data_7RN3 # _entry.id 7RN3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7RN3 pdb_00007rn3 10.2210/pdb7rn3/pdb WWPDB D_1000258320 ? ? BMRB 30938 ? 10.13018/BMR30938 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-03-02 2 'Structure model' 1 1 2022-12-07 3 'Structure model' 1 2 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_entry_details 7 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7RN3 _pdbx_database_status.recvd_initial_deposition_date 2021-07-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'hyen D solution structure' _pdbx_database_related.db_id 30938 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Du, Q.' 1 0000-0002-1165-3766 'Huang, Y.H.' 2 0000-0001-6937-2660 'Craik, D.J.' 3 0000-0003-0007-6796 'Wang, C.K.' 4 0000-0002-7973-7632 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 298 _citation.language ? _citation.page_first 101822 _citation.page_last 101822 _citation.title ;Mutagenesis of bracelet cyclotide hyen D reveals functionally and structurally critical residues for membrane binding and cytotoxicity. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jbc.2022.101822 _citation.pdbx_database_id_PubMed 35283188 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Du, Q.' 1 ? primary 'Huang, Y.H.' 2 ? primary 'Wang, C.K.' 3 ? primary 'Kaas, Q.' 4 ? primary 'Craik, D.J.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Cyclotide hyen-D' _entity.formula_weight 3182.778 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GFPCGESCVYIPCFTAAIGCSCKSKVCYKN _entity_poly.pdbx_seq_one_letter_code_can GFPCGESCVYIPCFTAAIGCSCKSKVCYKN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PHE n 1 3 PRO n 1 4 CYS n 1 5 GLY n 1 6 GLU n 1 7 SER n 1 8 CYS n 1 9 VAL n 1 10 TYR n 1 11 ILE n 1 12 PRO n 1 13 CYS n 1 14 PHE n 1 15 THR n 1 16 ALA n 1 17 ALA n 1 18 ILE n 1 19 GLY n 1 20 CYS n 1 21 SER n 1 22 CYS n 1 23 LYS n 1 24 SER n 1 25 LYS n 1 26 VAL n 1 27 CYS n 1 28 TYR n 1 29 LYS n 1 30 ASN n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 30 _entity_src_nat.common_name 'Spade flower, Viola enneasperma' _entity_src_nat.pdbx_organism_scientific 'Hybanthus enneaspermus' _entity_src_nat.pdbx_ncbi_taxonomy_id 212266 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ASN 30 30 30 ASN ASN A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7RN3 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7RN3 _struct.title 'hyen D solution structure' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7RN3 _struct_keywords.text 'cyclotides, PLANT PROTEIN' _struct_keywords.pdbx_keywords 'PLANT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYHED_HYBEN _struct_ref.pdbx_db_accession C0HLN8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GFPCGESCVYIPCFTAAIGCSCKSKVCYKN _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7RN3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 30 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C0HLN8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 30 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 30 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 13 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 17 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 13 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 17 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 20 SG ? ? A CYS 4 A CYS 20 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf2 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 8 A CYS 22 1_555 ? ? ? ? ? ? ? 2.011 ? ? disulf3 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 13 A CYS 27 1_555 ? ? ? ? ? ? ? 2.004 ? ? covale1 covale both ? A GLY 1 N ? ? ? 1_555 A ASN 30 C ? ? A GLY 1 A ASN 30 1_555 ? ? ? ? ? ? ? 1.320 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 4 ? CYS A 20 ? CYS A 4 ? 1_555 CYS A 20 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 8 ? CYS A 22 ? CYS A 8 ? 1_555 CYS A 22 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 13 ? CYS A 27 ? CYS A 13 ? 1_555 CYS A 27 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 GLY A 1 ? ASN A 30 ? GLY A 1 ? 1_555 ASN A 30 ? 1_555 N C . . . None 'Non-standard linkage' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 2 ? SER A 7 ? PHE A 2 SER A 7 AA1 2 VAL A 26 ? LYS A 29 ? VAL A 26 LYS A 29 AA1 3 SER A 21 ? LYS A 23 ? SER A 21 LYS A 23 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 2 ? N PHE A 2 O LYS A 29 ? O LYS A 29 AA1 2 3 O VAL A 26 ? O VAL A 26 N LYS A 23 ? N LYS A 23 # _pdbx_entry_details.entry_id 7RN3 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 8 ? ? -152.35 32.80 2 1 ILE A 18 ? ? -115.18 -75.65 3 2 CYS A 8 ? ? -149.30 35.45 4 4 CYS A 8 ? ? -149.96 38.44 5 5 CYS A 8 ? ? -143.35 32.41 6 5 ILE A 18 ? ? -129.71 -66.47 7 6 CYS A 8 ? ? -145.95 36.38 8 7 CYS A 8 ? ? -146.78 34.20 9 8 CYS A 8 ? ? -149.82 35.59 10 8 ILE A 18 ? ? -120.28 -71.98 11 9 CYS A 8 ? ? -147.33 34.90 12 9 LYS A 25 ? ? 59.42 19.68 13 10 LYS A 25 ? ? 59.48 17.52 14 11 CYS A 8 ? ? -151.32 31.84 15 11 LYS A 25 ? ? 59.23 18.64 16 12 CYS A 8 ? ? -144.71 31.68 17 13 CYS A 8 ? ? -150.03 34.44 18 13 ILE A 18 ? ? -123.47 -54.20 19 13 LYS A 25 ? ? 58.93 17.84 20 14 CYS A 8 ? ? -145.50 33.37 21 14 LYS A 25 ? ? 59.33 15.92 22 15 CYS A 8 ? ? -150.87 34.68 23 15 ILE A 18 ? ? -118.72 -70.13 24 16 CYS A 8 ? ? -151.29 34.55 25 17 CYS A 8 ? ? -141.83 31.07 26 18 LYS A 25 ? ? 59.43 15.32 27 20 CYS A 8 ? ? -151.67 37.02 # _pdbx_nmr_ensemble.entry_id 7RN3 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7RN3 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '4 mg/mL hyen D, 90 % H2O, 10 % D2O, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 'hyen D' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'hyen D' 4 ? mg/mL none 1 H2O 90 ? % none 1 D2O 10 ? % none # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 3.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength nd _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '2D 1H-15N HSQC' 1 isotropic 4 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic # _pdbx_nmr_refine.entry_id 7RN3 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger A. T. et.al.' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 processing TopSpin ? 'Bruker Biospin' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 CYS N N N N 31 CYS CA C N R 32 CYS C C N N 33 CYS O O N N 34 CYS CB C N N 35 CYS SG S N N 36 CYS OXT O N N 37 CYS H H N N 38 CYS H2 H N N 39 CYS HA H N N 40 CYS HB2 H N N 41 CYS HB3 H N N 42 CYS HG H N N 43 CYS HXT H N N 44 GLU N N N N 45 GLU CA C N S 46 GLU C C N N 47 GLU O O N N 48 GLU CB C N N 49 GLU CG C N N 50 GLU CD C N N 51 GLU OE1 O N N 52 GLU OE2 O N N 53 GLU OXT O N N 54 GLU H H N N 55 GLU H2 H N N 56 GLU HA H N N 57 GLU HB2 H N N 58 GLU HB3 H N N 59 GLU HG2 H N N 60 GLU HG3 H N N 61 GLU HE2 H N N 62 GLU HXT H N N 63 GLY N N N N 64 GLY CA C N N 65 GLY C C N N 66 GLY O O N N 67 GLY OXT O N N 68 GLY H H N N 69 GLY H2 H N N 70 GLY HA2 H N N 71 GLY HA3 H N N 72 GLY HXT H N N 73 ILE N N N N 74 ILE CA C N S 75 ILE C C N N 76 ILE O O N N 77 ILE CB C N S 78 ILE CG1 C N N 79 ILE CG2 C N N 80 ILE CD1 C N N 81 ILE OXT O N N 82 ILE H H N N 83 ILE H2 H N N 84 ILE HA H N N 85 ILE HB H N N 86 ILE HG12 H N N 87 ILE HG13 H N N 88 ILE HG21 H N N 89 ILE HG22 H N N 90 ILE HG23 H N N 91 ILE HD11 H N N 92 ILE HD12 H N N 93 ILE HD13 H N N 94 ILE HXT H N N 95 LYS N N N N 96 LYS CA C N S 97 LYS C C N N 98 LYS O O N N 99 LYS CB C N N 100 LYS CG C N N 101 LYS CD C N N 102 LYS CE C N N 103 LYS NZ N N N 104 LYS OXT O N N 105 LYS H H N N 106 LYS H2 H N N 107 LYS HA H N N 108 LYS HB2 H N N 109 LYS HB3 H N N 110 LYS HG2 H N N 111 LYS HG3 H N N 112 LYS HD2 H N N 113 LYS HD3 H N N 114 LYS HE2 H N N 115 LYS HE3 H N N 116 LYS HZ1 H N N 117 LYS HZ2 H N N 118 LYS HZ3 H N N 119 LYS HXT H N N 120 PHE N N N N 121 PHE CA C N S 122 PHE C C N N 123 PHE O O N N 124 PHE CB C N N 125 PHE CG C Y N 126 PHE CD1 C Y N 127 PHE CD2 C Y N 128 PHE CE1 C Y N 129 PHE CE2 C Y N 130 PHE CZ C Y N 131 PHE OXT O N N 132 PHE H H N N 133 PHE H2 H N N 134 PHE HA H N N 135 PHE HB2 H N N 136 PHE HB3 H N N 137 PHE HD1 H N N 138 PHE HD2 H N N 139 PHE HE1 H N N 140 PHE HE2 H N N 141 PHE HZ H N N 142 PHE HXT H N N 143 PRO N N N N 144 PRO CA C N S 145 PRO C C N N 146 PRO O O N N 147 PRO CB C N N 148 PRO CG C N N 149 PRO CD C N N 150 PRO OXT O N N 151 PRO H H N N 152 PRO HA H N N 153 PRO HB2 H N N 154 PRO HB3 H N N 155 PRO HG2 H N N 156 PRO HG3 H N N 157 PRO HD2 H N N 158 PRO HD3 H N N 159 PRO HXT H N N 160 SER N N N N 161 SER CA C N S 162 SER C C N N 163 SER O O N N 164 SER CB C N N 165 SER OG O N N 166 SER OXT O N N 167 SER H H N N 168 SER H2 H N N 169 SER HA H N N 170 SER HB2 H N N 171 SER HB3 H N N 172 SER HG H N N 173 SER HXT H N N 174 THR N N N N 175 THR CA C N S 176 THR C C N N 177 THR O O N N 178 THR CB C N R 179 THR OG1 O N N 180 THR CG2 C N N 181 THR OXT O N N 182 THR H H N N 183 THR H2 H N N 184 THR HA H N N 185 THR HB H N N 186 THR HG1 H N N 187 THR HG21 H N N 188 THR HG22 H N N 189 THR HG23 H N N 190 THR HXT H N N 191 TYR N N N N 192 TYR CA C N S 193 TYR C C N N 194 TYR O O N N 195 TYR CB C N N 196 TYR CG C Y N 197 TYR CD1 C Y N 198 TYR CD2 C Y N 199 TYR CE1 C Y N 200 TYR CE2 C Y N 201 TYR CZ C Y N 202 TYR OH O N N 203 TYR OXT O N N 204 TYR H H N N 205 TYR H2 H N N 206 TYR HA H N N 207 TYR HB2 H N N 208 TYR HB3 H N N 209 TYR HD1 H N N 210 TYR HD2 H N N 211 TYR HE1 H N N 212 TYR HE2 H N N 213 TYR HH H N N 214 TYR HXT H N N 215 VAL N N N N 216 VAL CA C N S 217 VAL C C N N 218 VAL O O N N 219 VAL CB C N N 220 VAL CG1 C N N 221 VAL CG2 C N N 222 VAL OXT O N N 223 VAL H H N N 224 VAL H2 H N N 225 VAL HA H N N 226 VAL HB H N N 227 VAL HG11 H N N 228 VAL HG12 H N N 229 VAL HG13 H N N 230 VAL HG21 H N N 231 VAL HG22 H N N 232 VAL HG23 H N N 233 VAL HXT H N N 234 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 CYS N CA sing N N 29 CYS N H sing N N 30 CYS N H2 sing N N 31 CYS CA C sing N N 32 CYS CA CB sing N N 33 CYS CA HA sing N N 34 CYS C O doub N N 35 CYS C OXT sing N N 36 CYS CB SG sing N N 37 CYS CB HB2 sing N N 38 CYS CB HB3 sing N N 39 CYS SG HG sing N N 40 CYS OXT HXT sing N N 41 GLU N CA sing N N 42 GLU N H sing N N 43 GLU N H2 sing N N 44 GLU CA C sing N N 45 GLU CA CB sing N N 46 GLU CA HA sing N N 47 GLU C O doub N N 48 GLU C OXT sing N N 49 GLU CB CG sing N N 50 GLU CB HB2 sing N N 51 GLU CB HB3 sing N N 52 GLU CG CD sing N N 53 GLU CG HG2 sing N N 54 GLU CG HG3 sing N N 55 GLU CD OE1 doub N N 56 GLU CD OE2 sing N N 57 GLU OE2 HE2 sing N N 58 GLU OXT HXT sing N N 59 GLY N CA sing N N 60 GLY N H sing N N 61 GLY N H2 sing N N 62 GLY CA C sing N N 63 GLY CA HA2 sing N N 64 GLY CA HA3 sing N N 65 GLY C O doub N N 66 GLY C OXT sing N N 67 GLY OXT HXT sing N N 68 ILE N CA sing N N 69 ILE N H sing N N 70 ILE N H2 sing N N 71 ILE CA C sing N N 72 ILE CA CB sing N N 73 ILE CA HA sing N N 74 ILE C O doub N N 75 ILE C OXT sing N N 76 ILE CB CG1 sing N N 77 ILE CB CG2 sing N N 78 ILE CB HB sing N N 79 ILE CG1 CD1 sing N N 80 ILE CG1 HG12 sing N N 81 ILE CG1 HG13 sing N N 82 ILE CG2 HG21 sing N N 83 ILE CG2 HG22 sing N N 84 ILE CG2 HG23 sing N N 85 ILE CD1 HD11 sing N N 86 ILE CD1 HD12 sing N N 87 ILE CD1 HD13 sing N N 88 ILE OXT HXT sing N N 89 LYS N CA sing N N 90 LYS N H sing N N 91 LYS N H2 sing N N 92 LYS CA C sing N N 93 LYS CA CB sing N N 94 LYS CA HA sing N N 95 LYS C O doub N N 96 LYS C OXT sing N N 97 LYS CB CG sing N N 98 LYS CB HB2 sing N N 99 LYS CB HB3 sing N N 100 LYS CG CD sing N N 101 LYS CG HG2 sing N N 102 LYS CG HG3 sing N N 103 LYS CD CE sing N N 104 LYS CD HD2 sing N N 105 LYS CD HD3 sing N N 106 LYS CE NZ sing N N 107 LYS CE HE2 sing N N 108 LYS CE HE3 sing N N 109 LYS NZ HZ1 sing N N 110 LYS NZ HZ2 sing N N 111 LYS NZ HZ3 sing N N 112 LYS OXT HXT sing N N 113 PHE N CA sing N N 114 PHE N H sing N N 115 PHE N H2 sing N N 116 PHE CA C sing N N 117 PHE CA CB sing N N 118 PHE CA HA sing N N 119 PHE C O doub N N 120 PHE C OXT sing N N 121 PHE CB CG sing N N 122 PHE CB HB2 sing N N 123 PHE CB HB3 sing N N 124 PHE CG CD1 doub Y N 125 PHE CG CD2 sing Y N 126 PHE CD1 CE1 sing Y N 127 PHE CD1 HD1 sing N N 128 PHE CD2 CE2 doub Y N 129 PHE CD2 HD2 sing N N 130 PHE CE1 CZ doub Y N 131 PHE CE1 HE1 sing N N 132 PHE CE2 CZ sing Y N 133 PHE CE2 HE2 sing N N 134 PHE CZ HZ sing N N 135 PHE OXT HXT sing N N 136 PRO N CA sing N N 137 PRO N CD sing N N 138 PRO N H sing N N 139 PRO CA C sing N N 140 PRO CA CB sing N N 141 PRO CA HA sing N N 142 PRO C O doub N N 143 PRO C OXT sing N N 144 PRO CB CG sing N N 145 PRO CB HB2 sing N N 146 PRO CB HB3 sing N N 147 PRO CG CD sing N N 148 PRO CG HG2 sing N N 149 PRO CG HG3 sing N N 150 PRO CD HD2 sing N N 151 PRO CD HD3 sing N N 152 PRO OXT HXT sing N N 153 SER N CA sing N N 154 SER N H sing N N 155 SER N H2 sing N N 156 SER CA C sing N N 157 SER CA CB sing N N 158 SER CA HA sing N N 159 SER C O doub N N 160 SER C OXT sing N N 161 SER CB OG sing N N 162 SER CB HB2 sing N N 163 SER CB HB3 sing N N 164 SER OG HG sing N N 165 SER OXT HXT sing N N 166 THR N CA sing N N 167 THR N H sing N N 168 THR N H2 sing N N 169 THR CA C sing N N 170 THR CA CB sing N N 171 THR CA HA sing N N 172 THR C O doub N N 173 THR C OXT sing N N 174 THR CB OG1 sing N N 175 THR CB CG2 sing N N 176 THR CB HB sing N N 177 THR OG1 HG1 sing N N 178 THR CG2 HG21 sing N N 179 THR CG2 HG22 sing N N 180 THR CG2 HG23 sing N N 181 THR OXT HXT sing N N 182 TYR N CA sing N N 183 TYR N H sing N N 184 TYR N H2 sing N N 185 TYR CA C sing N N 186 TYR CA CB sing N N 187 TYR CA HA sing N N 188 TYR C O doub N N 189 TYR C OXT sing N N 190 TYR CB CG sing N N 191 TYR CB HB2 sing N N 192 TYR CB HB3 sing N N 193 TYR CG CD1 doub Y N 194 TYR CG CD2 sing Y N 195 TYR CD1 CE1 sing Y N 196 TYR CD1 HD1 sing N N 197 TYR CD2 CE2 doub Y N 198 TYR CD2 HD2 sing N N 199 TYR CE1 CZ doub Y N 200 TYR CE1 HE1 sing N N 201 TYR CE2 CZ sing Y N 202 TYR CE2 HE2 sing N N 203 TYR CZ OH sing N N 204 TYR OH HH sing N N 205 TYR OXT HXT sing N N 206 VAL N CA sing N N 207 VAL N H sing N N 208 VAL N H2 sing N N 209 VAL CA C sing N N 210 VAL CA CB sing N N 211 VAL CA HA sing N N 212 VAL C O doub N N 213 VAL C OXT sing N N 214 VAL CB CG1 sing N N 215 VAL CB CG2 sing N N 216 VAL CB HB sing N N 217 VAL CG1 HG11 sing N N 218 VAL CG1 HG12 sing N N 219 VAL CG1 HG13 sing N N 220 VAL CG2 HG21 sing N N 221 VAL CG2 HG22 sing N N 222 VAL CG2 HG23 sing N N 223 VAL OXT HXT sing N N 224 # _pdbx_audit_support.funding_organization 'Australian Research Council (ARC)' _pdbx_audit_support.country Australia _pdbx_audit_support.grant_number CE200100012 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III HD' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7RN3 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_