data_7R22 # _entry.id 7R22 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7R22 pdb_00007r22 10.2210/pdb7r22/pdb WWPDB D_1292120652 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7R22 _pdbx_database_status.recvd_initial_deposition_date 2022-02-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kim, S.Y.' 1 0000-0002-4621-4771 'Eun, H.J.' 2 0000-0002-7240-1159 'Lee, J.Y.' 3 0000-0001-7947-0627 'Lee, B.J.' 4 0000-0001-7896-2961 'Blundell, T.L.' 5 0000-0002-2708-8992 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of putative ArsR family regulator antitoxin from Mycobacterium abscessus (MAB_3862)' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Kim, S.Y.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7R22 _cell.details ? _cell.formula_units_Z ? _cell.length_a 106.886 _cell.length_a_esd ? _cell.length_b 106.886 _cell.length_b_esd ? _cell.length_c 106.886 _cell.length_c_esd ? _cell.volume 1221131.612 _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7R22 _symmetry.cell_setting ? _symmetry.Int_Tables_number 213 _symmetry.space_group_name_Hall 'P 4bd 2ab 3' _symmetry.space_group_name_H-M 'P 41 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ArsR family transcriptional regulator' _entity.formula_weight 16797.391 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MNTIHHHHHHNTSGSGGGGGRLVPRGSMSENLYFQGSMATDADEDKADA(MSE)FHALSDRTRRDILRRVLAGEHSVSTL AANYD(MSE)SFAAVQKHVAVLEKAGLLTKRRNGREQLASGDVEAVRSVGA(MSE)LSELEQLWRGRIARIDELIARDRP SKD ; _entity_poly.pdbx_seq_one_letter_code_can ;MNTIHHHHHHNTSGSGGGGGRLVPRGSMSENLYFQGSMATDADEDKADAMFHALSDRTRRDILRRVLAGEHSVSTLAANY DMSFAAVQKHVAVLEKAGLLTKRRNGREQLASGDVEAVRSVGAMLSELEQLWRGRIARIDELIARDRPSKD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 THR n 1 4 ILE n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 ASN n 1 12 THR n 1 13 SER n 1 14 GLY n 1 15 SER n 1 16 GLY n 1 17 GLY n 1 18 GLY n 1 19 GLY n 1 20 GLY n 1 21 ARG n 1 22 LEU n 1 23 VAL n 1 24 PRO n 1 25 ARG n 1 26 GLY n 1 27 SER n 1 28 MET n 1 29 SER n 1 30 GLU n 1 31 ASN n 1 32 LEU n 1 33 TYR n 1 34 PHE n 1 35 GLN n 1 36 GLY n 1 37 SER n 1 38 MET n 1 39 ALA n 1 40 THR n 1 41 ASP n 1 42 ALA n 1 43 ASP n 1 44 GLU n 1 45 ASP n 1 46 LYS n 1 47 ALA n 1 48 ASP n 1 49 ALA n 1 50 MSE n 1 51 PHE n 1 52 HIS n 1 53 ALA n 1 54 LEU n 1 55 SER n 1 56 ASP n 1 57 ARG n 1 58 THR n 1 59 ARG n 1 60 ARG n 1 61 ASP n 1 62 ILE n 1 63 LEU n 1 64 ARG n 1 65 ARG n 1 66 VAL n 1 67 LEU n 1 68 ALA n 1 69 GLY n 1 70 GLU n 1 71 HIS n 1 72 SER n 1 73 VAL n 1 74 SER n 1 75 THR n 1 76 LEU n 1 77 ALA n 1 78 ALA n 1 79 ASN n 1 80 TYR n 1 81 ASP n 1 82 MSE n 1 83 SER n 1 84 PHE n 1 85 ALA n 1 86 ALA n 1 87 VAL n 1 88 GLN n 1 89 LYS n 1 90 HIS n 1 91 VAL n 1 92 ALA n 1 93 VAL n 1 94 LEU n 1 95 GLU n 1 96 LYS n 1 97 ALA n 1 98 GLY n 1 99 LEU n 1 100 LEU n 1 101 THR n 1 102 LYS n 1 103 ARG n 1 104 ARG n 1 105 ASN n 1 106 GLY n 1 107 ARG n 1 108 GLU n 1 109 GLN n 1 110 LEU n 1 111 ALA n 1 112 SER n 1 113 GLY n 1 114 ASP n 1 115 VAL n 1 116 GLU n 1 117 ALA n 1 118 VAL n 1 119 ARG n 1 120 SER n 1 121 VAL n 1 122 GLY n 1 123 ALA n 1 124 MSE n 1 125 LEU n 1 126 SER n 1 127 GLU n 1 128 LEU n 1 129 GLU n 1 130 GLN n 1 131 LEU n 1 132 TRP n 1 133 ARG n 1 134 GLY n 1 135 ARG n 1 136 ILE n 1 137 ALA n 1 138 ARG n 1 139 ILE n 1 140 ASP n 1 141 GLU n 1 142 LEU n 1 143 ILE n 1 144 ALA n 1 145 ARG n 1 146 ASP n 1 147 ARG n 1 148 PRO n 1 149 SER n 1 150 LYS n 1 151 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 151 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene D2E76_02065 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacteroides abscessus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 36809 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A418LEB3_9MYCO _struct_ref.pdbx_db_accession A0A418LEB3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TDADEDKADAMFHALSDRTRRDILRRVLAGEHSVSTLAANYDMSFAAVQKHVAVLEKAGLLTKRRNGREQLASGDVEAVR SVGAMLSELEQLWRGRIARIDELIARDRPSKD ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7R22 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 40 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 151 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A418LEB3 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 113 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 40 _struct_ref_seq.pdbx_auth_seq_align_end 151 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7R22 MET A 1 ? UNP A0A418LEB3 ? ? 'initiating methionine' 1 1 1 7R22 ASN A 2 ? UNP A0A418LEB3 ? ? 'expression tag' 2 2 1 7R22 THR A 3 ? UNP A0A418LEB3 ? ? 'expression tag' 3 3 1 7R22 ILE A 4 ? UNP A0A418LEB3 ? ? 'expression tag' 4 4 1 7R22 HIS A 5 ? UNP A0A418LEB3 ? ? 'expression tag' 5 5 1 7R22 HIS A 6 ? UNP A0A418LEB3 ? ? 'expression tag' 6 6 1 7R22 HIS A 7 ? UNP A0A418LEB3 ? ? 'expression tag' 7 7 1 7R22 HIS A 8 ? UNP A0A418LEB3 ? ? 'expression tag' 8 8 1 7R22 HIS A 9 ? UNP A0A418LEB3 ? ? 'expression tag' 9 9 1 7R22 HIS A 10 ? UNP A0A418LEB3 ? ? 'expression tag' 10 10 1 7R22 ASN A 11 ? UNP A0A418LEB3 ? ? 'expression tag' 11 11 1 7R22 THR A 12 ? UNP A0A418LEB3 ? ? 'expression tag' 12 12 1 7R22 SER A 13 ? UNP A0A418LEB3 ? ? 'expression tag' 13 13 1 7R22 GLY A 14 ? UNP A0A418LEB3 ? ? 'expression tag' 14 14 1 7R22 SER A 15 ? UNP A0A418LEB3 ? ? 'expression tag' 15 15 1 7R22 GLY A 16 ? UNP A0A418LEB3 ? ? 'expression tag' 16 16 1 7R22 GLY A 17 ? UNP A0A418LEB3 ? ? 'expression tag' 17 17 1 7R22 GLY A 18 ? UNP A0A418LEB3 ? ? 'expression tag' 18 18 1 7R22 GLY A 19 ? UNP A0A418LEB3 ? ? 'expression tag' 19 19 1 7R22 GLY A 20 ? UNP A0A418LEB3 ? ? 'expression tag' 20 20 1 7R22 ARG A 21 ? UNP A0A418LEB3 ? ? 'expression tag' 21 21 1 7R22 LEU A 22 ? UNP A0A418LEB3 ? ? 'expression tag' 22 22 1 7R22 VAL A 23 ? UNP A0A418LEB3 ? ? 'expression tag' 23 23 1 7R22 PRO A 24 ? UNP A0A418LEB3 ? ? 'expression tag' 24 24 1 7R22 ARG A 25 ? UNP A0A418LEB3 ? ? 'expression tag' 25 25 1 7R22 GLY A 26 ? UNP A0A418LEB3 ? ? 'expression tag' 26 26 1 7R22 SER A 27 ? UNP A0A418LEB3 ? ? 'expression tag' 27 27 1 7R22 MET A 28 ? UNP A0A418LEB3 ? ? 'expression tag' 28 28 1 7R22 SER A 29 ? UNP A0A418LEB3 ? ? 'expression tag' 29 29 1 7R22 GLU A 30 ? UNP A0A418LEB3 ? ? 'expression tag' 30 30 1 7R22 ASN A 31 ? UNP A0A418LEB3 ? ? 'expression tag' 31 31 1 7R22 LEU A 32 ? UNP A0A418LEB3 ? ? 'expression tag' 32 32 1 7R22 TYR A 33 ? UNP A0A418LEB3 ? ? 'expression tag' 33 33 1 7R22 PHE A 34 ? UNP A0A418LEB3 ? ? 'expression tag' 34 34 1 7R22 GLN A 35 ? UNP A0A418LEB3 ? ? 'expression tag' 35 35 1 7R22 GLY A 36 ? UNP A0A418LEB3 ? ? 'expression tag' 36 36 1 7R22 SER A 37 ? UNP A0A418LEB3 ? ? 'expression tag' 37 37 1 7R22 MET A 38 ? UNP A0A418LEB3 ? ? 'expression tag' 38 38 1 7R22 ALA A 39 ? UNP A0A418LEB3 ? ? 'expression tag' 39 39 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7R22 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.47 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 72.46 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'BATCH MODE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Sodium acetate pH 5.0 50mM Ammonium sulphate 2.0M ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-12-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7R22 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.73 _reflns.d_resolution_low 75.88 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5863 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20 _reflns.pdbx_Rmerge_I_obs 0.125 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 26.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.0 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.73 _reflns_shell.d_res_low 2.78 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 296 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.5 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7R22 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.73 _refine.ls_d_res_low 47.80 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 1083 _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 75.52 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.32 _refine.ls_R_factor_R_free 0.3473 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2992 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.73 _refine_hist.d_res_low 47.80 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 780 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 780 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0127 ? 787 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 2.0446 ? 1056 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0666 ? 120 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0070 ? 139 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 27.0561 ? 296 ? f_dihedral_angle_d ? ? # _struct.entry_id 7R22 _struct.title 'Crystal structure of protein Mab3862 from Mycobacterium abscessus' _struct.pdbx_structure_determination_methodology ? _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7R22 _struct_keywords.text 'antitoxin, toxin, Mycobacterium abscessus.putative ArsR family transcriptional regulator' _struct_keywords.pdbx_keywords ANTITOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 45 ? LEU A 54 ? ASP A 45 LEU A 54 1 ? 10 HELX_P HELX_P2 AA2 ASP A 56 ? LEU A 67 ? ASP A 56 LEU A 67 1 ? 12 HELX_P HELX_P3 AA3 SER A 72 ? ASN A 79 ? SER A 72 ASN A 79 1 ? 8 HELX_P HELX_P4 AA4 ALA A 86 ? ALA A 97 ? ALA A 86 ALA A 97 1 ? 12 HELX_P HELX_P5 AA5 VAL A 118 ? ARG A 135 ? VAL A 118 ARG A 135 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 49 C ? ? ? 1_555 A MSE 50 N ? ? A ALA 49 A MSE 50 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale2 covale both ? A MSE 50 C ? ? ? 1_555 A PHE 51 N ? ? A MSE 50 A PHE 51 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale3 covale both ? A ASP 81 C ? ? ? 1_555 A MSE 82 N ? ? A ASP 81 A MSE 82 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale4 covale both ? A MSE 82 C ? ? ? 1_555 A SER 83 N ? ? A MSE 82 A SER 83 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale5 covale both ? A ALA 123 C ? ? ? 1_555 A MSE 124 N ? ? A ALA 123 A MSE 124 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale6 covale both ? A MSE 124 C ? ? ? 1_555 A LEU 125 N ? ? A MSE 124 A LEU 125 1_555 ? ? ? ? ? ? ? 1.332 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 108 A . ? GLU 108 A GLN 109 A ? GLN 109 A 1 -4.73 2 GLU 116 A . ? GLU 116 A ALA 117 A ? ALA 117 A 1 13.83 3 ALA 117 A . ? ALA 117 A VAL 118 A ? VAL 118 A 1 18.76 # _atom_sites.entry_id 7R22 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009356 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009356 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009356 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? SE ? ? 26.02326 7.89457 ? ? 1.54240 29.12501 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 ILE 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 HIS 9 9 ? ? ? A . n A 1 10 HIS 10 10 ? ? ? A . n A 1 11 ASN 11 11 ? ? ? A . n A 1 12 THR 12 12 ? ? ? A . n A 1 13 SER 13 13 ? ? ? A . n A 1 14 GLY 14 14 ? ? ? A . n A 1 15 SER 15 15 ? ? ? A . n A 1 16 GLY 16 16 ? ? ? A . n A 1 17 GLY 17 17 ? ? ? A . n A 1 18 GLY 18 18 ? ? ? A . n A 1 19 GLY 19 19 ? ? ? A . n A 1 20 GLY 20 20 ? ? ? A . n A 1 21 ARG 21 21 ? ? ? A . n A 1 22 LEU 22 22 ? ? ? A . n A 1 23 VAL 23 23 ? ? ? A . n A 1 24 PRO 24 24 ? ? ? A . n A 1 25 ARG 25 25 ? ? ? A . n A 1 26 GLY 26 26 ? ? ? A . n A 1 27 SER 27 27 ? ? ? A . n A 1 28 MET 28 28 ? ? ? A . n A 1 29 SER 29 29 ? ? ? A . n A 1 30 GLU 30 30 ? ? ? A . n A 1 31 ASN 31 31 ? ? ? A . n A 1 32 LEU 32 32 ? ? ? A . n A 1 33 TYR 33 33 ? ? ? A . n A 1 34 PHE 34 34 ? ? ? A . n A 1 35 GLN 35 35 ? ? ? A . n A 1 36 GLY 36 36 ? ? ? A . n A 1 37 SER 37 37 ? ? ? A . n A 1 38 MET 38 38 ? ? ? A . n A 1 39 ALA 39 39 ? ? ? A . n A 1 40 THR 40 40 ? ? ? A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 MSE 50 50 50 MSE MSE A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 MSE 82 82 82 MSE MSE A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 MSE 124 124 124 MSE MSE A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 GLN 130 130 130 GLN GLN A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 TRP 132 132 132 TRP TRP A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 LEU 142 142 ? ? ? A . n A 1 143 ILE 143 143 ? ? ? A . n A 1 144 ALA 144 144 ? ? ? A . n A 1 145 ARG 145 145 ? ? ? A . n A 1 146 ASP 146 146 ? ? ? A . n A 1 147 ARG 147 147 ? ? ? A . n A 1 148 PRO 148 148 ? ? ? A . n A 1 149 SER 149 149 ? ? ? A . n A 1 150 LYS 150 150 ? ? ? A . n A 1 151 ASP 151 151 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email tlb20@cam.ac.uk _pdbx_contact_author.name_first Tom _pdbx_contact_author.name_last Blundell _pdbx_contact_author.name_mi L. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2708-8992 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 50 A MSE 50 ? MET 'modified residue' 2 A MSE 82 A MSE 82 ? MET 'modified residue' 3 A MSE 124 A MSE 124 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7630 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/4,-z+1/4,y+3/4 3 x+3/4,z+1/4,-y+1/4 4 z+3/4,y+1/4,-x+1/4 5 -z+1/4,y+3/4,x+1/4 6 -y+1/4,x+3/4,z+1/4 7 y+1/4,-x+1/4,z+3/4 8 z,x,y 9 y,z,x 10 -y+1/2,-z,x+1/2 11 z+1/2,-x+1/2,-y 12 -y,z+1/2,-x+1/2 13 -z+1/2,-x,y+1/2 14 -z,x+1/2,-y+1/2 15 y+1/2,-z+1/2,-x 16 x+1/2,-y+1/2,-z 17 -x,y+1/2,-z+1/2 18 -x+1/2,-y,z+1/2 19 y+3/4,x+1/4,-z+1/4 20 -y+3/4,-x+3/4,-z+3/4 21 z+1/4,-y+1/4,x+3/4 22 -z+3/4,-y+3/4,-x+3/4 23 -x+1/4,z+3/4,y+1/4 24 -x+3/4,-z+3/4,-y+3/4 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . 4 # _pdbx_entry_details.entry_id 7R22 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 100 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 100 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 100 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 131.40 _pdbx_validate_rmsd_angle.angle_target_value 115.30 _pdbx_validate_rmsd_angle.angle_deviation 16.10 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 55 ? ? -95.65 36.36 2 1 ARG A 60 ? ? -50.05 -74.24 3 1 ALA A 85 ? ? 110.23 -53.62 4 1 LEU A 100 ? ? 173.45 138.99 5 1 THR A 101 ? ? -170.02 134.89 6 1 ARG A 103 ? ? -98.12 -65.30 7 1 ASN A 105 ? ? 79.08 113.10 8 1 ARG A 107 ? ? -168.42 -33.34 9 1 GLU A 108 ? ? 62.94 141.90 10 1 GLN A 109 ? ? 123.73 152.48 11 1 ALA A 111 ? ? -83.27 -135.21 12 1 SER A 112 ? ? -127.12 -164.61 13 1 ASP A 114 ? ? -152.69 -68.22 14 1 VAL A 115 ? ? 33.28 -157.14 15 1 GLU A 116 ? ? 37.35 93.17 16 1 VAL A 118 ? ? -27.43 -56.03 17 1 ARG A 119 ? ? 28.31 -142.63 18 1 SER A 120 ? ? -3.57 -75.69 19 1 ILE A 136 ? ? -35.87 -36.25 20 1 ALA A 137 ? ? -26.60 106.68 21 1 ASP A 140 ? ? -170.36 131.32 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 SER A 83 ? ? PHE A 84 ? ? 149.93 2 1 LEU A 110 ? ? ALA A 111 ? ? -143.07 3 1 ARG A 119 ? ? SER A 120 ? ? 142.37 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 140 ? CG ? A ASP 140 CG 2 1 Y 1 A ASP 140 ? OD1 ? A ASP 140 OD1 3 1 Y 1 A ASP 140 ? OD2 ? A ASP 140 OD2 4 1 Y 1 A GLU 141 ? CG ? A GLU 141 CG 5 1 Y 1 A GLU 141 ? CD ? A GLU 141 CD 6 1 Y 1 A GLU 141 ? OE1 ? A GLU 141 OE1 7 1 Y 1 A GLU 141 ? OE2 ? A GLU 141 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A THR 3 ? A THR 3 4 1 Y 1 A ILE 4 ? A ILE 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A HIS 9 ? A HIS 9 10 1 Y 1 A HIS 10 ? A HIS 10 11 1 Y 1 A ASN 11 ? A ASN 11 12 1 Y 1 A THR 12 ? A THR 12 13 1 Y 1 A SER 13 ? A SER 13 14 1 Y 1 A GLY 14 ? A GLY 14 15 1 Y 1 A SER 15 ? A SER 15 16 1 Y 1 A GLY 16 ? A GLY 16 17 1 Y 1 A GLY 17 ? A GLY 17 18 1 Y 1 A GLY 18 ? A GLY 18 19 1 Y 1 A GLY 19 ? A GLY 19 20 1 Y 1 A GLY 20 ? A GLY 20 21 1 Y 1 A ARG 21 ? A ARG 21 22 1 Y 1 A LEU 22 ? A LEU 22 23 1 Y 1 A VAL 23 ? A VAL 23 24 1 Y 1 A PRO 24 ? A PRO 24 25 1 Y 1 A ARG 25 ? A ARG 25 26 1 Y 1 A GLY 26 ? A GLY 26 27 1 Y 1 A SER 27 ? A SER 27 28 1 Y 1 A MET 28 ? A MET 28 29 1 Y 1 A SER 29 ? A SER 29 30 1 Y 1 A GLU 30 ? A GLU 30 31 1 Y 1 A ASN 31 ? A ASN 31 32 1 Y 1 A LEU 32 ? A LEU 32 33 1 Y 1 A TYR 33 ? A TYR 33 34 1 Y 1 A PHE 34 ? A PHE 34 35 1 Y 1 A GLN 35 ? A GLN 35 36 1 Y 1 A GLY 36 ? A GLY 36 37 1 Y 1 A SER 37 ? A SER 37 38 1 Y 1 A MET 38 ? A MET 38 39 1 Y 1 A ALA 39 ? A ALA 39 40 1 Y 1 A THR 40 ? A THR 40 41 1 Y 1 A LEU 142 ? A LEU 142 42 1 Y 1 A ILE 143 ? A ILE 143 43 1 Y 1 A ALA 144 ? A ALA 144 44 1 Y 1 A ARG 145 ? A ARG 145 45 1 Y 1 A ASP 146 ? A ASP 146 46 1 Y 1 A ARG 147 ? A ARG 147 47 1 Y 1 A PRO 148 ? A PRO 148 48 1 Y 1 A SER 149 ? A SER 149 49 1 Y 1 A LYS 150 ? A LYS 150 50 1 Y 1 A ASP 151 ? A ASP 151 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id MSE _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id MSE _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 41 3 2' _space_group.name_Hall 'P 4bd 2ab 3' _space_group.IT_number 213 _space_group.crystal_system cubic _space_group.id 1 #