data_7RUP # _entry.id 7RUP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7RUP pdb_00007rup 10.2210/pdb7rup/pdb WWPDB D_1000259089 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7RUP _pdbx_database_status.recvd_initial_deposition_date 2021-08-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sobti, M.' 1 0000-0001-7086-3467 'Mead, B.J.' 2 ? 'Igreja, C.' 3 0000-0003-3563-1788 'Stewart, A.G.' 4 0000-0002-2070-6030 'Christie, M.' 5 0000-0002-0955-665X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Rna _citation.journal_id_ASTM RNARFU _citation.journal_id_CSD 2122 _citation.journal_id_ISSN 1469-9001 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 724 _citation.page_last 734 _citation.title 'Molecular basis for GIGYF-TNRC6 complex assembly.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1261/rna.079596.123 _citation.pdbx_database_id_PubMed 36854607 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sobti, M.' 1 ? primary 'Mead, B.J.' 2 ? primary 'Stewart, A.G.' 3 ? primary 'Igreja, C.' 4 ? primary 'Christie, M.' 5 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7RUP _cell.details ? _cell.formula_units_Z ? _cell.length_a 32.779 _cell.length_a_esd ? _cell.length_b 38.319 _cell.length_b_esd ? _cell.length_c 62.064 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7RUP _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GRB10-interacting GYF protein 2' 8468.629 1 ? ? ? ? 2 polymer man 'Trinucleotide repeat-containing gene 6A protein' 1461.643 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 96 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'PERQ amino acid-rich with GYF domain-containing protein 2,Trinucleotide repeat-containing gene 15 protein' 2 'CAG repeat protein 26,EMSY interactor protein,GW182 autoantigen,Protein GW1,Glycine-tryptophan protein of 182 kDa' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes 'GPLEMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRA(CSO)DESFQPLGDIMKMWGRVPFSPGPA' GPLEMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIMKMWGRVPFSPGPA A ? 2 'polypeptide(L)' no no GPLGSAPSRPPPGLTG GPLGSAPSRPPPGLTG B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLU n 1 5 MET n 1 6 HIS n 1 7 GLU n 1 8 ALA n 1 9 MET n 1 10 GLN n 1 11 LYS n 1 12 TRP n 1 13 TYR n 1 14 TYR n 1 15 LYS n 1 16 ASP n 1 17 PRO n 1 18 GLN n 1 19 GLY n 1 20 GLU n 1 21 ILE n 1 22 GLN n 1 23 GLY n 1 24 PRO n 1 25 PHE n 1 26 ASN n 1 27 ASN n 1 28 GLN n 1 29 GLU n 1 30 MET n 1 31 ALA n 1 32 GLU n 1 33 TRP n 1 34 PHE n 1 35 GLN n 1 36 ALA n 1 37 GLY n 1 38 TYR n 1 39 PHE n 1 40 THR n 1 41 MET n 1 42 SER n 1 43 LEU n 1 44 LEU n 1 45 VAL n 1 46 LYS n 1 47 ARG n 1 48 ALA n 1 49 CSO n 1 50 ASP n 1 51 GLU n 1 52 SER n 1 53 PHE n 1 54 GLN n 1 55 PRO n 1 56 LEU n 1 57 GLY n 1 58 ASP n 1 59 ILE n 1 60 MET n 1 61 LYS n 1 62 MET n 1 63 TRP n 1 64 GLY n 1 65 ARG n 1 66 VAL n 1 67 PRO n 1 68 PHE n 1 69 SER n 1 70 PRO n 1 71 GLY n 1 72 PRO n 1 73 ALA n 2 1 GLY n 2 2 PRO n 2 3 LEU n 2 4 GLY n 2 5 SER n 2 6 ALA n 2 7 PRO n 2 8 SER n 2 9 ARG n 2 10 PRO n 2 11 PRO n 2 12 PRO n 2 13 GLY n 2 14 LEU n 2 15 THR n 2 16 GLY n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 73 Human ? 'GIGYF2, KIAA0642, PERQ2, TNRC15' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 16 Human ? 'TNRC6A, CAGH26, KIAA1460, TNRC6' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP GGYF2_HUMAN Q6Y7W6 ? 1 MHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIMKMWGRVPFSPGPA 529 2 UNP TNR6A_HUMAN Q8NDV7 ? 2 APSRPPPGLTG 1729 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7RUP A 5 ? 73 ? Q6Y7W6 529 ? 597 ? 529 597 2 2 7RUP B 6 ? 16 ? Q8NDV7 1729 ? 1739 ? 1476 1486 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7RUP GLY A 1 ? UNP Q6Y7W6 ? ? 'expression tag' 525 1 1 7RUP PRO A 2 ? UNP Q6Y7W6 ? ? 'expression tag' 526 2 1 7RUP LEU A 3 ? UNP Q6Y7W6 ? ? 'expression tag' 527 3 1 7RUP GLU A 4 ? UNP Q6Y7W6 ? ? 'expression tag' 528 4 2 7RUP GLY B 1 ? UNP Q8NDV7 ? ? 'expression tag' 1471 5 2 7RUP PRO B 2 ? UNP Q8NDV7 ? ? 'expression tag' 1472 6 2 7RUP LEU B 3 ? UNP Q8NDV7 ? ? 'expression tag' 1473 7 2 7RUP GLY B 4 ? UNP Q8NDV7 ? ? 'expression tag' 1474 8 2 7RUP SER B 5 ? UNP Q8NDV7 ? ? 'expression tag' 1475 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S' 137.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7RUP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.96 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 37.33 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.0-1.4 M Na/K phosphate' _exptl_crystal_grow.pdbx_pH_range 7.4-7.8 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-04-26 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9537 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7RUP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.23 _reflns.d_resolution_low 19.43 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23420 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.23 _reflns_shell.d_res_low 1.25 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1130 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 11.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.778 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7RUP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.230 _refine.ls_d_res_low 19.425 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23369 _refine.ls_number_reflns_R_free 1111 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.99 _refine.ls_percent_reflns_R_free 4.75 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1533 _refine.ls_R_factor_R_free 0.1769 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1521 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3FMA _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 16.12 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.11 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.230 _refine_hist.d_res_low 19.425 _refine_hist.number_atoms_solvent 96 _refine_hist.number_atoms_total 673 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 572 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.015 ? 625 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.389 ? 854 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 3.707 ? 464 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.100 ? 78 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.013 ? 115 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.2300 1.2860 . . 129 2731 100.00 . . . 0.2149 . 0.1785 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2860 1.3538 . . 114 2763 100.00 . . . 0.1754 . 0.1587 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3538 1.4386 . . 156 2728 100.00 . . . 0.1989 . 0.1385 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4386 1.5496 . . 144 2738 100.00 . . . 0.1667 . 0.1277 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5496 1.7054 . . 133 2762 100.00 . . . 0.1665 . 0.1233 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7054 1.9520 . . 141 2787 100.00 . . . 0.1677 . 0.1301 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9520 2.4586 . . 155 2791 100.00 . . . 0.1731 . 0.1475 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4586 19.425 . . 139 2958 100.00 . . . 0.1797 . 0.1710 . . . . . . . . . . . # _struct.entry_id 7RUP _struct.title 'Structure of the human GIGYF2-TNRC6A complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7RUP _struct_keywords.text 'miRNA, 4EHP, translational repression, GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 26 ? GLY A 37 ? ASN A 550 GLY A 561 1 ? 12 HELX_P HELX_P2 AA2 LEU A 56 ? GLY A 64 ? LEU A 580 GLY A 588 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 48 C ? ? ? 1_555 A CSO 49 N ? ? A ALA 572 A CSO 573 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale2 covale both ? A CSO 49 C ? ? ? 1_555 A ASP 50 N ? ? A CSO 573 A ASP 574 1_555 ? ? ? ? ? ? ? 1.328 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 23 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 547 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 24 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 548 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 6.10 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 21 ? PHE A 25 ? ILE A 545 PHE A 549 AA1 2 TRP A 12 ? LYS A 15 ? TRP A 536 LYS A 539 AA1 3 LEU A 44 ? ARG A 47 ? LEU A 568 ARG A 571 AA1 4 GLN A 54 ? PRO A 55 ? GLN A 578 PRO A 579 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLN A 22 ? O GLN A 546 N TYR A 14 ? N TYR A 538 AA1 2 3 N TYR A 13 ? N TYR A 537 O LYS A 46 ? O LYS A 570 AA1 3 4 N VAL A 45 ? N VAL A 569 O GLN A 54 ? O GLN A 578 # _atom_sites.entry_id 7RUP _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.030507 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026097 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016112 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 525 ? ? ? A . n A 1 2 PRO 2 526 ? ? ? A . n A 1 3 LEU 3 527 ? ? ? A . n A 1 4 GLU 4 528 ? ? ? A . n A 1 5 MET 5 529 ? ? ? A . n A 1 6 HIS 6 530 ? ? ? A . n A 1 7 GLU 7 531 ? ? ? A . n A 1 8 ALA 8 532 ? ? ? A . n A 1 9 MET 9 533 ? ? ? A . n A 1 10 GLN 10 534 534 GLN GLN A . n A 1 11 LYS 11 535 535 LYS LYS A . n A 1 12 TRP 12 536 536 TRP TRP A . n A 1 13 TYR 13 537 537 TYR TYR A . n A 1 14 TYR 14 538 538 TYR TYR A . n A 1 15 LYS 15 539 539 LYS LYS A . n A 1 16 ASP 16 540 540 ASP ASP A . n A 1 17 PRO 17 541 541 PRO PRO A . n A 1 18 GLN 18 542 542 GLN GLN A . n A 1 19 GLY 19 543 543 GLY GLY A . n A 1 20 GLU 20 544 544 GLU GLU A . n A 1 21 ILE 21 545 545 ILE ILE A . n A 1 22 GLN 22 546 546 GLN GLN A . n A 1 23 GLY 23 547 547 GLY GLY A . n A 1 24 PRO 24 548 548 PRO PRO A . n A 1 25 PHE 25 549 549 PHE PHE A . n A 1 26 ASN 26 550 550 ASN ASN A . n A 1 27 ASN 27 551 551 ASN ASN A . n A 1 28 GLN 28 552 552 GLN GLN A . n A 1 29 GLU 29 553 553 GLU GLU A . n A 1 30 MET 30 554 554 MET MET A . n A 1 31 ALA 31 555 555 ALA ALA A . n A 1 32 GLU 32 556 556 GLU GLU A . n A 1 33 TRP 33 557 557 TRP TRP A . n A 1 34 PHE 34 558 558 PHE PHE A . n A 1 35 GLN 35 559 559 GLN GLN A . n A 1 36 ALA 36 560 560 ALA ALA A . n A 1 37 GLY 37 561 561 GLY GLY A . n A 1 38 TYR 38 562 562 TYR TYR A . n A 1 39 PHE 39 563 563 PHE PHE A . n A 1 40 THR 40 564 564 THR THR A . n A 1 41 MET 41 565 565 MET MET A . n A 1 42 SER 42 566 566 SER SER A . n A 1 43 LEU 43 567 567 LEU LEU A . n A 1 44 LEU 44 568 568 LEU LEU A . n A 1 45 VAL 45 569 569 VAL VAL A . n A 1 46 LYS 46 570 570 LYS LYS A . n A 1 47 ARG 47 571 571 ARG ARG A . n A 1 48 ALA 48 572 572 ALA ALA A . n A 1 49 CSO 49 573 573 CSO CSO A . n A 1 50 ASP 50 574 574 ASP ASP A . n A 1 51 GLU 51 575 575 GLU GLU A . n A 1 52 SER 52 576 576 SER SER A . n A 1 53 PHE 53 577 577 PHE PHE A . n A 1 54 GLN 54 578 578 GLN GLN A . n A 1 55 PRO 55 579 579 PRO PRO A . n A 1 56 LEU 56 580 580 LEU LEU A . n A 1 57 GLY 57 581 581 GLY GLY A . n A 1 58 ASP 58 582 582 ASP ASP A . n A 1 59 ILE 59 583 583 ILE ILE A . n A 1 60 MET 60 584 584 MET MET A . n A 1 61 LYS 61 585 585 LYS LYS A . n A 1 62 MET 62 586 586 MET MET A . n A 1 63 TRP 63 587 587 TRP TRP A . n A 1 64 GLY 64 588 588 GLY GLY A . n A 1 65 ARG 65 589 589 ARG ARG A . n A 1 66 VAL 66 590 590 VAL VAL A . n A 1 67 PRO 67 591 591 PRO PRO A . n A 1 68 PHE 68 592 592 PHE PHE A . n A 1 69 SER 69 593 593 SER SER A . n A 1 70 PRO 70 594 594 PRO PRO A . n A 1 71 GLY 71 595 595 GLY GLY A . n A 1 72 PRO 72 596 596 PRO PRO A . n A 1 73 ALA 73 597 ? ? ? A . n B 2 1 GLY 1 1471 ? ? ? B . n B 2 2 PRO 2 1472 ? ? ? B . n B 2 3 LEU 3 1473 ? ? ? B . n B 2 4 GLY 4 1474 ? ? ? B . n B 2 5 SER 5 1475 ? ? ? B . n B 2 6 ALA 6 1476 ? ? ? B . n B 2 7 PRO 7 1477 ? ? ? B . n B 2 8 SER 8 1478 1478 SER SER B . n B 2 9 ARG 9 1479 1479 ARG ARG B . n B 2 10 PRO 10 1480 1480 PRO PRO B . n B 2 11 PRO 11 1481 1481 PRO PRO B . n B 2 12 PRO 12 1482 1482 PRO PRO B . n B 2 13 GLY 13 1483 1483 GLY GLY B . n B 2 14 LEU 14 1484 1484 LEU LEU B . n B 2 15 THR 15 1485 1485 THR THR B . n B 2 16 GLY 16 1486 1486 GLY GLY B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 SO4 1 601 725 SO4 SO4 A . D 4 HOH 1 701 91 HOH HOH A . D 4 HOH 2 702 73 HOH HOH A . D 4 HOH 3 703 37 HOH HOH A . D 4 HOH 4 704 24 HOH HOH A . D 4 HOH 5 705 98 HOH HOH A . D 4 HOH 6 706 11 HOH HOH A . D 4 HOH 7 707 70 HOH HOH A . D 4 HOH 8 708 40 HOH HOH A . D 4 HOH 9 709 1 HOH HOH A . D 4 HOH 10 710 17 HOH HOH A . D 4 HOH 11 711 2 HOH HOH A . D 4 HOH 12 712 38 HOH HOH A . D 4 HOH 13 713 50 HOH HOH A . D 4 HOH 14 714 3 HOH HOH A . D 4 HOH 15 715 29 HOH HOH A . D 4 HOH 16 716 117 HOH HOH A . D 4 HOH 17 717 9 HOH HOH A . D 4 HOH 18 718 116 HOH HOH A . D 4 HOH 19 719 16 HOH HOH A . D 4 HOH 20 720 12 HOH HOH A . D 4 HOH 21 721 30 HOH HOH A . D 4 HOH 22 722 6 HOH HOH A . D 4 HOH 23 723 23 HOH HOH A . D 4 HOH 24 724 7 HOH HOH A . D 4 HOH 25 725 25 HOH HOH A . D 4 HOH 26 726 31 HOH HOH A . D 4 HOH 27 727 75 HOH HOH A . D 4 HOH 28 728 15 HOH HOH A . D 4 HOH 29 729 78 HOH HOH A . D 4 HOH 30 730 97 HOH HOH A . D 4 HOH 31 731 22 HOH HOH A . D 4 HOH 32 732 65 HOH HOH A . D 4 HOH 33 733 64 HOH HOH A . D 4 HOH 34 734 20 HOH HOH A . D 4 HOH 35 735 56 HOH HOH A . D 4 HOH 36 736 49 HOH HOH A . D 4 HOH 37 737 100 HOH HOH A . D 4 HOH 38 738 69 HOH HOH A . D 4 HOH 39 739 35 HOH HOH A . D 4 HOH 40 740 58 HOH HOH A . D 4 HOH 41 741 59 HOH HOH A . D 4 HOH 42 742 41 HOH HOH A . D 4 HOH 43 743 87 HOH HOH A . D 4 HOH 44 744 52 HOH HOH A . D 4 HOH 45 745 62 HOH HOH A . D 4 HOH 46 746 14 HOH HOH A . D 4 HOH 47 747 54 HOH HOH A . D 4 HOH 48 748 94 HOH HOH A . D 4 HOH 49 749 5 HOH HOH A . D 4 HOH 50 750 68 HOH HOH A . D 4 HOH 51 751 86 HOH HOH A . D 4 HOH 52 752 88 HOH HOH A . D 4 HOH 53 753 18 HOH HOH A . D 4 HOH 54 754 77 HOH HOH A . D 4 HOH 55 755 21 HOH HOH A . D 4 HOH 56 756 19 HOH HOH A . D 4 HOH 57 757 43 HOH HOH A . D 4 HOH 58 758 67 HOH HOH A . D 4 HOH 59 759 4 HOH HOH A . D 4 HOH 60 760 82 HOH HOH A . D 4 HOH 61 761 109 HOH HOH A . D 4 HOH 62 762 72 HOH HOH A . D 4 HOH 63 763 66 HOH HOH A . D 4 HOH 64 764 63 HOH HOH A . D 4 HOH 65 765 55 HOH HOH A . D 4 HOH 66 766 95 HOH HOH A . D 4 HOH 67 767 10 HOH HOH A . D 4 HOH 68 768 45 HOH HOH A . D 4 HOH 69 769 106 HOH HOH A . D 4 HOH 70 770 71 HOH HOH A . D 4 HOH 71 771 81 HOH HOH A . D 4 HOH 72 772 74 HOH HOH A . D 4 HOH 73 773 36 HOH HOH A . D 4 HOH 74 774 80 HOH HOH A . D 4 HOH 75 775 93 HOH HOH A . D 4 HOH 76 776 103 HOH HOH A . D 4 HOH 77 777 51 HOH HOH A . D 4 HOH 78 778 111 HOH HOH A . E 4 HOH 1 1501 83 HOH HOH B . E 4 HOH 2 1502 8 HOH HOH B . E 4 HOH 3 1503 34 HOH HOH B . E 4 HOH 4 1504 57 HOH HOH B . E 4 HOH 5 1505 48 HOH HOH B . E 4 HOH 6 1506 61 HOH HOH B . E 4 HOH 7 1507 33 HOH HOH B . E 4 HOH 8 1508 125 HOH HOH B . E 4 HOH 9 1509 27 HOH HOH B . E 4 HOH 10 1510 123 HOH HOH B . E 4 HOH 11 1511 60 HOH HOH B . E 4 HOH 12 1512 47 HOH HOH B . E 4 HOH 13 1513 112 HOH HOH B . E 4 HOH 14 1514 92 HOH HOH B . E 4 HOH 15 1515 32 HOH HOH B . E 4 HOH 16 1516 126 HOH HOH B . E 4 HOH 17 1517 96 HOH HOH B . E 4 HOH 18 1518 28 HOH HOH B . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CSO _pdbx_struct_mod_residue.label_seq_id 49 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CSO _pdbx_struct_mod_residue.auth_seq_id 573 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 860 ? 1 MORE -15 ? 1 'SSA (A^2)' 4730 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-08-24 2 'Structure model' 1 1 2023-03-15 3 'Structure model' 1 2 2023-05-31 4 'Structure model' 1 3 2023-10-25 5 'Structure model' 1 4 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' pdbx_initial_refinement_model 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.identifier_ORCID' 11 2 'Structure model' '_citation_author.name' 12 3 'Structure model' '_citation.journal_volume' 13 3 'Structure model' '_citation.page_first' 14 3 'Structure model' '_citation.page_last' 15 3 'Structure model' '_citation_author.identifier_ORCID' 16 5 'Structure model' '_chem_comp_atom.atom_id' 17 5 'Structure model' '_chem_comp_bond.atom_id_2' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.14_3260: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 7RUP _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 727 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 737 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.10 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 534 ? CG ? A GLN 10 CG 2 1 Y 1 A GLN 534 ? CD ? A GLN 10 CD 3 1 Y 1 A GLN 534 ? OE1 ? A GLN 10 OE1 4 1 Y 1 A GLN 534 ? NE2 ? A GLN 10 NE2 5 1 Y 1 A LYS 535 ? CG ? A LYS 11 CG 6 1 Y 1 A LYS 535 ? CD ? A LYS 11 CD 7 1 Y 1 A LYS 535 ? CE ? A LYS 11 CE 8 1 Y 1 A LYS 535 ? NZ ? A LYS 11 NZ 9 1 Y 1 A LYS 585 ? CE ? A LYS 61 CE 10 1 Y 1 A LYS 585 ? NZ ? A LYS 61 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 525 ? A GLY 1 2 1 Y 1 A PRO 526 ? A PRO 2 3 1 Y 1 A LEU 527 ? A LEU 3 4 1 Y 1 A GLU 528 ? A GLU 4 5 1 Y 1 A MET 529 ? A MET 5 6 1 Y 1 A HIS 530 ? A HIS 6 7 1 Y 1 A GLU 531 ? A GLU 7 8 1 Y 1 A ALA 532 ? A ALA 8 9 1 Y 1 A MET 533 ? A MET 9 10 1 Y 1 A ALA 597 ? A ALA 73 11 1 Y 1 B GLY 1471 ? B GLY 1 12 1 Y 1 B PRO 1472 ? B PRO 2 13 1 Y 1 B LEU 1473 ? B LEU 3 14 1 Y 1 B GLY 1474 ? B GLY 4 15 1 Y 1 B SER 1475 ? B SER 5 16 1 Y 1 B ALA 1476 ? B ALA 6 17 1 Y 1 B PRO 1477 ? B PRO 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CSO N N N N 74 CSO CA C N R 75 CSO CB C N N 76 CSO SG S N N 77 CSO C C N N 78 CSO O O N N 79 CSO OXT O N N 80 CSO OD O N N 81 CSO H H N N 82 CSO H2 H N N 83 CSO HA H N N 84 CSO HB2 H N N 85 CSO HB3 H N N 86 CSO HXT H N N 87 CSO HD H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 SO4 S S N N 305 SO4 O1 O N N 306 SO4 O2 O N N 307 SO4 O3 O N N 308 SO4 O4 O N N 309 THR N N N N 310 THR CA C N S 311 THR C C N N 312 THR O O N N 313 THR CB C N R 314 THR OG1 O N N 315 THR CG2 C N N 316 THR OXT O N N 317 THR H H N N 318 THR H2 H N N 319 THR HA H N N 320 THR HB H N N 321 THR HG1 H N N 322 THR HG21 H N N 323 THR HG22 H N N 324 THR HG23 H N N 325 THR HXT H N N 326 TRP N N N N 327 TRP CA C N S 328 TRP C C N N 329 TRP O O N N 330 TRP CB C N N 331 TRP CG C Y N 332 TRP CD1 C Y N 333 TRP CD2 C Y N 334 TRP NE1 N Y N 335 TRP CE2 C Y N 336 TRP CE3 C Y N 337 TRP CZ2 C Y N 338 TRP CZ3 C Y N 339 TRP CH2 C Y N 340 TRP OXT O N N 341 TRP H H N N 342 TRP H2 H N N 343 TRP HA H N N 344 TRP HB2 H N N 345 TRP HB3 H N N 346 TRP HD1 H N N 347 TRP HE1 H N N 348 TRP HE3 H N N 349 TRP HZ2 H N N 350 TRP HZ3 H N N 351 TRP HH2 H N N 352 TRP HXT H N N 353 TYR N N N N 354 TYR CA C N S 355 TYR C C N N 356 TYR O O N N 357 TYR CB C N N 358 TYR CG C Y N 359 TYR CD1 C Y N 360 TYR CD2 C Y N 361 TYR CE1 C Y N 362 TYR CE2 C Y N 363 TYR CZ C Y N 364 TYR OH O N N 365 TYR OXT O N N 366 TYR H H N N 367 TYR H2 H N N 368 TYR HA H N N 369 TYR HB2 H N N 370 TYR HB3 H N N 371 TYR HD1 H N N 372 TYR HD2 H N N 373 TYR HE1 H N N 374 TYR HE2 H N N 375 TYR HH H N N 376 TYR HXT H N N 377 VAL N N N N 378 VAL CA C N S 379 VAL C C N N 380 VAL O O N N 381 VAL CB C N N 382 VAL CG1 C N N 383 VAL CG2 C N N 384 VAL OXT O N N 385 VAL H H N N 386 VAL H2 H N N 387 VAL HA H N N 388 VAL HB H N N 389 VAL HG11 H N N 390 VAL HG12 H N N 391 VAL HG13 H N N 392 VAL HG21 H N N 393 VAL HG22 H N N 394 VAL HG23 H N N 395 VAL HXT H N N 396 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CSO N CA sing N N 70 CSO N H sing N N 71 CSO N H2 sing N N 72 CSO CA CB sing N N 73 CSO CA C sing N N 74 CSO CA HA sing N N 75 CSO CB SG sing N N 76 CSO CB HB2 sing N N 77 CSO CB HB3 sing N N 78 CSO SG OD sing N N 79 CSO C O doub N N 80 CSO C OXT sing N N 81 CSO OXT HXT sing N N 82 CSO OD HD sing N N 83 GLN N CA sing N N 84 GLN N H sing N N 85 GLN N H2 sing N N 86 GLN CA C sing N N 87 GLN CA CB sing N N 88 GLN CA HA sing N N 89 GLN C O doub N N 90 GLN C OXT sing N N 91 GLN CB CG sing N N 92 GLN CB HB2 sing N N 93 GLN CB HB3 sing N N 94 GLN CG CD sing N N 95 GLN CG HG2 sing N N 96 GLN CG HG3 sing N N 97 GLN CD OE1 doub N N 98 GLN CD NE2 sing N N 99 GLN NE2 HE21 sing N N 100 GLN NE2 HE22 sing N N 101 GLN OXT HXT sing N N 102 GLU N CA sing N N 103 GLU N H sing N N 104 GLU N H2 sing N N 105 GLU CA C sing N N 106 GLU CA CB sing N N 107 GLU CA HA sing N N 108 GLU C O doub N N 109 GLU C OXT sing N N 110 GLU CB CG sing N N 111 GLU CB HB2 sing N N 112 GLU CB HB3 sing N N 113 GLU CG CD sing N N 114 GLU CG HG2 sing N N 115 GLU CG HG3 sing N N 116 GLU CD OE1 doub N N 117 GLU CD OE2 sing N N 118 GLU OE2 HE2 sing N N 119 GLU OXT HXT sing N N 120 GLY N CA sing N N 121 GLY N H sing N N 122 GLY N H2 sing N N 123 GLY CA C sing N N 124 GLY CA HA2 sing N N 125 GLY CA HA3 sing N N 126 GLY C O doub N N 127 GLY C OXT sing N N 128 GLY OXT HXT sing N N 129 HIS N CA sing N N 130 HIS N H sing N N 131 HIS N H2 sing N N 132 HIS CA C sing N N 133 HIS CA CB sing N N 134 HIS CA HA sing N N 135 HIS C O doub N N 136 HIS C OXT sing N N 137 HIS CB CG sing N N 138 HIS CB HB2 sing N N 139 HIS CB HB3 sing N N 140 HIS CG ND1 sing Y N 141 HIS CG CD2 doub Y N 142 HIS ND1 CE1 doub Y N 143 HIS ND1 HD1 sing N N 144 HIS CD2 NE2 sing Y N 145 HIS CD2 HD2 sing N N 146 HIS CE1 NE2 sing Y N 147 HIS CE1 HE1 sing N N 148 HIS NE2 HE2 sing N N 149 HIS OXT HXT sing N N 150 HOH O H1 sing N N 151 HOH O H2 sing N N 152 ILE N CA sing N N 153 ILE N H sing N N 154 ILE N H2 sing N N 155 ILE CA C sing N N 156 ILE CA CB sing N N 157 ILE CA HA sing N N 158 ILE C O doub N N 159 ILE C OXT sing N N 160 ILE CB CG1 sing N N 161 ILE CB CG2 sing N N 162 ILE CB HB sing N N 163 ILE CG1 CD1 sing N N 164 ILE CG1 HG12 sing N N 165 ILE CG1 HG13 sing N N 166 ILE CG2 HG21 sing N N 167 ILE CG2 HG22 sing N N 168 ILE CG2 HG23 sing N N 169 ILE CD1 HD11 sing N N 170 ILE CD1 HD12 sing N N 171 ILE CD1 HD13 sing N N 172 ILE OXT HXT sing N N 173 LEU N CA sing N N 174 LEU N H sing N N 175 LEU N H2 sing N N 176 LEU CA C sing N N 177 LEU CA CB sing N N 178 LEU CA HA sing N N 179 LEU C O doub N N 180 LEU C OXT sing N N 181 LEU CB CG sing N N 182 LEU CB HB2 sing N N 183 LEU CB HB3 sing N N 184 LEU CG CD1 sing N N 185 LEU CG CD2 sing N N 186 LEU CG HG sing N N 187 LEU CD1 HD11 sing N N 188 LEU CD1 HD12 sing N N 189 LEU CD1 HD13 sing N N 190 LEU CD2 HD21 sing N N 191 LEU CD2 HD22 sing N N 192 LEU CD2 HD23 sing N N 193 LEU OXT HXT sing N N 194 LYS N CA sing N N 195 LYS N H sing N N 196 LYS N H2 sing N N 197 LYS CA C sing N N 198 LYS CA CB sing N N 199 LYS CA HA sing N N 200 LYS C O doub N N 201 LYS C OXT sing N N 202 LYS CB CG sing N N 203 LYS CB HB2 sing N N 204 LYS CB HB3 sing N N 205 LYS CG CD sing N N 206 LYS CG HG2 sing N N 207 LYS CG HG3 sing N N 208 LYS CD CE sing N N 209 LYS CD HD2 sing N N 210 LYS CD HD3 sing N N 211 LYS CE NZ sing N N 212 LYS CE HE2 sing N N 213 LYS CE HE3 sing N N 214 LYS NZ HZ1 sing N N 215 LYS NZ HZ2 sing N N 216 LYS NZ HZ3 sing N N 217 LYS OXT HXT sing N N 218 MET N CA sing N N 219 MET N H sing N N 220 MET N H2 sing N N 221 MET CA C sing N N 222 MET CA CB sing N N 223 MET CA HA sing N N 224 MET C O doub N N 225 MET C OXT sing N N 226 MET CB CG sing N N 227 MET CB HB2 sing N N 228 MET CB HB3 sing N N 229 MET CG SD sing N N 230 MET CG HG2 sing N N 231 MET CG HG3 sing N N 232 MET SD CE sing N N 233 MET CE HE1 sing N N 234 MET CE HE2 sing N N 235 MET CE HE3 sing N N 236 MET OXT HXT sing N N 237 PHE N CA sing N N 238 PHE N H sing N N 239 PHE N H2 sing N N 240 PHE CA C sing N N 241 PHE CA CB sing N N 242 PHE CA HA sing N N 243 PHE C O doub N N 244 PHE C OXT sing N N 245 PHE CB CG sing N N 246 PHE CB HB2 sing N N 247 PHE CB HB3 sing N N 248 PHE CG CD1 doub Y N 249 PHE CG CD2 sing Y N 250 PHE CD1 CE1 sing Y N 251 PHE CD1 HD1 sing N N 252 PHE CD2 CE2 doub Y N 253 PHE CD2 HD2 sing N N 254 PHE CE1 CZ doub Y N 255 PHE CE1 HE1 sing N N 256 PHE CE2 CZ sing Y N 257 PHE CE2 HE2 sing N N 258 PHE CZ HZ sing N N 259 PHE OXT HXT sing N N 260 PRO N CA sing N N 261 PRO N CD sing N N 262 PRO N H sing N N 263 PRO CA C sing N N 264 PRO CA CB sing N N 265 PRO CA HA sing N N 266 PRO C O doub N N 267 PRO C OXT sing N N 268 PRO CB CG sing N N 269 PRO CB HB2 sing N N 270 PRO CB HB3 sing N N 271 PRO CG CD sing N N 272 PRO CG HG2 sing N N 273 PRO CG HG3 sing N N 274 PRO CD HD2 sing N N 275 PRO CD HD3 sing N N 276 PRO OXT HXT sing N N 277 SER N CA sing N N 278 SER N H sing N N 279 SER N H2 sing N N 280 SER CA C sing N N 281 SER CA CB sing N N 282 SER CA HA sing N N 283 SER C O doub N N 284 SER C OXT sing N N 285 SER CB OG sing N N 286 SER CB HB2 sing N N 287 SER CB HB3 sing N N 288 SER OG HG sing N N 289 SER OXT HXT sing N N 290 SO4 S O1 doub N N 291 SO4 S O2 doub N N 292 SO4 S O3 sing N N 293 SO4 S O4 sing N N 294 THR N CA sing N N 295 THR N H sing N N 296 THR N H2 sing N N 297 THR CA C sing N N 298 THR CA CB sing N N 299 THR CA HA sing N N 300 THR C O doub N N 301 THR C OXT sing N N 302 THR CB OG1 sing N N 303 THR CB CG2 sing N N 304 THR CB HB sing N N 305 THR OG1 HG1 sing N N 306 THR CG2 HG21 sing N N 307 THR CG2 HG22 sing N N 308 THR CG2 HG23 sing N N 309 THR OXT HXT sing N N 310 TRP N CA sing N N 311 TRP N H sing N N 312 TRP N H2 sing N N 313 TRP CA C sing N N 314 TRP CA CB sing N N 315 TRP CA HA sing N N 316 TRP C O doub N N 317 TRP C OXT sing N N 318 TRP CB CG sing N N 319 TRP CB HB2 sing N N 320 TRP CB HB3 sing N N 321 TRP CG CD1 doub Y N 322 TRP CG CD2 sing Y N 323 TRP CD1 NE1 sing Y N 324 TRP CD1 HD1 sing N N 325 TRP CD2 CE2 doub Y N 326 TRP CD2 CE3 sing Y N 327 TRP NE1 CE2 sing Y N 328 TRP NE1 HE1 sing N N 329 TRP CE2 CZ2 sing Y N 330 TRP CE3 CZ3 doub Y N 331 TRP CE3 HE3 sing N N 332 TRP CZ2 CH2 doub Y N 333 TRP CZ2 HZ2 sing N N 334 TRP CZ3 CH2 sing Y N 335 TRP CZ3 HZ3 sing N N 336 TRP CH2 HH2 sing N N 337 TRP OXT HXT sing N N 338 TYR N CA sing N N 339 TYR N H sing N N 340 TYR N H2 sing N N 341 TYR CA C sing N N 342 TYR CA CB sing N N 343 TYR CA HA sing N N 344 TYR C O doub N N 345 TYR C OXT sing N N 346 TYR CB CG sing N N 347 TYR CB HB2 sing N N 348 TYR CB HB3 sing N N 349 TYR CG CD1 doub Y N 350 TYR CG CD2 sing Y N 351 TYR CD1 CE1 sing Y N 352 TYR CD1 HD1 sing N N 353 TYR CD2 CE2 doub Y N 354 TYR CD2 HD2 sing N N 355 TYR CE1 CZ doub Y N 356 TYR CE1 HE1 sing N N 357 TYR CE2 CZ sing Y N 358 TYR CE2 HE2 sing N N 359 TYR CZ OH sing N N 360 TYR OH HH sing N N 361 TYR OXT HXT sing N N 362 VAL N CA sing N N 363 VAL N H sing N N 364 VAL N H2 sing N N 365 VAL CA C sing N N 366 VAL CA CB sing N N 367 VAL CA HA sing N N 368 VAL C O doub N N 369 VAL C OXT sing N N 370 VAL CB CG1 sing N N 371 VAL CB CG2 sing N N 372 VAL CB HB sing N N 373 VAL CG1 HG11 sing N N 374 VAL CG1 HG12 sing N N 375 VAL CG1 HG13 sing N N 376 VAL CG2 HG21 sing N N 377 VAL CG2 HG22 sing N N 378 VAL CG2 HG23 sing N N 379 VAL OXT HXT sing N N 380 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Australian Research Council (ARC)' Australia DE160100608 1 'National Health and Medical Research Council (NHMRC, Australia)' Australia APP1159347 2 'National Health and Medical Research Council (NHMRC, Australia)' Australia APP1146403 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SULFATE ION' SO4 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3FMA _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #