data_7RNS # _entry.id 7RNS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7RNS pdb_00007rns 10.2210/pdb7rns/pdb WWPDB D_1000258586 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-08-11 2 'Structure model' 1 1 2023-10-18 3 'Structure model' 1 2 2023-11-15 4 'Structure model' 1 3 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_chem_comp_atom.atom_id' 2 3 'Structure model' '_chem_comp_bond.atom_id_2' 3 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7RNS _pdbx_database_status.recvd_initial_deposition_date 2021-07-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Dai, S.' 1 ? 'Horton, J.R.' 2 ? 'Cheng, X.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'The Functional Analysis of a Major Tyrosine Phosphorylation Site on Actin' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Amelie, A.' 1 ? primary 'Dai, S.' 2 ? primary 'Shen, X.' 3 ? primary 'Horton, J.R.' 4 ? primary 'Zhang, X.' 5 ? primary 'Cheng, X.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Isoform 2 of Phosphatidylinositol 3-kinase regulatory subunit alpha' 13516.108 1 ? ? ? ? 2 polymer syn 'Actin, alpha skeletal muscle' 1063.975 1 ? ? 'UNP residues 52-60' ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 6 ? ? ? ? 4 water nat water 18.015 196 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 ;PI3-kinase regulatory subunit alpha,PI3K regulatory subunit alpha,PtdIns-3-kinase regulatory subunit alpha,Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha,PI3-kinase subunit p85-alpha,PtdIns-3-kinase regulatory subunit p85-alpha ; 2 Alpha-actin-1 # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSMGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLT FSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQD ; ;GSMGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLT FSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQD ; A ? 2 'polypeptide(L)' no yes 'KDS(PTR)VGDEA' KDSYVGDEA B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 1,2-ETHANEDIOL EDO 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 GLY n 1 5 MET n 1 6 ASN n 1 7 ASN n 1 8 ASN n 1 9 MET n 1 10 SER n 1 11 LEU n 1 12 GLN n 1 13 ASP n 1 14 ALA n 1 15 GLU n 1 16 TRP n 1 17 TYR n 1 18 TRP n 1 19 GLY n 1 20 ASP n 1 21 ILE n 1 22 SER n 1 23 ARG n 1 24 GLU n 1 25 GLU n 1 26 VAL n 1 27 ASN n 1 28 GLU n 1 29 LYS n 1 30 LEU n 1 31 ARG n 1 32 ASP n 1 33 THR n 1 34 ALA n 1 35 ASP n 1 36 GLY n 1 37 THR n 1 38 PHE n 1 39 LEU n 1 40 VAL n 1 41 ARG n 1 42 ASP n 1 43 ALA n 1 44 SER n 1 45 THR n 1 46 LYS n 1 47 MET n 1 48 HIS n 1 49 GLY n 1 50 ASP n 1 51 TYR n 1 52 THR n 1 53 LEU n 1 54 THR n 1 55 LEU n 1 56 ARG n 1 57 LYS n 1 58 GLY n 1 59 GLY n 1 60 ASN n 1 61 ASN n 1 62 LYS n 1 63 LEU n 1 64 ILE n 1 65 LYS n 1 66 ILE n 1 67 PHE n 1 68 HIS n 1 69 ARG n 1 70 ASP n 1 71 GLY n 1 72 LYS n 1 73 TYR n 1 74 GLY n 1 75 PHE n 1 76 SER n 1 77 ASP n 1 78 PRO n 1 79 LEU n 1 80 THR n 1 81 PHE n 1 82 SER n 1 83 SER n 1 84 VAL n 1 85 VAL n 1 86 GLU n 1 87 LEU n 1 88 ILE n 1 89 ASN n 1 90 HIS n 1 91 TYR n 1 92 ARG n 1 93 ASN n 1 94 GLU n 1 95 SER n 1 96 LEU n 1 97 ALA n 1 98 GLN n 1 99 TYR n 1 100 ASN n 1 101 PRO n 1 102 LYS n 1 103 LEU n 1 104 ASP n 1 105 VAL n 1 106 LYS n 1 107 LEU n 1 108 LEU n 1 109 TYR n 1 110 PRO n 1 111 VAL n 1 112 SER n 1 113 LYS n 1 114 TYR n 1 115 GLN n 1 116 GLN n 1 117 ASP n 2 1 LYS n 2 2 ASP n 2 3 SER n 2 4 PTR n 2 5 VAL n 2 6 GLY n 2 7 ASP n 2 8 GLU n 2 9 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 117 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PIK3R1, GRB1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 9 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 318 ? ? ? A . n A 1 2 SER 2 319 ? ? ? A . n A 1 3 MET 3 320 ? ? ? A . n A 1 4 GLY 4 321 ? ? ? A . n A 1 5 MET 5 322 ? ? ? A . n A 1 6 ASN 6 323 ? ? ? A . n A 1 7 ASN 7 324 ? ? ? A . n A 1 8 ASN 8 325 325 ASN ASN A . n A 1 9 MET 9 326 326 MET MET A . n A 1 10 SER 10 327 327 SER SER A . n A 1 11 LEU 11 328 328 LEU LEU A . n A 1 12 GLN 12 329 329 GLN GLN A . n A 1 13 ASP 13 330 330 ASP ASP A . n A 1 14 ALA 14 331 331 ALA ALA A . n A 1 15 GLU 15 332 332 GLU GLU A . n A 1 16 TRP 16 333 333 TRP TRP A . n A 1 17 TYR 17 334 334 TYR TYR A . n A 1 18 TRP 18 335 335 TRP TRP A . n A 1 19 GLY 19 336 336 GLY GLY A . n A 1 20 ASP 20 337 337 ASP ASP A . n A 1 21 ILE 21 338 338 ILE ILE A . n A 1 22 SER 22 339 339 SER SER A . n A 1 23 ARG 23 340 340 ARG ARG A . n A 1 24 GLU 24 341 341 GLU GLU A . n A 1 25 GLU 25 342 342 GLU GLU A . n A 1 26 VAL 26 343 343 VAL VAL A . n A 1 27 ASN 27 344 344 ASN ASN A . n A 1 28 GLU 28 345 345 GLU GLU A . n A 1 29 LYS 29 346 346 LYS LYS A . n A 1 30 LEU 30 347 347 LEU LEU A . n A 1 31 ARG 31 348 348 ARG ARG A . n A 1 32 ASP 32 349 349 ASP ASP A . n A 1 33 THR 33 350 350 THR THR A . n A 1 34 ALA 34 351 351 ALA ALA A . n A 1 35 ASP 35 352 352 ASP ASP A . n A 1 36 GLY 36 353 353 GLY GLY A . n A 1 37 THR 37 354 354 THR THR A . n A 1 38 PHE 38 355 355 PHE PHE A . n A 1 39 LEU 39 356 356 LEU LEU A . n A 1 40 VAL 40 357 357 VAL VAL A . n A 1 41 ARG 41 358 358 ARG ARG A . n A 1 42 ASP 42 359 359 ASP ASP A . n A 1 43 ALA 43 360 360 ALA ALA A . n A 1 44 SER 44 361 361 SER SER A . n A 1 45 THR 45 362 362 THR THR A . n A 1 46 LYS 46 363 363 LYS LYS A . n A 1 47 MET 47 364 364 MET MET A . n A 1 48 HIS 48 365 365 HIS HIS A . n A 1 49 GLY 49 366 366 GLY GLY A . n A 1 50 ASP 50 367 367 ASP ASP A . n A 1 51 TYR 51 368 368 TYR TYR A . n A 1 52 THR 52 369 369 THR THR A . n A 1 53 LEU 53 370 370 LEU LEU A . n A 1 54 THR 54 371 371 THR THR A . n A 1 55 LEU 55 372 372 LEU LEU A . n A 1 56 ARG 56 373 373 ARG ARG A . n A 1 57 LYS 57 374 374 LYS LYS A . n A 1 58 GLY 58 375 375 GLY GLY A . n A 1 59 GLY 59 376 376 GLY GLY A . n A 1 60 ASN 60 377 377 ASN ASN A . n A 1 61 ASN 61 378 378 ASN ASN A . n A 1 62 LYS 62 379 379 LYS LYS A . n A 1 63 LEU 63 380 380 LEU LEU A . n A 1 64 ILE 64 381 381 ILE ILE A . n A 1 65 LYS 65 382 382 LYS LYS A . n A 1 66 ILE 66 383 383 ILE ILE A . n A 1 67 PHE 67 384 384 PHE PHE A . n A 1 68 HIS 68 385 385 HIS HIS A . n A 1 69 ARG 69 386 386 ARG ARG A . n A 1 70 ASP 70 387 387 ASP ASP A . n A 1 71 GLY 71 388 388 GLY GLY A . n A 1 72 LYS 72 389 389 LYS LYS A . n A 1 73 TYR 73 390 390 TYR TYR A . n A 1 74 GLY 74 391 391 GLY GLY A . n A 1 75 PHE 75 392 392 PHE PHE A . n A 1 76 SER 76 393 393 SER SER A . n A 1 77 ASP 77 394 394 ASP ASP A . n A 1 78 PRO 78 395 395 PRO PRO A . n A 1 79 LEU 79 396 396 LEU LEU A . n A 1 80 THR 80 397 397 THR THR A . n A 1 81 PHE 81 398 398 PHE PHE A . n A 1 82 SER 82 399 399 SER SER A . n A 1 83 SER 83 400 400 SER SER A . n A 1 84 VAL 84 401 401 VAL VAL A . n A 1 85 VAL 85 402 402 VAL VAL A . n A 1 86 GLU 86 403 403 GLU GLU A . n A 1 87 LEU 87 404 404 LEU LEU A . n A 1 88 ILE 88 405 405 ILE ILE A . n A 1 89 ASN 89 406 406 ASN ASN A . n A 1 90 HIS 90 407 407 HIS HIS A . n A 1 91 TYR 91 408 408 TYR TYR A . n A 1 92 ARG 92 409 409 ARG ARG A . n A 1 93 ASN 93 410 410 ASN ASN A . n A 1 94 GLU 94 411 411 GLU GLU A . n A 1 95 SER 95 412 412 SER SER A . n A 1 96 LEU 96 413 413 LEU LEU A . n A 1 97 ALA 97 414 414 ALA ALA A . n A 1 98 GLN 98 415 415 GLN GLN A . n A 1 99 TYR 99 416 416 TYR TYR A . n A 1 100 ASN 100 417 417 ASN ASN A . n A 1 101 PRO 101 418 418 PRO PRO A . n A 1 102 LYS 102 419 419 LYS LYS A . n A 1 103 LEU 103 420 420 LEU LEU A . n A 1 104 ASP 104 421 421 ASP ASP A . n A 1 105 VAL 105 422 422 VAL VAL A . n A 1 106 LYS 106 423 423 LYS LYS A . n A 1 107 LEU 107 424 424 LEU LEU A . n A 1 108 LEU 108 425 425 LEU LEU A . n A 1 109 TYR 109 426 426 TYR TYR A . n A 1 110 PRO 110 427 427 PRO PRO A . n A 1 111 VAL 111 428 428 VAL VAL A . n A 1 112 SER 112 429 429 SER SER A . n A 1 113 LYS 113 430 430 LYS LYS A . n A 1 114 TYR 114 431 431 TYR TYR A . n A 1 115 GLN 115 432 432 GLN GLN A . n A 1 116 GLN 116 433 433 GLN GLN A . n A 1 117 ASP 117 434 434 ASP ASP A . n B 2 1 LYS 1 50 50 LYS LYS B . n B 2 2 ASP 2 51 51 ASP ASP B . n B 2 3 SER 3 52 52 SER SER B . n B 2 4 PTR 4 53 53 PTR PTR B . n B 2 5 VAL 5 54 54 VAL VAL B . n B 2 6 GLY 6 55 55 GLY GLY B . n B 2 7 ASP 7 56 56 ASP ASP B . n B 2 8 GLU 8 57 57 GLU GLU B . n B 2 9 ALA 9 58 58 ALA ALA B . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id PTR _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id PTR _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 EDO 1 501 1 EDO EDO A . D 3 EDO 1 502 2 EDO EDO A . E 3 EDO 1 503 3 EDO EDO A . F 3 EDO 1 504 4 EDO EDO A . G 3 EDO 1 505 5 EDO EDO A . H 3 EDO 1 506 6 EDO EDO A . I 4 HOH 1 601 59 HOH HOH A . I 4 HOH 2 602 205 HOH HOH A . I 4 HOH 3 603 192 HOH HOH A . I 4 HOH 4 604 139 HOH HOH A . I 4 HOH 5 605 112 HOH HOH A . I 4 HOH 6 606 203 HOH HOH A . I 4 HOH 7 607 180 HOH HOH A . I 4 HOH 8 608 102 HOH HOH A . I 4 HOH 9 609 99 HOH HOH A . I 4 HOH 10 610 165 HOH HOH A . I 4 HOH 11 611 177 HOH HOH A . I 4 HOH 12 612 32 HOH HOH A . I 4 HOH 13 613 90 HOH HOH A . I 4 HOH 14 614 166 HOH HOH A . I 4 HOH 15 615 23 HOH HOH A . I 4 HOH 16 616 61 HOH HOH A . I 4 HOH 17 617 138 HOH HOH A . I 4 HOH 18 618 204 HOH HOH A . I 4 HOH 19 619 121 HOH HOH A . I 4 HOH 20 620 170 HOH HOH A . I 4 HOH 21 621 25 HOH HOH A . I 4 HOH 22 622 100 HOH HOH A . I 4 HOH 23 623 115 HOH HOH A . I 4 HOH 24 624 184 HOH HOH A . I 4 HOH 25 625 15 HOH HOH A . I 4 HOH 26 626 126 HOH HOH A . I 4 HOH 27 627 114 HOH HOH A . I 4 HOH 28 628 72 HOH HOH A . I 4 HOH 29 629 176 HOH HOH A . I 4 HOH 30 630 107 HOH HOH A . I 4 HOH 31 631 18 HOH HOH A . I 4 HOH 32 632 36 HOH HOH A . I 4 HOH 33 633 111 HOH HOH A . I 4 HOH 34 634 163 HOH HOH A . I 4 HOH 35 635 167 HOH HOH A . I 4 HOH 36 636 182 HOH HOH A . I 4 HOH 37 637 198 HOH HOH A . I 4 HOH 38 638 95 HOH HOH A . I 4 HOH 39 639 48 HOH HOH A . I 4 HOH 40 640 159 HOH HOH A . I 4 HOH 41 641 57 HOH HOH A . I 4 HOH 42 642 12 HOH HOH A . I 4 HOH 43 643 92 HOH HOH A . I 4 HOH 44 644 155 HOH HOH A . I 4 HOH 45 645 97 HOH HOH A . I 4 HOH 46 646 76 HOH HOH A . I 4 HOH 47 647 87 HOH HOH A . I 4 HOH 48 648 181 HOH HOH A . I 4 HOH 49 649 131 HOH HOH A . I 4 HOH 50 650 30 HOH HOH A . I 4 HOH 51 651 202 HOH HOH A . I 4 HOH 52 652 16 HOH HOH A . I 4 HOH 53 653 66 HOH HOH A . I 4 HOH 54 654 148 HOH HOH A . I 4 HOH 55 655 4 HOH HOH A . I 4 HOH 56 656 125 HOH HOH A . I 4 HOH 57 657 89 HOH HOH A . I 4 HOH 58 658 54 HOH HOH A . I 4 HOH 59 659 171 HOH HOH A . I 4 HOH 60 660 56 HOH HOH A . I 4 HOH 61 661 51 HOH HOH A . I 4 HOH 62 662 86 HOH HOH A . I 4 HOH 63 663 21 HOH HOH A . I 4 HOH 64 664 124 HOH HOH A . I 4 HOH 65 665 58 HOH HOH A . I 4 HOH 66 666 17 HOH HOH A . I 4 HOH 67 667 117 HOH HOH A . I 4 HOH 68 668 40 HOH HOH A . I 4 HOH 69 669 120 HOH HOH A . I 4 HOH 70 670 83 HOH HOH A . I 4 HOH 71 671 5 HOH HOH A . I 4 HOH 72 672 62 HOH HOH A . I 4 HOH 73 673 31 HOH HOH A . I 4 HOH 74 674 43 HOH HOH A . I 4 HOH 75 675 3 HOH HOH A . I 4 HOH 76 676 13 HOH HOH A . I 4 HOH 77 677 22 HOH HOH A . I 4 HOH 78 678 85 HOH HOH A . I 4 HOH 79 679 52 HOH HOH A . I 4 HOH 80 680 116 HOH HOH A . I 4 HOH 81 681 64 HOH HOH A . I 4 HOH 82 682 123 HOH HOH A . I 4 HOH 83 683 71 HOH HOH A . I 4 HOH 84 684 45 HOH HOH A . I 4 HOH 85 685 20 HOH HOH A . I 4 HOH 86 686 143 HOH HOH A . I 4 HOH 87 687 93 HOH HOH A . I 4 HOH 88 688 130 HOH HOH A . I 4 HOH 89 689 53 HOH HOH A . I 4 HOH 90 690 84 HOH HOH A . I 4 HOH 91 691 119 HOH HOH A . I 4 HOH 92 692 174 HOH HOH A . I 4 HOH 93 693 113 HOH HOH A . I 4 HOH 94 694 67 HOH HOH A . I 4 HOH 95 695 41 HOH HOH A . I 4 HOH 96 696 178 HOH HOH A . I 4 HOH 97 697 6 HOH HOH A . I 4 HOH 98 698 132 HOH HOH A . I 4 HOH 99 699 2 HOH HOH A . I 4 HOH 100 700 70 HOH HOH A . I 4 HOH 101 701 28 HOH HOH A . I 4 HOH 102 702 39 HOH HOH A . I 4 HOH 103 703 63 HOH HOH A . I 4 HOH 104 704 7 HOH HOH A . I 4 HOH 105 705 200 HOH HOH A . I 4 HOH 106 706 8 HOH HOH A . I 4 HOH 107 707 110 HOH HOH A . I 4 HOH 108 708 46 HOH HOH A . I 4 HOH 109 709 94 HOH HOH A . I 4 HOH 110 710 35 HOH HOH A . I 4 HOH 111 711 188 HOH HOH A . I 4 HOH 112 712 82 HOH HOH A . I 4 HOH 113 713 122 HOH HOH A . I 4 HOH 114 714 44 HOH HOH A . I 4 HOH 115 715 118 HOH HOH A . I 4 HOH 116 716 34 HOH HOH A . I 4 HOH 117 717 134 HOH HOH A . I 4 HOH 118 718 108 HOH HOH A . I 4 HOH 119 719 47 HOH HOH A . I 4 HOH 120 720 128 HOH HOH A . I 4 HOH 121 721 29 HOH HOH A . I 4 HOH 122 722 189 HOH HOH A . I 4 HOH 123 723 136 HOH HOH A . I 4 HOH 124 724 50 HOH HOH A . I 4 HOH 125 725 149 HOH HOH A . I 4 HOH 126 726 91 HOH HOH A . I 4 HOH 127 727 49 HOH HOH A . I 4 HOH 128 728 156 HOH HOH A . I 4 HOH 129 729 152 HOH HOH A . I 4 HOH 130 730 81 HOH HOH A . I 4 HOH 131 731 109 HOH HOH A . I 4 HOH 132 732 183 HOH HOH A . I 4 HOH 133 733 27 HOH HOH A . I 4 HOH 134 734 88 HOH HOH A . I 4 HOH 135 735 24 HOH HOH A . I 4 HOH 136 736 164 HOH HOH A . I 4 HOH 137 737 133 HOH HOH A . I 4 HOH 138 738 151 HOH HOH A . I 4 HOH 139 739 73 HOH HOH A . I 4 HOH 140 740 42 HOH HOH A . I 4 HOH 141 741 127 HOH HOH A . I 4 HOH 142 742 65 HOH HOH A . I 4 HOH 143 743 150 HOH HOH A . I 4 HOH 144 744 162 HOH HOH A . I 4 HOH 145 745 186 HOH HOH A . I 4 HOH 146 746 185 HOH HOH A . I 4 HOH 147 747 157 HOH HOH A . I 4 HOH 148 748 78 HOH HOH A . I 4 HOH 149 749 38 HOH HOH A . I 4 HOH 150 750 194 HOH HOH A . I 4 HOH 151 751 206 HOH HOH A . I 4 HOH 152 752 173 HOH HOH A . I 4 HOH 153 753 140 HOH HOH A . I 4 HOH 154 754 98 HOH HOH A . I 4 HOH 155 755 79 HOH HOH A . I 4 HOH 156 756 195 HOH HOH A . I 4 HOH 157 757 74 HOH HOH A . I 4 HOH 158 758 207 HOH HOH A . I 4 HOH 159 759 135 HOH HOH A . I 4 HOH 160 760 26 HOH HOH A . I 4 HOH 161 761 105 HOH HOH A . I 4 HOH 162 762 14 HOH HOH A . I 4 HOH 163 763 129 HOH HOH A . I 4 HOH 164 764 144 HOH HOH A . I 4 HOH 165 765 96 HOH HOH A . I 4 HOH 166 766 104 HOH HOH A . I 4 HOH 167 767 153 HOH HOH A . I 4 HOH 168 768 77 HOH HOH A . I 4 HOH 169 769 175 HOH HOH A . I 4 HOH 170 770 141 HOH HOH A . I 4 HOH 171 771 160 HOH HOH A . I 4 HOH 172 772 168 HOH HOH A . I 4 HOH 173 773 142 HOH HOH A . J 4 HOH 1 101 179 HOH HOH B . J 4 HOH 2 102 19 HOH HOH B . J 4 HOH 3 103 191 HOH HOH B . J 4 HOH 4 104 60 HOH HOH B . J 4 HOH 5 105 145 HOH HOH B . J 4 HOH 6 106 37 HOH HOH B . J 4 HOH 7 107 10 HOH HOH B . J 4 HOH 8 108 147 HOH HOH B . J 4 HOH 9 109 11 HOH HOH B . J 4 HOH 10 110 69 HOH HOH B . J 4 HOH 11 111 187 HOH HOH B . J 4 HOH 12 112 146 HOH HOH B . J 4 HOH 13 113 9 HOH HOH B . J 4 HOH 14 114 154 HOH HOH B . J 4 HOH 15 115 1 HOH HOH B . J 4 HOH 16 116 137 HOH HOH B . J 4 HOH 17 117 106 HOH HOH B . J 4 HOH 18 118 33 HOH HOH B . J 4 HOH 19 119 172 HOH HOH B . J 4 HOH 20 120 193 HOH HOH B . J 4 HOH 21 121 161 HOH HOH B . J 4 HOH 22 122 80 HOH HOH B . J 4 HOH 23 123 55 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 433 ? CG ? A GLN 116 CG 2 1 Y 1 A GLN 433 ? CD ? A GLN 116 CD 3 1 Y 1 A GLN 433 ? OE1 ? A GLN 116 OE1 4 1 Y 1 A GLN 433 ? NE2 ? A GLN 116 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2_3874 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrysalisPro ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7RNS _cell.details ? _cell.formula_units_Z ? _cell.length_a 43.795 _cell.length_a_esd ? _cell.length_b 46.536 _cell.length_b_esd ? _cell.length_c 50.089 _cell.length_c_esd ? _cell.volume 102083.917 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7RNS _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7RNS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.75 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 29.73 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.05 M cadmium sulfate hydrate, 0.1 M HEPES, pH 7.5, 1.0 M sodium acetate trihydrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU HyPix-6000HE' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-08-30 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'SEALED TUBE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-003' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 7.76 _reflns.entry_id 7RNS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.14 _reflns.d_resolution_low 26.9 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 37579 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.981 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.14 _reflns_shell.d_res_low 1.18 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3027 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.512 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 11.69 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7RNS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.14 _refine.ls_d_res_low 26.90 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 37548 _refine.ls_number_reflns_R_free 1868 _refine.ls_number_reflns_R_work 35680 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.46 _refine.ls_percent_reflns_R_free 4.97 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1341 _refine.ls_R_factor_R_free 0.1470 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1334 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 2IUI' _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 15.5045 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1030 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.14 _refine_hist.d_res_low 26.90 _refine_hist.number_atoms_solvent 196 _refine_hist.number_atoms_total 1193 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 973 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0092 ? 1093 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.2138 ? 1477 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0831 ? 152 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0074 ? 194 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 26.3692 ? 414 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.14 1.17 . . 93 2051 73.35 . . . 0.3277 . 0.4206 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.17 1.20 . . 150 2684 97.35 . . . 0.3172 . 0.2585 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.20 1.24 . . 146 2716 98.32 . . . 0.1533 . 0.1463 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.24 1.28 . . 137 2773 99.08 . . . 0.1644 . 0.1243 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.28 1.33 . . 154 2764 99.45 . . . 0.1702 . 0.1209 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.33 1.40 . . 138 2784 99.66 . . . 0.1466 . 0.1173 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.40 1.47 . . 150 2788 99.73 . . . 0.1576 . 0.1092 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.47 1.56 . . 143 2808 99.93 . . . 0.1251 . 0.1046 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.56 1.68 . . 146 2816 100.00 . . . 0.1206 . 0.1110 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.68 1.85 . . 151 2815 100.00 . . . 0.1352 . 0.1125 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.85 2.12 . . 151 2827 100.00 . . . 0.1201 . 0.1127 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.12 2.67 . . 149 2862 100.00 . . . 0.1441 . 0.1260 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.67 26.90 . . 160 2992 99.68 . . . 0.1358 . 0.1389 . . . . . . . . . . . # _struct.entry_id 7RNS _struct.title 'nSH2 domain of p85-alpha subunit of phosphatidylinositol 3-kinase in complex with an actin peptide with phosphorylated tyrosine 53' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7RNS _struct_keywords.text 'phosphorylated tyrosine binding protein, actin peptide, PEPTIDE BINDING PROTEIN' _struct_keywords.pdbx_keywords 'PEPTIDE BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? I N N 4 ? J N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP P85A_HUMAN P27986 P27986-2 1 ;GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSS VVELINHYRNESLAQYNPKLDVKLLYPVSKYQQD ; 51 2 UNP ACTS_HUMAN P68133 ? 2 KDSYVGDEA 52 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7RNS A 4 ? 117 ? P27986 51 ? 164 ? 321 434 2 2 7RNS B 1 ? 9 ? P68133 52 ? 60 ? 50 58 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7RNS GLY A 1 ? UNP P27986 ? ? 'expression tag' 318 1 1 7RNS SER A 2 ? UNP P27986 ? ? 'expression tag' 319 2 1 7RNS MET A 3 ? UNP P27986 ? ? 'expression tag' 320 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1410 ? 1 MORE -3 ? 1 'SSA (A^2)' 7870 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 10 ? ALA A 14 ? SER A 327 ALA A 331 5 ? 5 HELX_P HELX_P2 AA2 SER A 22 ? ARG A 31 ? SER A 339 ARG A 348 1 ? 10 HELX_P HELX_P3 AA3 LYS A 46 ? GLY A 49 ? LYS A 363 GLY A 366 5 ? 4 HELX_P HELX_P4 AA4 SER A 83 ? GLU A 94 ? SER A 400 GLU A 411 1 ? 12 HELX_P HELX_P5 AA5 SER A 95 ? TYR A 99 ? SER A 412 TYR A 416 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B SER 3 C ? ? ? 1_555 B PTR 4 N ? ? B SER 52 B PTR 53 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale2 covale both ? B PTR 4 C ? ? ? 1_555 B VAL 5 N ? ? B PTR 53 B VAL 54 1_555 ? ? ? ? ? ? ? 1.329 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id PTR _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id 4 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id PTR _pdbx_modification_feature.auth_asym_id B _pdbx_modification_feature.auth_seq_id 53 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id TYR _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id PTR _pdbx_modification_feature.type Phosphorylation _pdbx_modification_feature.category 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 77 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 394 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 78 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 395 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.33 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 72 ? GLY A 74 ? LYS A 389 GLY A 391 AA1 2 ASN A 60 ? ARG A 69 ? ASN A 377 ARG A 386 AA1 3 TYR A 51 ? LYS A 57 ? TYR A 368 LYS A 374 AA1 4 THR A 37 ? ASP A 42 ? THR A 354 ASP A 359 AA1 5 TYR A 109 ? PRO A 110 ? TYR A 426 PRO A 427 AA2 1 LYS A 72 ? GLY A 74 ? LYS A 389 GLY A 391 AA2 2 ASN A 60 ? ARG A 69 ? ASN A 377 ARG A 386 AA2 3 ASP B 2 ? PTR B 4 ? ASP B 51 PTR B 53 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLY A 74 ? O GLY A 391 N PHE A 67 ? N PHE A 384 AA1 2 3 O ILE A 66 ? O ILE A 383 N TYR A 51 ? N TYR A 368 AA1 3 4 O THR A 52 ? O THR A 369 N ARG A 41 ? N ARG A 358 AA1 4 5 N PHE A 38 ? N PHE A 355 O TYR A 109 ? O TYR A 426 AA2 1 2 O GLY A 74 ? O GLY A 391 N PHE A 67 ? N PHE A 384 AA2 2 3 N LEU A 63 ? N LEU A 380 O SER B 3 ? O SER B 52 # _pdbx_entry_details.entry_id 7RNS _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG A SER 399 ? C O A HOH 604 ? ? 1.56 2 1 O A HOH 611 ? ? O A HOH 705 ? ? 1.70 3 1 O A HOH 609 ? ? O A HOH 646 ? ? 1.71 4 1 OD2 A ASP 434 ? ? O A HOH 601 ? ? 1.84 5 1 O A HOH 618 ? ? O A HOH 656 ? ? 1.89 6 1 O A HOH 653 ? ? O B HOH 101 ? ? 1.93 7 1 OE2 A GLU 342 ? A O A HOH 602 ? ? 1.95 8 1 O A HOH 603 ? ? O A HOH 734 ? ? 1.95 9 1 O1 A EDO 503 ? ? O A HOH 603 ? ? 1.96 10 1 OG A SER 399 ? C O A HOH 604 ? ? 2.02 11 1 O A HOH 729 ? ? O A HOH 759 ? ? 2.04 12 1 O A HOH 659 ? ? O A HOH 741 ? ? 2.04 13 1 O A HOH 715 ? ? O A HOH 771 ? ? 2.07 14 1 O A HOH 619 ? ? O A HOH 722 ? ? 2.09 15 1 O2 A EDO 505 ? ? O A HOH 605 ? ? 2.09 16 1 O A HOH 698 ? ? O A HOH 717 ? ? 2.12 17 1 NZ A LYS 346 ? ? O A HOH 606 ? ? 2.14 18 1 O A HOH 693 ? ? O A HOH 738 ? ? 2.16 19 1 O2 A EDO 501 ? ? O A HOH 607 ? ? 2.17 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 617 ? ? 1_555 O A HOH 737 ? ? 2_554 1.81 2 1 O A HOH 602 ? ? 1_555 O A HOH 701 ? ? 4_445 1.90 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 337 ? ? -87.47 31.09 2 1 HIS A 365 ? ? 70.39 -1.24 3 1 HIS A 365 ? ? 65.96 -1.24 4 1 LEU A 413 ? ? -66.84 1.41 5 1 LEU A 420 ? ? -115.71 66.42 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id PTR _pdbx_struct_mod_residue.label_seq_id 4 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id PTR _pdbx_struct_mod_residue.auth_seq_id 53 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details 'modified residue' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 318 ? A GLY 1 2 1 Y 1 A SER 319 ? A SER 2 3 1 Y 1 A MET 320 ? A MET 3 4 1 Y 1 A GLY 321 ? A GLY 4 5 1 Y 1 A MET 322 ? A MET 5 6 1 Y 1 A ASN 323 ? A ASN 6 7 1 Y 1 A ASN 324 ? A ASN 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 EDO C1 C N N 74 EDO O1 O N N 75 EDO C2 C N N 76 EDO O2 O N N 77 EDO H11 H N N 78 EDO H12 H N N 79 EDO HO1 H N N 80 EDO H21 H N N 81 EDO H22 H N N 82 EDO HO2 H N N 83 GLN N N N N 84 GLN CA C N S 85 GLN C C N N 86 GLN O O N N 87 GLN CB C N N 88 GLN CG C N N 89 GLN CD C N N 90 GLN OE1 O N N 91 GLN NE2 N N N 92 GLN OXT O N N 93 GLN H H N N 94 GLN H2 H N N 95 GLN HA H N N 96 GLN HB2 H N N 97 GLN HB3 H N N 98 GLN HG2 H N N 99 GLN HG3 H N N 100 GLN HE21 H N N 101 GLN HE22 H N N 102 GLN HXT H N N 103 GLU N N N N 104 GLU CA C N S 105 GLU C C N N 106 GLU O O N N 107 GLU CB C N N 108 GLU CG C N N 109 GLU CD C N N 110 GLU OE1 O N N 111 GLU OE2 O N N 112 GLU OXT O N N 113 GLU H H N N 114 GLU H2 H N N 115 GLU HA H N N 116 GLU HB2 H N N 117 GLU HB3 H N N 118 GLU HG2 H N N 119 GLU HG3 H N N 120 GLU HE2 H N N 121 GLU HXT H N N 122 GLY N N N N 123 GLY CA C N N 124 GLY C C N N 125 GLY O O N N 126 GLY OXT O N N 127 GLY H H N N 128 GLY H2 H N N 129 GLY HA2 H N N 130 GLY HA3 H N N 131 GLY HXT H N N 132 HIS N N N N 133 HIS CA C N S 134 HIS C C N N 135 HIS O O N N 136 HIS CB C N N 137 HIS CG C Y N 138 HIS ND1 N Y N 139 HIS CD2 C Y N 140 HIS CE1 C Y N 141 HIS NE2 N Y N 142 HIS OXT O N N 143 HIS H H N N 144 HIS H2 H N N 145 HIS HA H N N 146 HIS HB2 H N N 147 HIS HB3 H N N 148 HIS HD1 H N N 149 HIS HD2 H N N 150 HIS HE1 H N N 151 HIS HE2 H N N 152 HIS HXT H N N 153 HOH O O N N 154 HOH H1 H N N 155 HOH H2 H N N 156 ILE N N N N 157 ILE CA C N S 158 ILE C C N N 159 ILE O O N N 160 ILE CB C N S 161 ILE CG1 C N N 162 ILE CG2 C N N 163 ILE CD1 C N N 164 ILE OXT O N N 165 ILE H H N N 166 ILE H2 H N N 167 ILE HA H N N 168 ILE HB H N N 169 ILE HG12 H N N 170 ILE HG13 H N N 171 ILE HG21 H N N 172 ILE HG22 H N N 173 ILE HG23 H N N 174 ILE HD11 H N N 175 ILE HD12 H N N 176 ILE HD13 H N N 177 ILE HXT H N N 178 LEU N N N N 179 LEU CA C N S 180 LEU C C N N 181 LEU O O N N 182 LEU CB C N N 183 LEU CG C N N 184 LEU CD1 C N N 185 LEU CD2 C N N 186 LEU OXT O N N 187 LEU H H N N 188 LEU H2 H N N 189 LEU HA H N N 190 LEU HB2 H N N 191 LEU HB3 H N N 192 LEU HG H N N 193 LEU HD11 H N N 194 LEU HD12 H N N 195 LEU HD13 H N N 196 LEU HD21 H N N 197 LEU HD22 H N N 198 LEU HD23 H N N 199 LEU HXT H N N 200 LYS N N N N 201 LYS CA C N S 202 LYS C C N N 203 LYS O O N N 204 LYS CB C N N 205 LYS CG C N N 206 LYS CD C N N 207 LYS CE C N N 208 LYS NZ N N N 209 LYS OXT O N N 210 LYS H H N N 211 LYS H2 H N N 212 LYS HA H N N 213 LYS HB2 H N N 214 LYS HB3 H N N 215 LYS HG2 H N N 216 LYS HG3 H N N 217 LYS HD2 H N N 218 LYS HD3 H N N 219 LYS HE2 H N N 220 LYS HE3 H N N 221 LYS HZ1 H N N 222 LYS HZ2 H N N 223 LYS HZ3 H N N 224 LYS HXT H N N 225 MET N N N N 226 MET CA C N S 227 MET C C N N 228 MET O O N N 229 MET CB C N N 230 MET CG C N N 231 MET SD S N N 232 MET CE C N N 233 MET OXT O N N 234 MET H H N N 235 MET H2 H N N 236 MET HA H N N 237 MET HB2 H N N 238 MET HB3 H N N 239 MET HG2 H N N 240 MET HG3 H N N 241 MET HE1 H N N 242 MET HE2 H N N 243 MET HE3 H N N 244 MET HXT H N N 245 PHE N N N N 246 PHE CA C N S 247 PHE C C N N 248 PHE O O N N 249 PHE CB C N N 250 PHE CG C Y N 251 PHE CD1 C Y N 252 PHE CD2 C Y N 253 PHE CE1 C Y N 254 PHE CE2 C Y N 255 PHE CZ C Y N 256 PHE OXT O N N 257 PHE H H N N 258 PHE H2 H N N 259 PHE HA H N N 260 PHE HB2 H N N 261 PHE HB3 H N N 262 PHE HD1 H N N 263 PHE HD2 H N N 264 PHE HE1 H N N 265 PHE HE2 H N N 266 PHE HZ H N N 267 PHE HXT H N N 268 PRO N N N N 269 PRO CA C N S 270 PRO C C N N 271 PRO O O N N 272 PRO CB C N N 273 PRO CG C N N 274 PRO CD C N N 275 PRO OXT O N N 276 PRO H H N N 277 PRO HA H N N 278 PRO HB2 H N N 279 PRO HB3 H N N 280 PRO HG2 H N N 281 PRO HG3 H N N 282 PRO HD2 H N N 283 PRO HD3 H N N 284 PRO HXT H N N 285 PTR N N N N 286 PTR CA C N S 287 PTR C C N N 288 PTR O O N N 289 PTR OXT O N N 290 PTR CB C N N 291 PTR CG C Y N 292 PTR CD1 C Y N 293 PTR CD2 C Y N 294 PTR CE1 C Y N 295 PTR CE2 C Y N 296 PTR CZ C Y N 297 PTR OH O N N 298 PTR P P N N 299 PTR O1P O N N 300 PTR O2P O N N 301 PTR O3P O N N 302 PTR H H N N 303 PTR H2 H N N 304 PTR HA H N N 305 PTR HXT H N N 306 PTR HB2 H N N 307 PTR HB3 H N N 308 PTR HD1 H N N 309 PTR HD2 H N N 310 PTR HE1 H N N 311 PTR HE2 H N N 312 PTR HO2P H N N 313 PTR HO3P H N N 314 SER N N N N 315 SER CA C N S 316 SER C C N N 317 SER O O N N 318 SER CB C N N 319 SER OG O N N 320 SER OXT O N N 321 SER H H N N 322 SER H2 H N N 323 SER HA H N N 324 SER HB2 H N N 325 SER HB3 H N N 326 SER HG H N N 327 SER HXT H N N 328 THR N N N N 329 THR CA C N S 330 THR C C N N 331 THR O O N N 332 THR CB C N R 333 THR OG1 O N N 334 THR CG2 C N N 335 THR OXT O N N 336 THR H H N N 337 THR H2 H N N 338 THR HA H N N 339 THR HB H N N 340 THR HG1 H N N 341 THR HG21 H N N 342 THR HG22 H N N 343 THR HG23 H N N 344 THR HXT H N N 345 TRP N N N N 346 TRP CA C N S 347 TRP C C N N 348 TRP O O N N 349 TRP CB C N N 350 TRP CG C Y N 351 TRP CD1 C Y N 352 TRP CD2 C Y N 353 TRP NE1 N Y N 354 TRP CE2 C Y N 355 TRP CE3 C Y N 356 TRP CZ2 C Y N 357 TRP CZ3 C Y N 358 TRP CH2 C Y N 359 TRP OXT O N N 360 TRP H H N N 361 TRP H2 H N N 362 TRP HA H N N 363 TRP HB2 H N N 364 TRP HB3 H N N 365 TRP HD1 H N N 366 TRP HE1 H N N 367 TRP HE3 H N N 368 TRP HZ2 H N N 369 TRP HZ3 H N N 370 TRP HH2 H N N 371 TRP HXT H N N 372 TYR N N N N 373 TYR CA C N S 374 TYR C C N N 375 TYR O O N N 376 TYR CB C N N 377 TYR CG C Y N 378 TYR CD1 C Y N 379 TYR CD2 C Y N 380 TYR CE1 C Y N 381 TYR CE2 C Y N 382 TYR CZ C Y N 383 TYR OH O N N 384 TYR OXT O N N 385 TYR H H N N 386 TYR H2 H N N 387 TYR HA H N N 388 TYR HB2 H N N 389 TYR HB3 H N N 390 TYR HD1 H N N 391 TYR HD2 H N N 392 TYR HE1 H N N 393 TYR HE2 H N N 394 TYR HH H N N 395 TYR HXT H N N 396 VAL N N N N 397 VAL CA C N S 398 VAL C C N N 399 VAL O O N N 400 VAL CB C N N 401 VAL CG1 C N N 402 VAL CG2 C N N 403 VAL OXT O N N 404 VAL H H N N 405 VAL H2 H N N 406 VAL HA H N N 407 VAL HB H N N 408 VAL HG11 H N N 409 VAL HG12 H N N 410 VAL HG13 H N N 411 VAL HG21 H N N 412 VAL HG22 H N N 413 VAL HG23 H N N 414 VAL HXT H N N 415 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 EDO C1 O1 sing N N 70 EDO C1 C2 sing N N 71 EDO C1 H11 sing N N 72 EDO C1 H12 sing N N 73 EDO O1 HO1 sing N N 74 EDO C2 O2 sing N N 75 EDO C2 H21 sing N N 76 EDO C2 H22 sing N N 77 EDO O2 HO2 sing N N 78 GLN N CA sing N N 79 GLN N H sing N N 80 GLN N H2 sing N N 81 GLN CA C sing N N 82 GLN CA CB sing N N 83 GLN CA HA sing N N 84 GLN C O doub N N 85 GLN C OXT sing N N 86 GLN CB CG sing N N 87 GLN CB HB2 sing N N 88 GLN CB HB3 sing N N 89 GLN CG CD sing N N 90 GLN CG HG2 sing N N 91 GLN CG HG3 sing N N 92 GLN CD OE1 doub N N 93 GLN CD NE2 sing N N 94 GLN NE2 HE21 sing N N 95 GLN NE2 HE22 sing N N 96 GLN OXT HXT sing N N 97 GLU N CA sing N N 98 GLU N H sing N N 99 GLU N H2 sing N N 100 GLU CA C sing N N 101 GLU CA CB sing N N 102 GLU CA HA sing N N 103 GLU C O doub N N 104 GLU C OXT sing N N 105 GLU CB CG sing N N 106 GLU CB HB2 sing N N 107 GLU CB HB3 sing N N 108 GLU CG CD sing N N 109 GLU CG HG2 sing N N 110 GLU CG HG3 sing N N 111 GLU CD OE1 doub N N 112 GLU CD OE2 sing N N 113 GLU OE2 HE2 sing N N 114 GLU OXT HXT sing N N 115 GLY N CA sing N N 116 GLY N H sing N N 117 GLY N H2 sing N N 118 GLY CA C sing N N 119 GLY CA HA2 sing N N 120 GLY CA HA3 sing N N 121 GLY C O doub N N 122 GLY C OXT sing N N 123 GLY OXT HXT sing N N 124 HIS N CA sing N N 125 HIS N H sing N N 126 HIS N H2 sing N N 127 HIS CA C sing N N 128 HIS CA CB sing N N 129 HIS CA HA sing N N 130 HIS C O doub N N 131 HIS C OXT sing N N 132 HIS CB CG sing N N 133 HIS CB HB2 sing N N 134 HIS CB HB3 sing N N 135 HIS CG ND1 sing Y N 136 HIS CG CD2 doub Y N 137 HIS ND1 CE1 doub Y N 138 HIS ND1 HD1 sing N N 139 HIS CD2 NE2 sing Y N 140 HIS CD2 HD2 sing N N 141 HIS CE1 NE2 sing Y N 142 HIS CE1 HE1 sing N N 143 HIS NE2 HE2 sing N N 144 HIS OXT HXT sing N N 145 HOH O H1 sing N N 146 HOH O H2 sing N N 147 ILE N CA sing N N 148 ILE N H sing N N 149 ILE N H2 sing N N 150 ILE CA C sing N N 151 ILE CA CB sing N N 152 ILE CA HA sing N N 153 ILE C O doub N N 154 ILE C OXT sing N N 155 ILE CB CG1 sing N N 156 ILE CB CG2 sing N N 157 ILE CB HB sing N N 158 ILE CG1 CD1 sing N N 159 ILE CG1 HG12 sing N N 160 ILE CG1 HG13 sing N N 161 ILE CG2 HG21 sing N N 162 ILE CG2 HG22 sing N N 163 ILE CG2 HG23 sing N N 164 ILE CD1 HD11 sing N N 165 ILE CD1 HD12 sing N N 166 ILE CD1 HD13 sing N N 167 ILE OXT HXT sing N N 168 LEU N CA sing N N 169 LEU N H sing N N 170 LEU N H2 sing N N 171 LEU CA C sing N N 172 LEU CA CB sing N N 173 LEU CA HA sing N N 174 LEU C O doub N N 175 LEU C OXT sing N N 176 LEU CB CG sing N N 177 LEU CB HB2 sing N N 178 LEU CB HB3 sing N N 179 LEU CG CD1 sing N N 180 LEU CG CD2 sing N N 181 LEU CG HG sing N N 182 LEU CD1 HD11 sing N N 183 LEU CD1 HD12 sing N N 184 LEU CD1 HD13 sing N N 185 LEU CD2 HD21 sing N N 186 LEU CD2 HD22 sing N N 187 LEU CD2 HD23 sing N N 188 LEU OXT HXT sing N N 189 LYS N CA sing N N 190 LYS N H sing N N 191 LYS N H2 sing N N 192 LYS CA C sing N N 193 LYS CA CB sing N N 194 LYS CA HA sing N N 195 LYS C O doub N N 196 LYS C OXT sing N N 197 LYS CB CG sing N N 198 LYS CB HB2 sing N N 199 LYS CB HB3 sing N N 200 LYS CG CD sing N N 201 LYS CG HG2 sing N N 202 LYS CG HG3 sing N N 203 LYS CD CE sing N N 204 LYS CD HD2 sing N N 205 LYS CD HD3 sing N N 206 LYS CE NZ sing N N 207 LYS CE HE2 sing N N 208 LYS CE HE3 sing N N 209 LYS NZ HZ1 sing N N 210 LYS NZ HZ2 sing N N 211 LYS NZ HZ3 sing N N 212 LYS OXT HXT sing N N 213 MET N CA sing N N 214 MET N H sing N N 215 MET N H2 sing N N 216 MET CA C sing N N 217 MET CA CB sing N N 218 MET CA HA sing N N 219 MET C O doub N N 220 MET C OXT sing N N 221 MET CB CG sing N N 222 MET CB HB2 sing N N 223 MET CB HB3 sing N N 224 MET CG SD sing N N 225 MET CG HG2 sing N N 226 MET CG HG3 sing N N 227 MET SD CE sing N N 228 MET CE HE1 sing N N 229 MET CE HE2 sing N N 230 MET CE HE3 sing N N 231 MET OXT HXT sing N N 232 PHE N CA sing N N 233 PHE N H sing N N 234 PHE N H2 sing N N 235 PHE CA C sing N N 236 PHE CA CB sing N N 237 PHE CA HA sing N N 238 PHE C O doub N N 239 PHE C OXT sing N N 240 PHE CB CG sing N N 241 PHE CB HB2 sing N N 242 PHE CB HB3 sing N N 243 PHE CG CD1 doub Y N 244 PHE CG CD2 sing Y N 245 PHE CD1 CE1 sing Y N 246 PHE CD1 HD1 sing N N 247 PHE CD2 CE2 doub Y N 248 PHE CD2 HD2 sing N N 249 PHE CE1 CZ doub Y N 250 PHE CE1 HE1 sing N N 251 PHE CE2 CZ sing Y N 252 PHE CE2 HE2 sing N N 253 PHE CZ HZ sing N N 254 PHE OXT HXT sing N N 255 PRO N CA sing N N 256 PRO N CD sing N N 257 PRO N H sing N N 258 PRO CA C sing N N 259 PRO CA CB sing N N 260 PRO CA HA sing N N 261 PRO C O doub N N 262 PRO C OXT sing N N 263 PRO CB CG sing N N 264 PRO CB HB2 sing N N 265 PRO CB HB3 sing N N 266 PRO CG CD sing N N 267 PRO CG HG2 sing N N 268 PRO CG HG3 sing N N 269 PRO CD HD2 sing N N 270 PRO CD HD3 sing N N 271 PRO OXT HXT sing N N 272 PTR N CA sing N N 273 PTR N H sing N N 274 PTR N H2 sing N N 275 PTR CA C sing N N 276 PTR CA CB sing N N 277 PTR CA HA sing N N 278 PTR C O doub N N 279 PTR C OXT sing N N 280 PTR OXT HXT sing N N 281 PTR CB CG sing N N 282 PTR CB HB2 sing N N 283 PTR CB HB3 sing N N 284 PTR CG CD1 doub Y N 285 PTR CG CD2 sing Y N 286 PTR CD1 CE1 sing Y N 287 PTR CD1 HD1 sing N N 288 PTR CD2 CE2 doub Y N 289 PTR CD2 HD2 sing N N 290 PTR CE1 CZ doub Y N 291 PTR CE1 HE1 sing N N 292 PTR CE2 CZ sing Y N 293 PTR CE2 HE2 sing N N 294 PTR CZ OH sing N N 295 PTR OH P sing N N 296 PTR P O1P doub N N 297 PTR P O2P sing N N 298 PTR P O3P sing N N 299 PTR O2P HO2P sing N N 300 PTR O3P HO3P sing N N 301 SER N CA sing N N 302 SER N H sing N N 303 SER N H2 sing N N 304 SER CA C sing N N 305 SER CA CB sing N N 306 SER CA HA sing N N 307 SER C O doub N N 308 SER C OXT sing N N 309 SER CB OG sing N N 310 SER CB HB2 sing N N 311 SER CB HB3 sing N N 312 SER OG HG sing N N 313 SER OXT HXT sing N N 314 THR N CA sing N N 315 THR N H sing N N 316 THR N H2 sing N N 317 THR CA C sing N N 318 THR CA CB sing N N 319 THR CA HA sing N N 320 THR C O doub N N 321 THR C OXT sing N N 322 THR CB OG1 sing N N 323 THR CB CG2 sing N N 324 THR CB HB sing N N 325 THR OG1 HG1 sing N N 326 THR CG2 HG21 sing N N 327 THR CG2 HG22 sing N N 328 THR CG2 HG23 sing N N 329 THR OXT HXT sing N N 330 TRP N CA sing N N 331 TRP N H sing N N 332 TRP N H2 sing N N 333 TRP CA C sing N N 334 TRP CA CB sing N N 335 TRP CA HA sing N N 336 TRP C O doub N N 337 TRP C OXT sing N N 338 TRP CB CG sing N N 339 TRP CB HB2 sing N N 340 TRP CB HB3 sing N N 341 TRP CG CD1 doub Y N 342 TRP CG CD2 sing Y N 343 TRP CD1 NE1 sing Y N 344 TRP CD1 HD1 sing N N 345 TRP CD2 CE2 doub Y N 346 TRP CD2 CE3 sing Y N 347 TRP NE1 CE2 sing Y N 348 TRP NE1 HE1 sing N N 349 TRP CE2 CZ2 sing Y N 350 TRP CE3 CZ3 doub Y N 351 TRP CE3 HE3 sing N N 352 TRP CZ2 CH2 doub Y N 353 TRP CZ2 HZ2 sing N N 354 TRP CZ3 CH2 sing Y N 355 TRP CZ3 HZ3 sing N N 356 TRP CH2 HH2 sing N N 357 TRP OXT HXT sing N N 358 TYR N CA sing N N 359 TYR N H sing N N 360 TYR N H2 sing N N 361 TYR CA C sing N N 362 TYR CA CB sing N N 363 TYR CA HA sing N N 364 TYR C O doub N N 365 TYR C OXT sing N N 366 TYR CB CG sing N N 367 TYR CB HB2 sing N N 368 TYR CB HB3 sing N N 369 TYR CG CD1 doub Y N 370 TYR CG CD2 sing Y N 371 TYR CD1 CE1 sing Y N 372 TYR CD1 HD1 sing N N 373 TYR CD2 CE2 doub Y N 374 TYR CD2 HD2 sing N N 375 TYR CE1 CZ doub Y N 376 TYR CE1 HE1 sing N N 377 TYR CE2 CZ sing Y N 378 TYR CE2 HE2 sing N N 379 TYR CZ OH sing N N 380 TYR OH HH sing N N 381 TYR OXT HXT sing N N 382 VAL N CA sing N N 383 VAL N H sing N N 384 VAL N H2 sing N N 385 VAL CA C sing N N 386 VAL CA CB sing N N 387 VAL CA HA sing N N 388 VAL C O doub N N 389 VAL C OXT sing N N 390 VAL CB CG1 sing N N 391 VAL CB CG2 sing N N 392 VAL CB HB sing N N 393 VAL CG1 HG11 sing N N 394 VAL CG1 HG12 sing N N 395 VAL CG1 HG13 sing N N 396 VAL CG2 HG21 sing N N 397 VAL CG2 HG22 sing N N 398 VAL CG2 HG23 sing N N 399 VAL OXT HXT sing N N 400 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM049245-23 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2IUI _pdbx_initial_refinement_model.details 'PDB entry 2IUI' # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 7RNS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.022834 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021489 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019964 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #