data_7R8R # _entry.id 7R8R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7R8R pdb_00007r8r 10.2210/pdb7r8r/pdb WWPDB D_1000257794 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'same protein different ligand' _pdbx_database_related.db_id 3s92 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7R8R _pdbx_database_status.recvd_initial_deposition_date 2021-06-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fromme, R.' 1 0000-0003-4835-1080 'Sivinski, J.' 2 0000-0003-2696-6279 'Zerio, C.' 3 0000-0003-4053-4835 'Gunatilaka, A.A.L.' 4 0000-0001-9663-3600 'Chapman, E.' 5 0000-0002-6310-1664 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 66 _citation.language ? _citation.page_first 913 _citation.page_last 933 _citation.title 'Physachenolide C is a Potent, Selective BET Inhibitor.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.2c01770 _citation.pdbx_database_id_PubMed 36577036 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zerio, C.J.' 1 0000-0003-4053-4835 primary 'Sivinski, J.' 2 ? primary 'Wijeratne, E.M.K.' 3 ? primary 'Xu, Y.M.' 4 ? primary 'Ngo, D.T.' 5 ? primary 'Ambrose, A.J.' 6 0000-0002-2932-4514 primary 'Villa-Celis, L.' 7 ? primary 'Ghadirian, N.' 8 ? primary 'Clarkson, M.W.' 9 ? primary 'Zhang, D.D.' 10 ? primary 'Horton, N.C.' 11 ? primary 'Gunatilaka, A.A.L.' 12 ? primary 'Fromme, R.' 13 ? primary 'Chapman, E.' 14 0000-0002-6310-1664 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7R8R _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.098 _cell.length_a_esd ? _cell.length_b 49.316 _cell.length_b_esd ? _cell.length_c 60.779 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7R8R _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 2 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bromodomain-containing protein 3' 14368.570 1 ? ? ? ? 2 non-polymer syn 'Physachenolide C' 546.649 1 ? ? ? ? 3 water nat water 18.015 58 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RING3-like protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQ DFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEE ; _entity_poly.pdbx_seq_one_letter_code_can ;PEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQ DFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 GLU n 1 3 VAL n 1 4 SER n 1 5 ASN n 1 6 PRO n 1 7 SER n 1 8 LYS n 1 9 PRO n 1 10 GLY n 1 11 ARG n 1 12 LYS n 1 13 THR n 1 14 ASN n 1 15 GLN n 1 16 LEU n 1 17 GLN n 1 18 TYR n 1 19 MET n 1 20 GLN n 1 21 ASN n 1 22 VAL n 1 23 VAL n 1 24 VAL n 1 25 LYS n 1 26 THR n 1 27 LEU n 1 28 TRP n 1 29 LYS n 1 30 HIS n 1 31 GLN n 1 32 PHE n 1 33 ALA n 1 34 TRP n 1 35 PRO n 1 36 PHE n 1 37 TYR n 1 38 GLN n 1 39 PRO n 1 40 VAL n 1 41 ASP n 1 42 ALA n 1 43 ILE n 1 44 LYS n 1 45 LEU n 1 46 ASN n 1 47 LEU n 1 48 PRO n 1 49 ASP n 1 50 TYR n 1 51 HIS n 1 52 LYS n 1 53 ILE n 1 54 ILE n 1 55 LYS n 1 56 ASN n 1 57 PRO n 1 58 MET n 1 59 ASP n 1 60 MET n 1 61 GLY n 1 62 THR n 1 63 ILE n 1 64 LYS n 1 65 LYS n 1 66 ARG n 1 67 LEU n 1 68 GLU n 1 69 ASN n 1 70 ASN n 1 71 TYR n 1 72 TYR n 1 73 TRP n 1 74 SER n 1 75 ALA n 1 76 SER n 1 77 GLU n 1 78 CYS n 1 79 MET n 1 80 GLN n 1 81 ASP n 1 82 PHE n 1 83 ASN n 1 84 THR n 1 85 MET n 1 86 PHE n 1 87 THR n 1 88 ASN n 1 89 CYS n 1 90 TYR n 1 91 ILE n 1 92 TYR n 1 93 ASN n 1 94 LYS n 1 95 PRO n 1 96 THR n 1 97 ASP n 1 98 ASP n 1 99 ILE n 1 100 VAL n 1 101 LEU n 1 102 MET n 1 103 ALA n 1 104 GLN n 1 105 ALA n 1 106 LEU n 1 107 GLU n 1 108 LYS n 1 109 ILE n 1 110 PHE n 1 111 LEU n 1 112 GLN n 1 113 LYS n 1 114 VAL n 1 115 ALA n 1 116 GLN n 1 117 MET n 1 118 PRO n 1 119 GLN n 1 120 GLU n 1 121 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 121 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BRD3, KIAA0043, RING3L' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BRD3_HUMAN _struct_ref.pdbx_db_accession Q15059 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQ DFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEE ; _struct_ref.pdbx_align_begin 24 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7R8R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 121 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q15059 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 144 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 24 _struct_ref_seq.pdbx_auth_seq_align_end 144 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 8L6 non-polymer . 'Physachenolide C' ? 'C30 H42 O9' 546.649 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7R8R _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.30 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.52 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '10mM CaCl, 50mM Tris-HCl pH 8.5, 30% w/v PEG 4000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-04-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 34.81 _reflns.entry_id 7R8R _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.8 _reflns.d_resolution_low 44.1 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12117 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.55 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.8 _reflns.pdbx_Rmerge_I_obs 0.064 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.076 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.8 _reflns_shell.d_res_low 1.864 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 508 _reflns_shell.percent_possible_all 71.21 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.782 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.557 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -2.2100 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 1.2400 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] 0.9600 _refine.B_iso_max 128.910 _refine.B_iso_mean 43.8390 _refine.B_iso_min 23.400 _refine.correlation_coeff_Fo_to_Fc 0.9700 _refine.correlation_coeff_Fo_to_Fc_free 0.9470 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7R8R _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8000 _refine.ls_d_res_low 44.1000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11563 _refine.ls_number_reflns_R_free 554 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.5600 _refine.ls_percent_reflns_R_free 4.6000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1620 _refine.ls_R_factor_R_free 0.2353 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1584 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3s91 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2200 _refine.pdbx_overall_ESU_R_Free 0.1330 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 6.7000 _refine.overall_SU_ML 0.0910 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.8000 _refine_hist.d_res_low 44.1000 _refine_hist.number_atoms_solvent 58 _refine_hist.number_atoms_total 1050 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 114 _refine_hist.pdbx_B_iso_mean_ligand 40.22 _refine_hist.pdbx_B_iso_mean_solvent 49.75 _refine_hist.pdbx_number_atoms_protein 953 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.013 1027 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 974 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.285 1.727 1405 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.558 1.642 2248 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.971 5.000 112 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 40.925 25.098 51 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.801 15.000 183 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 6.536 15.000 2 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.197 0.200 136 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 1118 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 233 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 4.679 3.000 1995 ? r_rigid_bond_restr ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.8000 _refine_ls_shell.d_res_low 1.8470 _refine_ls_shell.number_reflns_all 648 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 21 _refine_ls_shell.number_reflns_R_work 627 _refine_ls_shell.percent_reflns_obs 69.0100 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3590 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2030 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7R8R _struct.title 'Physachenolide C with Bromodomain (BRD3-BD1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7R8R _struct_keywords.text 'bromodomain 3, physachenolide C, prostate cancer, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 13 ? VAL A 22 ? THR A 36 VAL A 45 1 ? 10 HELX_P HELX_P2 AA2 VAL A 22 ? LYS A 29 ? VAL A 45 LYS A 52 1 ? 8 HELX_P HELX_P3 AA3 ALA A 33 ? TYR A 37 ? ALA A 56 TYR A 60 5 ? 5 HELX_P HELX_P4 AA4 ASP A 49 ? ILE A 54 ? ASP A 72 ILE A 77 1 ? 6 HELX_P HELX_P5 AA5 ASP A 59 ? ASN A 69 ? ASP A 82 ASN A 92 1 ? 11 HELX_P HELX_P6 AA6 SER A 74 ? ASN A 93 ? SER A 97 ASN A 116 1 ? 20 HELX_P HELX_P7 AA7 ASP A 97 ? GLN A 116 ? ASP A 120 GLN A 139 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 7R8R _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.022677 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020277 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016453 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 2.31000 1.02000 1.58860 0.86500 20.84390 10.20750 0.56870 51.65120 0.215599998832 ;4-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.49300 0.32291 0.14019 0.04081 10.51090 26.12570 3.14236 57.79970 0.0030380000826 ;4-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 12.21260 3.13220 2.01250 1.16630 0.00570 9.89330 28.99750 0.58260 -11.5290002823 ;4-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 3.04850 2.28680 1.54630 0.86700 13.27710 5.70110 0.32390 32.90890 0.250800013542 ;4-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 6.90530 5.20340 1.43790 1.58630 1.46790 22.21510 0.25360 56.17200 0.866900026798 ;4-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _database_PDB_caveat.text '8L6 A 201 HAS WRONG CHIRALITY AT ATOM C13' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 24 ? ? ? A . n A 1 2 GLU 2 25 ? ? ? A . n A 1 3 VAL 3 26 ? ? ? A . n A 1 4 SER 4 27 ? ? ? A . n A 1 5 ASN 5 28 ? ? ? A . n A 1 6 PRO 6 29 ? ? ? A . n A 1 7 SER 7 30 ? ? ? A . n A 1 8 LYS 8 31 31 LYS LYS A . n A 1 9 PRO 9 32 32 PRO PRO A . n A 1 10 GLY 10 33 33 GLY GLY A . n A 1 11 ARG 11 34 34 ARG ARG A . n A 1 12 LYS 12 35 35 LYS LYS A . n A 1 13 THR 13 36 36 THR THR A . n A 1 14 ASN 14 37 37 ASN ASN A . n A 1 15 GLN 15 38 38 GLN GLN A . n A 1 16 LEU 16 39 39 LEU LEU A . n A 1 17 GLN 17 40 40 GLN GLN A . n A 1 18 TYR 18 41 41 TYR TYR A . n A 1 19 MET 19 42 42 MET MET A . n A 1 20 GLN 20 43 43 GLN GLN A . n A 1 21 ASN 21 44 44 ASN ASN A . n A 1 22 VAL 22 45 45 VAL VAL A . n A 1 23 VAL 23 46 46 VAL VAL A . n A 1 24 VAL 24 47 47 VAL VAL A . n A 1 25 LYS 25 48 48 LYS LYS A . n A 1 26 THR 26 49 49 THR THR A . n A 1 27 LEU 27 50 50 LEU LEU A . n A 1 28 TRP 28 51 51 TRP TRP A . n A 1 29 LYS 29 52 52 LYS LYS A . n A 1 30 HIS 30 53 53 HIS HIS A . n A 1 31 GLN 31 54 54 GLN GLN A . n A 1 32 PHE 32 55 55 PHE PHE A . n A 1 33 ALA 33 56 56 ALA ALA A . n A 1 34 TRP 34 57 57 TRP TRP A . n A 1 35 PRO 35 58 58 PRO PRO A . n A 1 36 PHE 36 59 59 PHE PHE A . n A 1 37 TYR 37 60 60 TYR TYR A . n A 1 38 GLN 38 61 61 GLN GLN A . n A 1 39 PRO 39 62 62 PRO PRO A . n A 1 40 VAL 40 63 63 VAL VAL A . n A 1 41 ASP 41 64 64 ASP ASP A . n A 1 42 ALA 42 65 65 ALA ALA A . n A 1 43 ILE 43 66 66 ILE ILE A . n A 1 44 LYS 44 67 67 LYS LYS A . n A 1 45 LEU 45 68 68 LEU LEU A . n A 1 46 ASN 46 69 69 ASN ASN A . n A 1 47 LEU 47 70 70 LEU LEU A . n A 1 48 PRO 48 71 71 PRO PRO A . n A 1 49 ASP 49 72 72 ASP ASP A . n A 1 50 TYR 50 73 73 TYR TYR A . n A 1 51 HIS 51 74 74 HIS HIS A . n A 1 52 LYS 52 75 75 LYS LYS A . n A 1 53 ILE 53 76 76 ILE ILE A . n A 1 54 ILE 54 77 77 ILE ILE A . n A 1 55 LYS 55 78 78 LYS LYS A . n A 1 56 ASN 56 79 79 ASN ASN A . n A 1 57 PRO 57 80 80 PRO PRO A . n A 1 58 MET 58 81 81 MET MET A . n A 1 59 ASP 59 82 82 ASP ASP A . n A 1 60 MET 60 83 83 MET MET A . n A 1 61 GLY 61 84 84 GLY GLY A . n A 1 62 THR 62 85 85 THR THR A . n A 1 63 ILE 63 86 86 ILE ILE A . n A 1 64 LYS 64 87 87 LYS LYS A . n A 1 65 LYS 65 88 88 LYS LYS A . n A 1 66 ARG 66 89 89 ARG ARG A . n A 1 67 LEU 67 90 90 LEU LEU A . n A 1 68 GLU 68 91 91 GLU GLU A . n A 1 69 ASN 69 92 92 ASN ASN A . n A 1 70 ASN 70 93 93 ASN ASN A . n A 1 71 TYR 71 94 94 TYR TYR A . n A 1 72 TYR 72 95 95 TYR TYR A . n A 1 73 TRP 73 96 96 TRP TRP A . n A 1 74 SER 74 97 97 SER SER A . n A 1 75 ALA 75 98 98 ALA ALA A . n A 1 76 SER 76 99 99 SER SER A . n A 1 77 GLU 77 100 100 GLU GLU A . n A 1 78 CYS 78 101 101 CYS CYS A . n A 1 79 MET 79 102 102 MET MET A . n A 1 80 GLN 80 103 103 GLN GLN A . n A 1 81 ASP 81 104 104 ASP ASP A . n A 1 82 PHE 82 105 105 PHE PHE A . n A 1 83 ASN 83 106 106 ASN ASN A . n A 1 84 THR 84 107 107 THR THR A . n A 1 85 MET 85 108 108 MET MET A . n A 1 86 PHE 86 109 109 PHE PHE A . n A 1 87 THR 87 110 110 THR THR A . n A 1 88 ASN 88 111 111 ASN ASN A . n A 1 89 CYS 89 112 112 CYS CYS A . n A 1 90 TYR 90 113 113 TYR TYR A . n A 1 91 ILE 91 114 114 ILE ILE A . n A 1 92 TYR 92 115 115 TYR TYR A . n A 1 93 ASN 93 116 116 ASN ASN A . n A 1 94 LYS 94 117 117 LYS LYS A . n A 1 95 PRO 95 118 118 PRO PRO A . n A 1 96 THR 96 119 119 THR THR A . n A 1 97 ASP 97 120 120 ASP ASP A . n A 1 98 ASP 98 121 121 ASP ASP A . n A 1 99 ILE 99 122 122 ILE ILE A . n A 1 100 VAL 100 123 123 VAL VAL A . n A 1 101 LEU 101 124 124 LEU LEU A . n A 1 102 MET 102 125 125 MET MET A . n A 1 103 ALA 103 126 126 ALA ALA A . n A 1 104 GLN 104 127 127 GLN GLN A . n A 1 105 ALA 105 128 128 ALA ALA A . n A 1 106 LEU 106 129 129 LEU LEU A . n A 1 107 GLU 107 130 130 GLU GLU A . n A 1 108 LYS 108 131 131 LYS LYS A . n A 1 109 ILE 109 132 132 ILE ILE A . n A 1 110 PHE 110 133 133 PHE PHE A . n A 1 111 LEU 111 134 134 LEU LEU A . n A 1 112 GLN 112 135 135 GLN GLN A . n A 1 113 LYS 113 136 136 LYS LYS A . n A 1 114 VAL 114 137 137 VAL VAL A . n A 1 115 ALA 115 138 138 ALA ALA A . n A 1 116 GLN 116 139 139 GLN GLN A . n A 1 117 MET 117 140 140 MET MET A . n A 1 118 PRO 118 141 141 PRO PRO A . n A 1 119 GLN 119 142 142 GLN GLN A . n A 1 120 GLU 120 143 143 GLU GLU A . n A 1 121 GLU 121 144 144 GLU GLU A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email Raimund.Fromme@asu.edu _pdbx_contact_author.name_first Raimund _pdbx_contact_author.name_last Fromme _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4835-1080 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 8L6 1 201 201 8L6 8L6 A . C 3 HOH 1 301 21 HOH HOH A . C 3 HOH 2 302 81 HOH HOH A . C 3 HOH 3 303 39 HOH HOH A . C 3 HOH 4 304 33 HOH HOH A . C 3 HOH 5 305 9 HOH HOH A . C 3 HOH 6 306 21 HOH HOH A . C 3 HOH 7 307 32 HOH HOH A . C 3 HOH 8 308 3 HOH HOH A . C 3 HOH 9 309 56 HOH HOH A . C 3 HOH 10 310 29 HOH HOH A . C 3 HOH 11 311 6 HOH HOH A . C 3 HOH 12 312 28 HOH HOH A . C 3 HOH 13 313 57 HOH HOH A . C 3 HOH 14 314 10 HOH HOH A . C 3 HOH 15 315 69 HOH HOH A . C 3 HOH 16 316 1 HOH HOH A . C 3 HOH 17 317 11 HOH HOH A . C 3 HOH 18 318 64 HOH HOH A . C 3 HOH 19 319 23 HOH HOH A . C 3 HOH 20 320 13 HOH HOH A . C 3 HOH 21 321 48 HOH HOH A . C 3 HOH 22 322 14 HOH HOH A . C 3 HOH 23 323 17 HOH HOH A . C 3 HOH 24 324 61 HOH HOH A . C 3 HOH 25 325 16 HOH HOH A . C 3 HOH 26 326 25 HOH HOH A . C 3 HOH 27 327 44 HOH HOH A . C 3 HOH 28 328 67 HOH HOH A . C 3 HOH 29 329 5 HOH HOH A . C 3 HOH 30 330 2 HOH HOH A . C 3 HOH 31 331 31 HOH HOH A . C 3 HOH 32 332 26 HOH HOH A . C 3 HOH 33 333 8 HOH HOH A . C 3 HOH 34 334 11 HOH HOH A . C 3 HOH 35 335 17 HOH HOH A . C 3 HOH 36 336 83 HOH HOH A . C 3 HOH 37 337 20 HOH HOH A . C 3 HOH 38 338 28 HOH HOH A . C 3 HOH 39 339 18 HOH HOH A . C 3 HOH 40 340 9 HOH HOH A . C 3 HOH 41 341 24 HOH HOH A . C 3 HOH 42 342 4 HOH HOH A . C 3 HOH 43 343 49 HOH HOH A . C 3 HOH 44 344 54 HOH HOH A . C 3 HOH 45 345 30 HOH HOH A . C 3 HOH 46 346 34 HOH HOH A . C 3 HOH 47 347 42 HOH HOH A . C 3 HOH 48 348 50 HOH HOH A . C 3 HOH 49 349 4 HOH HOH A . C 3 HOH 50 350 47 HOH HOH A . C 3 HOH 51 351 15 HOH HOH A . C 3 HOH 52 352 52 HOH HOH A . C 3 HOH 53 353 41 HOH HOH A . C 3 HOH 54 354 38 HOH HOH A . C 3 HOH 55 355 79 HOH HOH A . C 3 HOH 56 356 46 HOH HOH A . C 3 HOH 57 357 59 HOH HOH A . C 3 HOH 58 358 66 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-09-21 2 'Structure model' 1 1 2023-02-01 3 'Structure model' 1 2 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y+1/2,-z+1/2 4 -x,-y+1/2,z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 7R8R _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 315 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 315 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_565 _pdbx_validate_symm_contact.dist 2.17 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id C13 _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id 8L6 _pdbx_validate_chiral.auth_seq_id 201 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details 'WRONG HAND' _pdbx_validate_chiral.omega . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 142 ? CG ? A GLN 119 CG 2 1 Y 1 A GLN 142 ? CD ? A GLN 119 CD 3 1 Y 1 A GLN 142 ? OE1 ? A GLN 119 OE1 4 1 Y 1 A GLN 142 ? NE2 ? A GLN 119 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PRO 24 ? A PRO 1 2 1 Y 1 A GLU 25 ? A GLU 2 3 1 Y 1 A VAL 26 ? A VAL 3 4 1 Y 1 A SER 27 ? A SER 4 5 1 Y 1 A ASN 28 ? A ASN 5 6 1 Y 1 A PRO 29 ? A PRO 6 7 1 Y 1 A SER 30 ? A SER 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 8L6 C C N N 1 8L6 O O N N 2 8L6 C1 C N S 3 8L6 C10 C N N 4 8L6 C11 C N N 5 8L6 C12 C N R 6 8L6 C13 C N R 7 8L6 C14 C N N 8 8L6 C15 C N R 9 8L6 C16 C N S 10 8L6 C17 C N R 11 8L6 C18 C N N 12 8L6 C19 C N S 13 8L6 C2 C N S 14 8L6 C20 C N N 15 8L6 C21 C N N 16 8L6 C22 C N R 17 8L6 C23 C N N 18 8L6 C24 C N N 19 8L6 C25 C N N 20 8L6 C26 C N N 21 8L6 C27 C N N 22 8L6 C28 C N N 23 8L6 C29 C N N 24 8L6 C3 C N N 25 8L6 C4 C N N 26 8L6 C5 C N N 27 8L6 C6 C N N 28 8L6 C7 C N N 29 8L6 C8 C N N 30 8L6 C9 C N S 31 8L6 O1 O N N 32 8L6 O2 O N N 33 8L6 O3 O N N 34 8L6 O4 O N N 35 8L6 O5 O N N 36 8L6 O6 O N N 37 8L6 O7 O N N 38 8L6 O8 O N N 39 8L6 H1 H N N 40 8L6 H3 H N N 41 8L6 H2 H N N 42 8L6 H5 H N N 43 8L6 H4 H N N 44 8L6 H7 H N N 45 8L6 H6 H N N 46 8L6 H8 H N N 47 8L6 H9 H N N 48 8L6 H10 H N N 49 8L6 H11 H N N 50 8L6 H12 H N N 51 8L6 H13 H N N 52 8L6 H14 H N N 53 8L6 H15 H N N 54 8L6 H16 H N N 55 8L6 H17 H N N 56 8L6 H18 H N N 57 8L6 H19 H N N 58 8L6 H20 H N N 59 8L6 H22 H N N 60 8L6 H21 H N N 61 8L6 H23 H N N 62 8L6 H25 H N N 63 8L6 H24 H N N 64 8L6 H27 H N N 65 8L6 H26 H N N 66 8L6 H28 H N N 67 8L6 H29 H N N 68 8L6 H30 H N N 69 8L6 H31 H N N 70 8L6 H33 H N N 71 8L6 H34 H N N 72 8L6 H35 H N N 73 8L6 H37 H N N 74 8L6 H38 H N N 75 8L6 H39 H N N 76 8L6 H40 H N N 77 8L6 H41 H N N 78 8L6 H42 H N N 79 8L6 H43 H N N 80 8L6 H44 H N N 81 ALA N N N N 82 ALA CA C N S 83 ALA C C N N 84 ALA O O N N 85 ALA CB C N N 86 ALA OXT O N N 87 ALA H H N N 88 ALA H2 H N N 89 ALA HA H N N 90 ALA HB1 H N N 91 ALA HB2 H N N 92 ALA HB3 H N N 93 ALA HXT H N N 94 ARG N N N N 95 ARG CA C N S 96 ARG C C N N 97 ARG O O N N 98 ARG CB C N N 99 ARG CG C N N 100 ARG CD C N N 101 ARG NE N N N 102 ARG CZ C N N 103 ARG NH1 N N N 104 ARG NH2 N N N 105 ARG OXT O N N 106 ARG H H N N 107 ARG H2 H N N 108 ARG HA H N N 109 ARG HB2 H N N 110 ARG HB3 H N N 111 ARG HG2 H N N 112 ARG HG3 H N N 113 ARG HD2 H N N 114 ARG HD3 H N N 115 ARG HE H N N 116 ARG HH11 H N N 117 ARG HH12 H N N 118 ARG HH21 H N N 119 ARG HH22 H N N 120 ARG HXT H N N 121 ASN N N N N 122 ASN CA C N S 123 ASN C C N N 124 ASN O O N N 125 ASN CB C N N 126 ASN CG C N N 127 ASN OD1 O N N 128 ASN ND2 N N N 129 ASN OXT O N N 130 ASN H H N N 131 ASN H2 H N N 132 ASN HA H N N 133 ASN HB2 H N N 134 ASN HB3 H N N 135 ASN HD21 H N N 136 ASN HD22 H N N 137 ASN HXT H N N 138 ASP N N N N 139 ASP CA C N S 140 ASP C C N N 141 ASP O O N N 142 ASP CB C N N 143 ASP CG C N N 144 ASP OD1 O N N 145 ASP OD2 O N N 146 ASP OXT O N N 147 ASP H H N N 148 ASP H2 H N N 149 ASP HA H N N 150 ASP HB2 H N N 151 ASP HB3 H N N 152 ASP HD2 H N N 153 ASP HXT H N N 154 CYS N N N N 155 CYS CA C N R 156 CYS C C N N 157 CYS O O N N 158 CYS CB C N N 159 CYS SG S N N 160 CYS OXT O N N 161 CYS H H N N 162 CYS H2 H N N 163 CYS HA H N N 164 CYS HB2 H N N 165 CYS HB3 H N N 166 CYS HG H N N 167 CYS HXT H N N 168 GLN N N N N 169 GLN CA C N S 170 GLN C C N N 171 GLN O O N N 172 GLN CB C N N 173 GLN CG C N N 174 GLN CD C N N 175 GLN OE1 O N N 176 GLN NE2 N N N 177 GLN OXT O N N 178 GLN H H N N 179 GLN H2 H N N 180 GLN HA H N N 181 GLN HB2 H N N 182 GLN HB3 H N N 183 GLN HG2 H N N 184 GLN HG3 H N N 185 GLN HE21 H N N 186 GLN HE22 H N N 187 GLN HXT H N N 188 GLU N N N N 189 GLU CA C N S 190 GLU C C N N 191 GLU O O N N 192 GLU CB C N N 193 GLU CG C N N 194 GLU CD C N N 195 GLU OE1 O N N 196 GLU OE2 O N N 197 GLU OXT O N N 198 GLU H H N N 199 GLU H2 H N N 200 GLU HA H N N 201 GLU HB2 H N N 202 GLU HB3 H N N 203 GLU HG2 H N N 204 GLU HG3 H N N 205 GLU HE2 H N N 206 GLU HXT H N N 207 GLY N N N N 208 GLY CA C N N 209 GLY C C N N 210 GLY O O N N 211 GLY OXT O N N 212 GLY H H N N 213 GLY H2 H N N 214 GLY HA2 H N N 215 GLY HA3 H N N 216 GLY HXT H N N 217 HIS N N N N 218 HIS CA C N S 219 HIS C C N N 220 HIS O O N N 221 HIS CB C N N 222 HIS CG C Y N 223 HIS ND1 N Y N 224 HIS CD2 C Y N 225 HIS CE1 C Y N 226 HIS NE2 N Y N 227 HIS OXT O N N 228 HIS H H N N 229 HIS H2 H N N 230 HIS HA H N N 231 HIS HB2 H N N 232 HIS HB3 H N N 233 HIS HD1 H N N 234 HIS HD2 H N N 235 HIS HE1 H N N 236 HIS HE2 H N N 237 HIS HXT H N N 238 HOH O O N N 239 HOH H1 H N N 240 HOH H2 H N N 241 ILE N N N N 242 ILE CA C N S 243 ILE C C N N 244 ILE O O N N 245 ILE CB C N S 246 ILE CG1 C N N 247 ILE CG2 C N N 248 ILE CD1 C N N 249 ILE OXT O N N 250 ILE H H N N 251 ILE H2 H N N 252 ILE HA H N N 253 ILE HB H N N 254 ILE HG12 H N N 255 ILE HG13 H N N 256 ILE HG21 H N N 257 ILE HG22 H N N 258 ILE HG23 H N N 259 ILE HD11 H N N 260 ILE HD12 H N N 261 ILE HD13 H N N 262 ILE HXT H N N 263 LEU N N N N 264 LEU CA C N S 265 LEU C C N N 266 LEU O O N N 267 LEU CB C N N 268 LEU CG C N N 269 LEU CD1 C N N 270 LEU CD2 C N N 271 LEU OXT O N N 272 LEU H H N N 273 LEU H2 H N N 274 LEU HA H N N 275 LEU HB2 H N N 276 LEU HB3 H N N 277 LEU HG H N N 278 LEU HD11 H N N 279 LEU HD12 H N N 280 LEU HD13 H N N 281 LEU HD21 H N N 282 LEU HD22 H N N 283 LEU HD23 H N N 284 LEU HXT H N N 285 LYS N N N N 286 LYS CA C N S 287 LYS C C N N 288 LYS O O N N 289 LYS CB C N N 290 LYS CG C N N 291 LYS CD C N N 292 LYS CE C N N 293 LYS NZ N N N 294 LYS OXT O N N 295 LYS H H N N 296 LYS H2 H N N 297 LYS HA H N N 298 LYS HB2 H N N 299 LYS HB3 H N N 300 LYS HG2 H N N 301 LYS HG3 H N N 302 LYS HD2 H N N 303 LYS HD3 H N N 304 LYS HE2 H N N 305 LYS HE3 H N N 306 LYS HZ1 H N N 307 LYS HZ2 H N N 308 LYS HZ3 H N N 309 LYS HXT H N N 310 MET N N N N 311 MET CA C N S 312 MET C C N N 313 MET O O N N 314 MET CB C N N 315 MET CG C N N 316 MET SD S N N 317 MET CE C N N 318 MET OXT O N N 319 MET H H N N 320 MET H2 H N N 321 MET HA H N N 322 MET HB2 H N N 323 MET HB3 H N N 324 MET HG2 H N N 325 MET HG3 H N N 326 MET HE1 H N N 327 MET HE2 H N N 328 MET HE3 H N N 329 MET HXT H N N 330 PHE N N N N 331 PHE CA C N S 332 PHE C C N N 333 PHE O O N N 334 PHE CB C N N 335 PHE CG C Y N 336 PHE CD1 C Y N 337 PHE CD2 C Y N 338 PHE CE1 C Y N 339 PHE CE2 C Y N 340 PHE CZ C Y N 341 PHE OXT O N N 342 PHE H H N N 343 PHE H2 H N N 344 PHE HA H N N 345 PHE HB2 H N N 346 PHE HB3 H N N 347 PHE HD1 H N N 348 PHE HD2 H N N 349 PHE HE1 H N N 350 PHE HE2 H N N 351 PHE HZ H N N 352 PHE HXT H N N 353 PRO N N N N 354 PRO CA C N S 355 PRO C C N N 356 PRO O O N N 357 PRO CB C N N 358 PRO CG C N N 359 PRO CD C N N 360 PRO OXT O N N 361 PRO H H N N 362 PRO HA H N N 363 PRO HB2 H N N 364 PRO HB3 H N N 365 PRO HG2 H N N 366 PRO HG3 H N N 367 PRO HD2 H N N 368 PRO HD3 H N N 369 PRO HXT H N N 370 SER N N N N 371 SER CA C N S 372 SER C C N N 373 SER O O N N 374 SER CB C N N 375 SER OG O N N 376 SER OXT O N N 377 SER H H N N 378 SER H2 H N N 379 SER HA H N N 380 SER HB2 H N N 381 SER HB3 H N N 382 SER HG H N N 383 SER HXT H N N 384 THR N N N N 385 THR CA C N S 386 THR C C N N 387 THR O O N N 388 THR CB C N R 389 THR OG1 O N N 390 THR CG2 C N N 391 THR OXT O N N 392 THR H H N N 393 THR H2 H N N 394 THR HA H N N 395 THR HB H N N 396 THR HG1 H N N 397 THR HG21 H N N 398 THR HG22 H N N 399 THR HG23 H N N 400 THR HXT H N N 401 TRP N N N N 402 TRP CA C N S 403 TRP C C N N 404 TRP O O N N 405 TRP CB C N N 406 TRP CG C Y N 407 TRP CD1 C Y N 408 TRP CD2 C Y N 409 TRP NE1 N Y N 410 TRP CE2 C Y N 411 TRP CE3 C Y N 412 TRP CZ2 C Y N 413 TRP CZ3 C Y N 414 TRP CH2 C Y N 415 TRP OXT O N N 416 TRP H H N N 417 TRP H2 H N N 418 TRP HA H N N 419 TRP HB2 H N N 420 TRP HB3 H N N 421 TRP HD1 H N N 422 TRP HE1 H N N 423 TRP HE3 H N N 424 TRP HZ2 H N N 425 TRP HZ3 H N N 426 TRP HH2 H N N 427 TRP HXT H N N 428 TYR N N N N 429 TYR CA C N S 430 TYR C C N N 431 TYR O O N N 432 TYR CB C N N 433 TYR CG C Y N 434 TYR CD1 C Y N 435 TYR CD2 C Y N 436 TYR CE1 C Y N 437 TYR CE2 C Y N 438 TYR CZ C Y N 439 TYR OH O N N 440 TYR OXT O N N 441 TYR H H N N 442 TYR H2 H N N 443 TYR HA H N N 444 TYR HB2 H N N 445 TYR HB3 H N N 446 TYR HD1 H N N 447 TYR HD2 H N N 448 TYR HE1 H N N 449 TYR HE2 H N N 450 TYR HH H N N 451 TYR HXT H N N 452 VAL N N N N 453 VAL CA C N S 454 VAL C C N N 455 VAL O O N N 456 VAL CB C N N 457 VAL CG1 C N N 458 VAL CG2 C N N 459 VAL OXT O N N 460 VAL H H N N 461 VAL H2 H N N 462 VAL HA H N N 463 VAL HB H N N 464 VAL HG11 H N N 465 VAL HG12 H N N 466 VAL HG13 H N N 467 VAL HG21 H N N 468 VAL HG22 H N N 469 VAL HG23 H N N 470 VAL HXT H N N 471 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 8L6 O6 C24 doub N N 1 8L6 C25 C24 sing N N 2 8L6 C24 O5 sing N N 3 8L6 O5 C23 sing N N 4 8L6 C18 C17 sing N N 5 8L6 C7 C6 sing N N 6 8L6 C23 C22 sing N N 7 8L6 O7 C16 sing N N 8 8L6 O7 C15 sing N N 9 8L6 C17 C16 sing N N 10 8L6 C17 C29 sing N N 11 8L6 C17 C19 sing N N 12 8L6 C16 C26 sing N N 13 8L6 C16 C15 sing N N 14 8L6 C28 C29 sing N N 15 8L6 C28 C27 sing N N 16 8L6 C29 O8 doub N N 17 8L6 C26 C27 sing N N 18 8L6 O3 C9 sing N N 19 8L6 C6 C8 sing N N 20 8L6 C6 C4 doub N N 21 8L6 C20 C21 sing N N 22 8L6 C20 C19 sing N N 23 8L6 C22 C21 sing N N 24 8L6 C22 C9 sing N N 25 8L6 C22 C12 sing N N 26 8L6 C8 C2 sing N N 27 8L6 C19 C13 sing N N 28 8L6 C13 C14 sing N N 29 8L6 C13 C12 sing N N 30 8L6 C15 C14 sing N N 31 8L6 C5 C4 sing N N 32 8L6 C9 C10 sing N N 33 8L6 C9 C1 sing N N 34 8L6 C4 C3 sing N N 35 8L6 C12 C11 sing N N 36 8L6 C12 O4 sing N N 37 8L6 C10 C11 sing N N 38 8L6 C2 C1 sing N N 39 8L6 C2 O sing N N 40 8L6 C1 O2 sing N N 41 8L6 C1 C sing N N 42 8L6 C3 O sing N N 43 8L6 C3 O1 doub N N 44 8L6 C H1 sing N N 45 8L6 C H3 sing N N 46 8L6 C H2 sing N N 47 8L6 C10 H5 sing N N 48 8L6 C10 H4 sing N N 49 8L6 C11 H7 sing N N 50 8L6 C11 H6 sing N N 51 8L6 C13 H8 sing N N 52 8L6 C14 H9 sing N N 53 8L6 C14 H10 sing N N 54 8L6 C15 H11 sing N N 55 8L6 C18 H12 sing N N 56 8L6 C18 H13 sing N N 57 8L6 C18 H14 sing N N 58 8L6 C19 H15 sing N N 59 8L6 C2 H16 sing N N 60 8L6 C20 H17 sing N N 61 8L6 C20 H18 sing N N 62 8L6 C21 H19 sing N N 63 8L6 C21 H20 sing N N 64 8L6 C23 H22 sing N N 65 8L6 C23 H21 sing N N 66 8L6 C25 H23 sing N N 67 8L6 C25 H25 sing N N 68 8L6 C25 H24 sing N N 69 8L6 C26 H27 sing N N 70 8L6 C26 H26 sing N N 71 8L6 C27 H28 sing N N 72 8L6 C27 H29 sing N N 73 8L6 C28 H30 sing N N 74 8L6 C28 H31 sing N N 75 8L6 C5 H33 sing N N 76 8L6 C5 H34 sing N N 77 8L6 C5 H35 sing N N 78 8L6 C7 H37 sing N N 79 8L6 C7 H38 sing N N 80 8L6 C7 H39 sing N N 81 8L6 C8 H40 sing N N 82 8L6 C8 H41 sing N N 83 8L6 O2 H42 sing N N 84 8L6 O3 H43 sing N N 85 8L6 O4 H44 sing N N 86 ALA N CA sing N N 87 ALA N H sing N N 88 ALA N H2 sing N N 89 ALA CA C sing N N 90 ALA CA CB sing N N 91 ALA CA HA sing N N 92 ALA C O doub N N 93 ALA C OXT sing N N 94 ALA CB HB1 sing N N 95 ALA CB HB2 sing N N 96 ALA CB HB3 sing N N 97 ALA OXT HXT sing N N 98 ARG N CA sing N N 99 ARG N H sing N N 100 ARG N H2 sing N N 101 ARG CA C sing N N 102 ARG CA CB sing N N 103 ARG CA HA sing N N 104 ARG C O doub N N 105 ARG C OXT sing N N 106 ARG CB CG sing N N 107 ARG CB HB2 sing N N 108 ARG CB HB3 sing N N 109 ARG CG CD sing N N 110 ARG CG HG2 sing N N 111 ARG CG HG3 sing N N 112 ARG CD NE sing N N 113 ARG CD HD2 sing N N 114 ARG CD HD3 sing N N 115 ARG NE CZ sing N N 116 ARG NE HE sing N N 117 ARG CZ NH1 sing N N 118 ARG CZ NH2 doub N N 119 ARG NH1 HH11 sing N N 120 ARG NH1 HH12 sing N N 121 ARG NH2 HH21 sing N N 122 ARG NH2 HH22 sing N N 123 ARG OXT HXT sing N N 124 ASN N CA sing N N 125 ASN N H sing N N 126 ASN N H2 sing N N 127 ASN CA C sing N N 128 ASN CA CB sing N N 129 ASN CA HA sing N N 130 ASN C O doub N N 131 ASN C OXT sing N N 132 ASN CB CG sing N N 133 ASN CB HB2 sing N N 134 ASN CB HB3 sing N N 135 ASN CG OD1 doub N N 136 ASN CG ND2 sing N N 137 ASN ND2 HD21 sing N N 138 ASN ND2 HD22 sing N N 139 ASN OXT HXT sing N N 140 ASP N CA sing N N 141 ASP N H sing N N 142 ASP N H2 sing N N 143 ASP CA C sing N N 144 ASP CA CB sing N N 145 ASP CA HA sing N N 146 ASP C O doub N N 147 ASP C OXT sing N N 148 ASP CB CG sing N N 149 ASP CB HB2 sing N N 150 ASP CB HB3 sing N N 151 ASP CG OD1 doub N N 152 ASP CG OD2 sing N N 153 ASP OD2 HD2 sing N N 154 ASP OXT HXT sing N N 155 CYS N CA sing N N 156 CYS N H sing N N 157 CYS N H2 sing N N 158 CYS CA C sing N N 159 CYS CA CB sing N N 160 CYS CA HA sing N N 161 CYS C O doub N N 162 CYS C OXT sing N N 163 CYS CB SG sing N N 164 CYS CB HB2 sing N N 165 CYS CB HB3 sing N N 166 CYS SG HG sing N N 167 CYS OXT HXT sing N N 168 GLN N CA sing N N 169 GLN N H sing N N 170 GLN N H2 sing N N 171 GLN CA C sing N N 172 GLN CA CB sing N N 173 GLN CA HA sing N N 174 GLN C O doub N N 175 GLN C OXT sing N N 176 GLN CB CG sing N N 177 GLN CB HB2 sing N N 178 GLN CB HB3 sing N N 179 GLN CG CD sing N N 180 GLN CG HG2 sing N N 181 GLN CG HG3 sing N N 182 GLN CD OE1 doub N N 183 GLN CD NE2 sing N N 184 GLN NE2 HE21 sing N N 185 GLN NE2 HE22 sing N N 186 GLN OXT HXT sing N N 187 GLU N CA sing N N 188 GLU N H sing N N 189 GLU N H2 sing N N 190 GLU CA C sing N N 191 GLU CA CB sing N N 192 GLU CA HA sing N N 193 GLU C O doub N N 194 GLU C OXT sing N N 195 GLU CB CG sing N N 196 GLU CB HB2 sing N N 197 GLU CB HB3 sing N N 198 GLU CG CD sing N N 199 GLU CG HG2 sing N N 200 GLU CG HG3 sing N N 201 GLU CD OE1 doub N N 202 GLU CD OE2 sing N N 203 GLU OE2 HE2 sing N N 204 GLU OXT HXT sing N N 205 GLY N CA sing N N 206 GLY N H sing N N 207 GLY N H2 sing N N 208 GLY CA C sing N N 209 GLY CA HA2 sing N N 210 GLY CA HA3 sing N N 211 GLY C O doub N N 212 GLY C OXT sing N N 213 GLY OXT HXT sing N N 214 HIS N CA sing N N 215 HIS N H sing N N 216 HIS N H2 sing N N 217 HIS CA C sing N N 218 HIS CA CB sing N N 219 HIS CA HA sing N N 220 HIS C O doub N N 221 HIS C OXT sing N N 222 HIS CB CG sing N N 223 HIS CB HB2 sing N N 224 HIS CB HB3 sing N N 225 HIS CG ND1 sing Y N 226 HIS CG CD2 doub Y N 227 HIS ND1 CE1 doub Y N 228 HIS ND1 HD1 sing N N 229 HIS CD2 NE2 sing Y N 230 HIS CD2 HD2 sing N N 231 HIS CE1 NE2 sing Y N 232 HIS CE1 HE1 sing N N 233 HIS NE2 HE2 sing N N 234 HIS OXT HXT sing N N 235 HOH O H1 sing N N 236 HOH O H2 sing N N 237 ILE N CA sing N N 238 ILE N H sing N N 239 ILE N H2 sing N N 240 ILE CA C sing N N 241 ILE CA CB sing N N 242 ILE CA HA sing N N 243 ILE C O doub N N 244 ILE C OXT sing N N 245 ILE CB CG1 sing N N 246 ILE CB CG2 sing N N 247 ILE CB HB sing N N 248 ILE CG1 CD1 sing N N 249 ILE CG1 HG12 sing N N 250 ILE CG1 HG13 sing N N 251 ILE CG2 HG21 sing N N 252 ILE CG2 HG22 sing N N 253 ILE CG2 HG23 sing N N 254 ILE CD1 HD11 sing N N 255 ILE CD1 HD12 sing N N 256 ILE CD1 HD13 sing N N 257 ILE OXT HXT sing N N 258 LEU N CA sing N N 259 LEU N H sing N N 260 LEU N H2 sing N N 261 LEU CA C sing N N 262 LEU CA CB sing N N 263 LEU CA HA sing N N 264 LEU C O doub N N 265 LEU C OXT sing N N 266 LEU CB CG sing N N 267 LEU CB HB2 sing N N 268 LEU CB HB3 sing N N 269 LEU CG CD1 sing N N 270 LEU CG CD2 sing N N 271 LEU CG HG sing N N 272 LEU CD1 HD11 sing N N 273 LEU CD1 HD12 sing N N 274 LEU CD1 HD13 sing N N 275 LEU CD2 HD21 sing N N 276 LEU CD2 HD22 sing N N 277 LEU CD2 HD23 sing N N 278 LEU OXT HXT sing N N 279 LYS N CA sing N N 280 LYS N H sing N N 281 LYS N H2 sing N N 282 LYS CA C sing N N 283 LYS CA CB sing N N 284 LYS CA HA sing N N 285 LYS C O doub N N 286 LYS C OXT sing N N 287 LYS CB CG sing N N 288 LYS CB HB2 sing N N 289 LYS CB HB3 sing N N 290 LYS CG CD sing N N 291 LYS CG HG2 sing N N 292 LYS CG HG3 sing N N 293 LYS CD CE sing N N 294 LYS CD HD2 sing N N 295 LYS CD HD3 sing N N 296 LYS CE NZ sing N N 297 LYS CE HE2 sing N N 298 LYS CE HE3 sing N N 299 LYS NZ HZ1 sing N N 300 LYS NZ HZ2 sing N N 301 LYS NZ HZ3 sing N N 302 LYS OXT HXT sing N N 303 MET N CA sing N N 304 MET N H sing N N 305 MET N H2 sing N N 306 MET CA C sing N N 307 MET CA CB sing N N 308 MET CA HA sing N N 309 MET C O doub N N 310 MET C OXT sing N N 311 MET CB CG sing N N 312 MET CB HB2 sing N N 313 MET CB HB3 sing N N 314 MET CG SD sing N N 315 MET CG HG2 sing N N 316 MET CG HG3 sing N N 317 MET SD CE sing N N 318 MET CE HE1 sing N N 319 MET CE HE2 sing N N 320 MET CE HE3 sing N N 321 MET OXT HXT sing N N 322 PHE N CA sing N N 323 PHE N H sing N N 324 PHE N H2 sing N N 325 PHE CA C sing N N 326 PHE CA CB sing N N 327 PHE CA HA sing N N 328 PHE C O doub N N 329 PHE C OXT sing N N 330 PHE CB CG sing N N 331 PHE CB HB2 sing N N 332 PHE CB HB3 sing N N 333 PHE CG CD1 doub Y N 334 PHE CG CD2 sing Y N 335 PHE CD1 CE1 sing Y N 336 PHE CD1 HD1 sing N N 337 PHE CD2 CE2 doub Y N 338 PHE CD2 HD2 sing N N 339 PHE CE1 CZ doub Y N 340 PHE CE1 HE1 sing N N 341 PHE CE2 CZ sing Y N 342 PHE CE2 HE2 sing N N 343 PHE CZ HZ sing N N 344 PHE OXT HXT sing N N 345 PRO N CA sing N N 346 PRO N CD sing N N 347 PRO N H sing N N 348 PRO CA C sing N N 349 PRO CA CB sing N N 350 PRO CA HA sing N N 351 PRO C O doub N N 352 PRO C OXT sing N N 353 PRO CB CG sing N N 354 PRO CB HB2 sing N N 355 PRO CB HB3 sing N N 356 PRO CG CD sing N N 357 PRO CG HG2 sing N N 358 PRO CG HG3 sing N N 359 PRO CD HD2 sing N N 360 PRO CD HD3 sing N N 361 PRO OXT HXT sing N N 362 SER N CA sing N N 363 SER N H sing N N 364 SER N H2 sing N N 365 SER CA C sing N N 366 SER CA CB sing N N 367 SER CA HA sing N N 368 SER C O doub N N 369 SER C OXT sing N N 370 SER CB OG sing N N 371 SER CB HB2 sing N N 372 SER CB HB3 sing N N 373 SER OG HG sing N N 374 SER OXT HXT sing N N 375 THR N CA sing N N 376 THR N H sing N N 377 THR N H2 sing N N 378 THR CA C sing N N 379 THR CA CB sing N N 380 THR CA HA sing N N 381 THR C O doub N N 382 THR C OXT sing N N 383 THR CB OG1 sing N N 384 THR CB CG2 sing N N 385 THR CB HB sing N N 386 THR OG1 HG1 sing N N 387 THR CG2 HG21 sing N N 388 THR CG2 HG22 sing N N 389 THR CG2 HG23 sing N N 390 THR OXT HXT sing N N 391 TRP N CA sing N N 392 TRP N H sing N N 393 TRP N H2 sing N N 394 TRP CA C sing N N 395 TRP CA CB sing N N 396 TRP CA HA sing N N 397 TRP C O doub N N 398 TRP C OXT sing N N 399 TRP CB CG sing N N 400 TRP CB HB2 sing N N 401 TRP CB HB3 sing N N 402 TRP CG CD1 doub Y N 403 TRP CG CD2 sing Y N 404 TRP CD1 NE1 sing Y N 405 TRP CD1 HD1 sing N N 406 TRP CD2 CE2 doub Y N 407 TRP CD2 CE3 sing Y N 408 TRP NE1 CE2 sing Y N 409 TRP NE1 HE1 sing N N 410 TRP CE2 CZ2 sing Y N 411 TRP CE3 CZ3 doub Y N 412 TRP CE3 HE3 sing N N 413 TRP CZ2 CH2 doub Y N 414 TRP CZ2 HZ2 sing N N 415 TRP CZ3 CH2 sing Y N 416 TRP CZ3 HZ3 sing N N 417 TRP CH2 HH2 sing N N 418 TRP OXT HXT sing N N 419 TYR N CA sing N N 420 TYR N H sing N N 421 TYR N H2 sing N N 422 TYR CA C sing N N 423 TYR CA CB sing N N 424 TYR CA HA sing N N 425 TYR C O doub N N 426 TYR C OXT sing N N 427 TYR CB CG sing N N 428 TYR CB HB2 sing N N 429 TYR CB HB3 sing N N 430 TYR CG CD1 doub Y N 431 TYR CG CD2 sing Y N 432 TYR CD1 CE1 sing Y N 433 TYR CD1 HD1 sing N N 434 TYR CD2 CE2 doub Y N 435 TYR CD2 HD2 sing N N 436 TYR CE1 CZ doub Y N 437 TYR CE1 HE1 sing N N 438 TYR CE2 CZ sing Y N 439 TYR CE2 HE2 sing N N 440 TYR CZ OH sing N N 441 TYR OH HH sing N N 442 TYR OXT HXT sing N N 443 VAL N CA sing N N 444 VAL N H sing N N 445 VAL N H2 sing N N 446 VAL CA C sing N N 447 VAL CA CB sing N N 448 VAL CA HA sing N N 449 VAL C O doub N N 450 VAL C OXT sing N N 451 VAL CB CG1 sing N N 452 VAL CB CG2 sing N N 453 VAL CB HB sing N N 454 VAL CG1 HG11 sing N N 455 VAL CG1 HG12 sing N N 456 VAL CG1 HG13 sing N N 457 VAL CG2 HG21 sing N N 458 VAL CG2 HG22 sing N N 459 VAL CG2 HG23 sing N N 460 VAL OXT HXT sing N N 461 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 8L6 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 8L6 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'Physachenolide C' 8L6 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3S91 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 2 21 21' _space_group.name_Hall 'P 2 2ab (z,x,y)' _space_group.IT_number 18 _space_group.crystal_system orthorhombic _space_group.id 1 #