grid_mesh_size 300 _em_sample_support.grid_type 'Quantifoil R2/1' _em_sample_support.method ? _em_sample_support.film_material ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature 293 _em_vitrification.cryogen_name ETHANE _em_vitrification.details 'Blot times between 5 and 11 seconds.' _em_vitrification.humidity 95 _em_vitrification.instrument 'LEICA PLUNGER' _em_vitrification.entry_id 7R1C _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 7R1C _em_experiment.id 1 _em_experiment.aggregation_state 'HELICAL ARRAY' _em_experiment.reconstruction_method HELICAL _em_experiment.entity_assembly_id 1 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id VAL _pdbx_validate_torsion.auth_asym_id N _pdbx_validate_torsion.auth_seq_id 35 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 49.77 _pdbx_validate_torsion.psi 12.39 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 N MET 1 ? A MET 1 2 1 Y 1 N ASP 67 ? A ASP 67 3 1 Y 1 N VAL 68 ? A VAL 68 4 1 Y 1 N GLU 69 ? A GLU 69 5 1 Y 1 N GLU 70 ? A GLU 70 6 1 Y 1 N ASN 71 ? A ASN 71 7 1 Y 1 N GLY 72 ? A GLY 72 8 1 Y 1 N LEU 73 ? A LEU 73 9 1 Y 1 N PRO 74 ? A PRO 74 10 1 Y 1 N GLU 75 ? A GLU 75 11 1 Y 1 N ARG 76 ? A ARG 76 12 1 Y 1 N SER 77 ? A SER 77 13 1 Y 1 N ASN 78 ? A ASN 78 14 1 Y 1 N SER 79 ? A SER 79 15 1 Y 1 N SER 80 ? A SER 80 16 1 Y 1 N GLU 81 ? A GLU 81 17 1 Y 1 N GLY 82 ? A GLY 82 18 1 Y 1 N GLN 83 ? A GLN 83 19 1 Y 1 N PRO 84 ? A PRO 84 20 1 Y 1 N ARG 85 ? A ARG 85 21 1 Y 1 N PHE 86 ? A PHE 86 22 1 Y 1 N SER 87 ? A SER 87 23 1 Y 1 N ILE 88 ? A ILE 88 # loop_ _em_buffer_component.buffer_id _em_buffer_component.id _em_buffer_component.concentration _em_buffer_component.concentration_units _em_buffer_component.formula _em_buffer_component.name 1 1 20 mM Tris-Cl 'tris(hydroxymethyl)aminomethane' 1 2 50 mM NaCl 'sodium chloride' # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' _em_ctf_correction.details ? # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.units MEGADALTONS _em_entity_assembly_molwt.value 9.99 # _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 1348623 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism 'Priestia megaterium NBRC 15308 = ATCC 14581' _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_entity_assembly_recombinant.id 2 _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.ncbi_tax_id 562 _em_entity_assembly_recombinant.organism 'Escherichia coli' _em_entity_assembly_recombinant.plasmid ? _em_entity_assembly_recombinant.strain BL21-DE3-pLysS # _em_helical_entity.id 1 _em_helical_entity.image_processing_id 1 _em_helical_entity.angular_rotation_per_subunit -3.874 _em_helical_entity.axial_rise_per_subunit 0.525 _em_helical_entity.axial_symmetry C1 _em_helical_entity.details ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 30 _em_image_recording.average_exposure_time 2.4 _em_image_recording.details ;One shot per hole 1.37 A/pix 60 fractions over 30 e-/A2 ; _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN K3 BIOQUANTUM (6k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged 1 _em_image_recording.num_real_images 4351 _em_image_recording.avg_electron_dose_per_subtomogram ? # _em_particle_selection.id 1 _em_particle_selection.image_processing_id 1 _em_particle_selection.details ? _em_particle_selection.method ? _em_particle_selection.num_particles_selected 36295 _em_particle_selection.reference_model ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'PARTICLE SELECTION' ? RELION 3.1 1 ? ? 2 'IMAGE ACQUISITION' ? ? ? ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? RELION 3.1 1 ? ? 5 'LAYERLINE INDEXING' ? ? ? ? ? ? 6 'DIFFRACTION INDEXING' ? ? ? ? ? ? 7 'MODEL FITTING' ? ? ? ? 1 ? 8 OTHER ? ? ? ? ? ? 9 'INITIAL EULER ASSIGNMENT' ? ? ? 1 ? ? 10 'FINAL EULER ASSIGNMENT' ? cryoSPARC 3.3 1 ? ? 11 CLASSIFICATION ? RELION 3.1 1 ? ? 12 RECONSTRUCTION ? cryoSPARC 3.3 1 ? ? 13 'MODEL REFINEMENT' ? PHENIX 1.13 ? 1 ? 14 'MODEL REFINEMENT' ? ISOLDE ? ? 1 ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration 0.45 _em_specimen.details 'Concentration measured by OD(500)=3.12 against a sonicated blank.' _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'electron microscopy' ? 2 2 'electron microscopy' ? 3 3 'electron microscopy' ? #