data_7S0N # _entry.id 7S0N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7S0N pdb_00007s0n 10.2210/pdb7s0n/pdb WWPDB D_1000259096 ? ? BMRB 51054 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 51054 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7S0N _pdbx_database_status.recvd_initial_deposition_date 2021-08-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kent, J.E.' 1 0000-0002-4856-525X 'Tian, Y.' 2 0000-0003-4057-9830 'Shin, K.' 3 0000-0003-4836-8798 'Zhang, L.' 4 ? 'Niederweis, M.' 5 ? 'Marassi, F.M.' 6 0000-0003-2695-5844 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of MS3494 from Mycobacterium Smegmatis' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kent, J.E.' 1 0000-0002-4856-525X primary 'Zhang, L.' 2 ? primary 'Shin, K.' 3 0000-0003-4836-8798 primary 'Tian, Y.' 4 0000-0003-4057-9830 primary 'Niederweis, M.' 5 ? primary 'Marassi, F.M.' 6 0000-0003-2695-5844 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Secreted protein' _entity.formula_weight 14488.071 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name MS3494 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ADATDDYPIPNRIMRTPCTAEQIMAAARDVEPVYYERYMTDYKNKPPHVQQAARDRIHWFFSMDYAGRRQYSENTATDAF FEQLAWMWPNWAKLFFNNKGVAANTTDVCEQYPPDDMSVWNW ; _entity_poly.pdbx_seq_one_letter_code_can ;ADATDDYPIPNRIMRTPCTAEQIMAAARDVEPVYYERYMTDYKNKPPHVQQAARDRIHWFFSMDYAGRRQYSENTATDAF FEQLAWMWPNWAKLFFNNKGVAANTTDVCEQYPPDDMSVWNW ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 ALA n 1 4 THR n 1 5 ASP n 1 6 ASP n 1 7 TYR n 1 8 PRO n 1 9 ILE n 1 10 PRO n 1 11 ASN n 1 12 ARG n 1 13 ILE n 1 14 MET n 1 15 ARG n 1 16 THR n 1 17 PRO n 1 18 CYS n 1 19 THR n 1 20 ALA n 1 21 GLU n 1 22 GLN n 1 23 ILE n 1 24 MET n 1 25 ALA n 1 26 ALA n 1 27 ALA n 1 28 ARG n 1 29 ASP n 1 30 VAL n 1 31 GLU n 1 32 PRO n 1 33 VAL n 1 34 TYR n 1 35 TYR n 1 36 GLU n 1 37 ARG n 1 38 TYR n 1 39 MET n 1 40 THR n 1 41 ASP n 1 42 TYR n 1 43 LYS n 1 44 ASN n 1 45 LYS n 1 46 PRO n 1 47 PRO n 1 48 HIS n 1 49 VAL n 1 50 GLN n 1 51 GLN n 1 52 ALA n 1 53 ALA n 1 54 ARG n 1 55 ASP n 1 56 ARG n 1 57 ILE n 1 58 HIS n 1 59 TRP n 1 60 PHE n 1 61 PHE n 1 62 SER n 1 63 MET n 1 64 ASP n 1 65 TYR n 1 66 ALA n 1 67 GLY n 1 68 ARG n 1 69 ARG n 1 70 GLN n 1 71 TYR n 1 72 SER n 1 73 GLU n 1 74 ASN n 1 75 THR n 1 76 ALA n 1 77 THR n 1 78 ASP n 1 79 ALA n 1 80 PHE n 1 81 PHE n 1 82 GLU n 1 83 GLN n 1 84 LEU n 1 85 ALA n 1 86 TRP n 1 87 MET n 1 88 TRP n 1 89 PRO n 1 90 ASN n 1 91 TRP n 1 92 ALA n 1 93 LYS n 1 94 LEU n 1 95 PHE n 1 96 PHE n 1 97 ASN n 1 98 ASN n 1 99 LYS n 1 100 GLY n 1 101 VAL n 1 102 ALA n 1 103 ALA n 1 104 ASN n 1 105 THR n 1 106 THR n 1 107 ASP n 1 108 VAL n 1 109 CYS n 1 110 GLU n 1 111 GLN n 1 112 TYR n 1 113 PRO n 1 114 PRO n 1 115 ASP n 1 116 ASP n 1 117 MET n 1 118 SER n 1 119 VAL n 1 120 TRP n 1 121 ASN n 1 122 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 122 _entity_src_gen.gene_src_common_name 'Mycobacterium smegmatis' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ERS451418_03468 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycolicibacterium smegmatis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1772 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0D6IBL0_MYCSM _struct_ref.pdbx_db_accession A0A0D6IBL0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ADATDDYPIPNRIMRTPCTAEQIMAAARDVEPVYYERYMTDYKNKPPHVQQAARDRIHWFFSMDYAGRRQYSENTATDAF FEQLAWMWPNWAKLFFNNKGVAANTTDVCEQYPPDDMSVWNW ; _struct_ref.pdbx_align_begin 32 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7S0N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 122 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0D6IBL0 _struct_ref_seq.db_align_beg 32 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 153 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 122 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCA' 1 isotropic 3 1 1 '3D HNCO' 1 isotropic 4 1 1 '3D HNCACB' 1 isotropic 5 1 1 '3D CBCA(CO)NH' 1 isotropic 6 1 1 '3D 1H-15N NOESY' 1 isotropic 7 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 8 2 2 '3D 1H-15N NOESY' 1 isotropic 9 2 2 '2D 1H-13C HSQC' 1 isotropic 10 2 2 '2D HBCBCGCDHD' 1 isotropic 11 2 2 '2D HBCBCGCDCEHE' 1 isotropic 12 2 2 '2D 1H-15N HSQC' 1 isotropic 13 2 2 '3D HCCH-TOCSY' 1 isotropic 14 2 2 '3D HCCH-COSY' 1 isotropic 15 1 1 '1H-15N heteronoe' 1 isotropic # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 atm 1 6.5 0 ;90 % H2O 10 % D2O 50 mM PO4 pH 6.5 ; ? 'Not defined' Conditions_H2O ? 'Not defined' ? ? K 2 298 atm 1 6.5 0 ;~100 % D2O 50 mM PO4 pH 6.5 ; ? 'Not defined' Conditions_D2O ? pH ? ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM [U-100% 13C; U-100% 15N] MS3494, 50 mM NA- sodium phosphate, 90% H2O/10% D2O' '90% H2O/10% D2O' '15N_13C Sample' solution ? 2 '0.5 mM [U-100% 13C; U-100% 15N] MS3494, 50 mM NA- sodium phosphate, 100% D2O' '100% D2O' '15N_13C Sample' solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 7S0N _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 7S0N _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7S0N _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 2 'data analysis' TALOS-N ? ;Shen, Y. Bax, A. ; 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'peak picking' 'CcpNmr Analysis' ? CCPN # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7S0N _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7S0N _struct.title 'Structure of MS3494 from Mycobacterium Smegmatis determined by Solution NMR' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7S0N _struct_keywords.text 'DUF5078, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 10 ? ARG A 15 ? PRO A 10 ARG A 15 1 ? 6 HELX_P HELX_P2 AA2 THR A 19 ? GLU A 31 ? THR A 19 GLU A 31 1 ? 13 HELX_P HELX_P3 AA3 GLU A 31 ? LYS A 45 ? GLU A 31 LYS A 45 1 ? 15 HELX_P HELX_P4 AA4 PRO A 46 ? ASP A 64 ? PRO A 46 ASP A 64 1 ? 19 HELX_P HELX_P5 AA5 ASP A 64 ? ASP A 78 ? ASP A 64 ASP A 78 1 ? 15 HELX_P HELX_P6 AA6 ALA A 79 ? GLU A 82 ? ALA A 79 GLU A 82 5 ? 4 HELX_P HELX_P7 AA7 GLN A 83 ? TRP A 88 ? GLN A 83 TRP A 88 1 ? 6 HELX_P HELX_P8 AA8 LYS A 99 ? CYS A 109 ? LYS A 99 CYS A 109 1 ? 11 HELX_P HELX_P9 AA9 ASP A 116 ? TRP A 120 ? ASP A 116 TRP A 120 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 18 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 109 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 18 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 109 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.024 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 7 A . ? TYR 7 A PRO 8 A ? PRO 8 A 1 0.61 2 TYR 7 A . ? TYR 7 A PRO 8 A ? PRO 8 A 2 1.58 3 TYR 7 A . ? TYR 7 A PRO 8 A ? PRO 8 A 3 0.90 4 TYR 7 A . ? TYR 7 A PRO 8 A ? PRO 8 A 4 -1.71 5 TYR 7 A . ? TYR 7 A PRO 8 A ? PRO 8 A 5 1.18 6 TYR 7 A . ? TYR 7 A PRO 8 A ? PRO 8 A 6 1.03 7 TYR 7 A . ? TYR 7 A PRO 8 A ? PRO 8 A 7 1.16 8 TYR 7 A . ? TYR 7 A PRO 8 A ? PRO 8 A 8 0.59 9 TYR 7 A . ? TYR 7 A PRO 8 A ? PRO 8 A 9 1.63 10 TYR 7 A . ? TYR 7 A PRO 8 A ? PRO 8 A 10 1.24 # _atom_sites.entry_id 7S0N _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 TRP 88 88 88 TRP TRP A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 TRP 91 91 91 TRP TRP A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 CYS 109 109 109 CYS CYS A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 MET 117 117 117 MET MET A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 TRP 120 120 120 TRP TRP A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 TRP 122 122 122 TRP TRP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2021-10-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 MS3494 0.5 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate' 50 ? mM NA- 2 MS3494 0.5 ? mM '[U-100% 13C; U-100% 15N]' 2 'sodium phosphate' 50 ? mM NA- # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A LEU 84 ? ? H A TRP 88 ? ? 1.56 2 2 O A GLN 70 ? ? H A ASN 74 ? ? 1.58 3 5 O A LEU 84 ? ? H A TRP 88 ? ? 1.57 4 8 O A ALA 102 ? ? HG1 A THR 106 ? ? 1.58 5 9 O A LEU 84 ? ? H A TRP 88 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? 66.00 -155.36 2 1 PRO A 8 ? ? -76.68 -139.55 3 1 PRO A 10 ? ? -35.62 120.93 4 1 ARG A 15 ? ? -93.69 40.05 5 1 ASP A 64 ? ? 68.30 -115.34 6 1 LYS A 99 ? ? -78.97 -160.71 7 2 PRO A 8 ? ? -73.23 -141.28 8 2 ASP A 64 ? ? 77.83 -116.33 9 2 PHE A 96 ? ? -97.08 -80.11 10 2 ASN A 98 ? ? -179.99 -55.66 11 2 LYS A 99 ? ? -165.89 -152.35 12 3 PRO A 8 ? ? -73.18 -140.15 13 3 ASP A 64 ? ? 81.76 -139.96 14 3 LYS A 99 ? ? -81.64 48.67 15 4 ASP A 64 ? ? 72.82 -114.22 16 4 LYS A 99 ? ? -76.26 -160.91 17 5 PRO A 8 ? ? -73.61 -138.61 18 5 ARG A 15 ? ? -97.17 40.44 19 5 ASP A 64 ? ? 72.87 -122.02 20 5 LYS A 99 ? ? -79.04 -159.95 21 6 PRO A 8 ? ? -71.37 -139.54 22 6 ARG A 15 ? ? -101.38 40.52 23 6 ASP A 64 ? ? 83.28 -118.49 24 7 PRO A 8 ? ? -73.04 -136.95 25 7 ARG A 15 ? ? -99.92 40.16 26 7 ASP A 64 ? ? 74.81 -109.26 27 8 PRO A 8 ? ? -73.97 -138.57 28 8 ASP A 64 ? ? 74.11 -130.56 29 8 ASN A 97 ? ? -161.62 -66.11 30 8 ALA A 103 ? ? -90.18 -65.15 31 9 PRO A 8 ? ? -74.06 -139.84 32 9 ARG A 15 ? ? -93.78 40.81 33 9 ASP A 64 ? ? 164.43 166.65 34 9 PHE A 96 ? ? -103.39 55.26 35 9 LYS A 99 ? ? -107.40 -159.64 36 10 PRO A 8 ? ? -70.89 -138.81 37 10 ASP A 64 ? ? 72.67 -122.60 38 10 PHE A 80 ? ? -89.16 32.70 39 10 LYS A 99 ? ? -79.33 -163.34 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' ? 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' ? 2 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #