data_7S18 # _entry.id 7S18 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7S18 pdb_00007s18 10.2210/pdb7s18/pdb WWPDB D_1000259376 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7S18 _pdbx_database_status.recvd_initial_deposition_date 2021-09-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sharma, V.' 1 0000-0002-3054-2658 'Podust, L.M.' 2 0000-0002-8537-8760 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 4255 _citation.page_last 4269 _citation.title 'Intramolecular Interactions Enhance the Potency of Gallinamide A Analogues against Trypanosoma cruzi .' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.1c02063 _citation.pdbx_database_id_PubMed 35188371 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Barbosa Da Silva, E.' 1 ? primary 'Sharma, V.' 2 ? primary 'Hernandez-Alvarez, L.' 3 ? primary 'Tang, A.H.' 4 ? primary 'Stoye, A.' 5 ? primary ;O'Donoghue, A.J. ; 6 ? primary 'Gerwick, W.H.' 7 ? primary 'Payne, R.J.' 8 ? primary 'McKerrow, J.H.' 9 ? primary 'Podust, L.M.' 10 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7S18 _cell.details ? _cell.formula_units_Z ? _cell.length_a 99.500 _cell.length_a_esd ? _cell.length_b 99.500 _cell.length_b_esd ? _cell.length_c 85.370 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7S18 _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Cruzipain 22715.133 1 3.4.22.51 ? ? ? 2 non-polymer syn ;N,N-dimethyl-L-valyl-L-leucyl-N-[(3S)-6-{(2S)-2-[([1,1'-biphenyl]-4-yl)methyl]-3-methoxy-5-oxo-2,5-dihydro-1H-pyrrol-1-yl}-6-oxo-1-phenylhexan-3-yl]-L-leucinamide ; 822.086 1 ? ? ? ? 3 water nat water 18.015 3 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cruzaine,Major cysteine proteinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENN GAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQL DHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG ; _entity_poly.pdbx_seq_one_letter_code_can ;APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENN GAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQL DHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 PRO n 1 3 ALA n 1 4 ALA n 1 5 VAL n 1 6 ASP n 1 7 TRP n 1 8 ARG n 1 9 ALA n 1 10 ARG n 1 11 GLY n 1 12 ALA n 1 13 VAL n 1 14 THR n 1 15 ALA n 1 16 VAL n 1 17 LYS n 1 18 ASP n 1 19 GLN n 1 20 GLY n 1 21 GLN n 1 22 CYS n 1 23 GLY n 1 24 SER n 1 25 CYS n 1 26 TRP n 1 27 ALA n 1 28 PHE n 1 29 SER n 1 30 ALA n 1 31 ILE n 1 32 GLY n 1 33 ASN n 1 34 VAL n 1 35 GLU n 1 36 CYS n 1 37 GLN n 1 38 TRP n 1 39 PHE n 1 40 LEU n 1 41 ALA n 1 42 GLY n 1 43 HIS n 1 44 PRO n 1 45 LEU n 1 46 THR n 1 47 ASN n 1 48 LEU n 1 49 SER n 1 50 GLU n 1 51 GLN n 1 52 MET n 1 53 LEU n 1 54 VAL n 1 55 SER n 1 56 CYS n 1 57 ASP n 1 58 LYS n 1 59 THR n 1 60 ASP n 1 61 SER n 1 62 GLY n 1 63 CYS n 1 64 SER n 1 65 GLY n 1 66 GLY n 1 67 LEU n 1 68 MET n 1 69 ASN n 1 70 ASN n 1 71 ALA n 1 72 PHE n 1 73 GLU n 1 74 TRP n 1 75 ILE n 1 76 VAL n 1 77 GLN n 1 78 GLU n 1 79 ASN n 1 80 ASN n 1 81 GLY n 1 82 ALA n 1 83 VAL n 1 84 TYR n 1 85 THR n 1 86 GLU n 1 87 ASP n 1 88 SER n 1 89 TYR n 1 90 PRO n 1 91 TYR n 1 92 ALA n 1 93 SER n 1 94 GLY n 1 95 GLU n 1 96 GLY n 1 97 ILE n 1 98 SER n 1 99 PRO n 1 100 PRO n 1 101 CYS n 1 102 THR n 1 103 THR n 1 104 SER n 1 105 GLY n 1 106 HIS n 1 107 THR n 1 108 VAL n 1 109 GLY n 1 110 ALA n 1 111 THR n 1 112 ILE n 1 113 THR n 1 114 GLY n 1 115 HIS n 1 116 VAL n 1 117 GLU n 1 118 LEU n 1 119 PRO n 1 120 GLN n 1 121 ASP n 1 122 GLU n 1 123 ALA n 1 124 GLN n 1 125 ILE n 1 126 ALA n 1 127 ALA n 1 128 TRP n 1 129 LEU n 1 130 ALA n 1 131 VAL n 1 132 ASN n 1 133 GLY n 1 134 PRO n 1 135 VAL n 1 136 ALA n 1 137 VAL n 1 138 ALA n 1 139 VAL n 1 140 ASP n 1 141 ALA n 1 142 SER n 1 143 SER n 1 144 TRP n 1 145 MET n 1 146 THR n 1 147 TYR n 1 148 THR n 1 149 GLY n 1 150 GLY n 1 151 VAL n 1 152 MET n 1 153 THR n 1 154 SER n 1 155 CYS n 1 156 VAL n 1 157 SER n 1 158 GLU n 1 159 GLN n 1 160 LEU n 1 161 ASP n 1 162 HIS n 1 163 GLY n 1 164 VAL n 1 165 LEU n 1 166 LEU n 1 167 VAL n 1 168 GLY n 1 169 TYR n 1 170 ASN n 1 171 ASP n 1 172 SER n 1 173 ALA n 1 174 ALA n 1 175 VAL n 1 176 PRO n 1 177 TYR n 1 178 TRP n 1 179 ILE n 1 180 ILE n 1 181 LYS n 1 182 ASN n 1 183 SER n 1 184 TRP n 1 185 THR n 1 186 THR n 1 187 GLN n 1 188 TRP n 1 189 GLY n 1 190 GLU n 1 191 GLU n 1 192 GLY n 1 193 TYR n 1 194 ILE n 1 195 ARG n 1 196 ILE n 1 197 ALA n 1 198 LYS n 1 199 GLY n 1 200 SER n 1 201 ASN n 1 202 GLN n 1 203 CYS n 1 204 LEU n 1 205 VAL n 1 206 LYS n 1 207 GLU n 1 208 GLU n 1 209 ALA n 1 210 SER n 1 211 SER n 1 212 ALA n 1 213 VAL n 1 214 VAL n 1 215 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 215 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Trypanosoma cruzi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5693 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Arctic Express' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PET _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET21A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYSP_TRYCR _struct_ref.pdbx_db_accession P25779 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENN GAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQL DHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG ; _struct_ref.pdbx_align_begin 123 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7S18 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 215 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P25779 _struct_ref_seq.db_align_beg 123 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 337 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 215 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 83E non-polymer . ;N,N-dimethyl-L-valyl-L-leucyl-N-[(3S)-6-{(2S)-2-[([1,1'-biphenyl]-4-yl)methyl]-3-methoxy-5-oxo-2,5-dihydro-1H-pyrrol-1-yl}-6-oxo-1-phenylhexan-3-yl]-L-leucinamide ; ? 'C49 H67 N5 O6' 822.086 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7S18 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.33 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.11 _exptl_crystal.description 'transparent rhomboid shaped crystals' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.3 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 296 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '3.2 M Sodium Chloride; 0.1 M Sodium Citrate pH 5.3; 0.01 M Sarcosine' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 110 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details Mirrors _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-07-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'SI(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.1159 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.1159 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 79.502 _reflns.entry_id 7S18 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.140 _reflns.d_resolution_low 70.360 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12135 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.246 _reflns.pdbx_Rmerge_I_obs 0.068 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.310 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.828 _reflns.pdbx_scaling_rejects 163 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.070 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 306358 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.140 2.200 ? 0.890 ? ? ? ? 871 100.00 ? ? ? ? 5.573 ? ? ? ? ? ? ? ? 26.749 ? ? ? ? 5.680 ? ? 1 1 0.481 ? ? ? ? ? ? ? ? ? ? 2.200 2.260 ? 1.390 ? ? ? ? 863 99.900 ? ? ? ? 3.845 ? ? ? ? ? ? ? ? 26.419 ? ? ? ? 3.919 ? ? 2 1 0.742 ? ? ? ? ? ? ? ? ? ? 2.260 2.320 ? 2.280 ? ? ? ? 824 99.900 ? ? ? ? 2.523 ? ? ? ? ? ? ? ? 25.211 ? ? ? ? 2.575 ? ? 3 1 0.886 ? ? ? ? ? ? ? ? ? ? 2.320 2.390 ? 2.730 ? ? ? ? 817 99.900 ? ? ? ? 2.129 ? ? ? ? ? ? ? ? 25.307 ? ? ? ? 2.172 ? ? 4 1 0.921 ? ? ? ? ? ? ? ? ? ? 2.390 2.470 ? 3.580 ? ? ? ? 793 100.000 ? ? ? ? 1.742 ? ? ? ? ? ? ? ? 27.262 ? ? ? ? 1.775 ? ? 5 1 0.958 ? ? ? ? ? ? ? ? ? ? 2.470 2.560 ? 4.750 ? ? ? ? 761 99.900 ? ? ? ? 1.300 ? ? ? ? ? ? ? ? 26.901 ? ? ? ? 1.325 ? ? 6 1 0.968 ? ? ? ? ? ? ? ? ? ? 2.560 2.650 ? 6.300 ? ? ? ? 737 99.700 ? ? ? ? 0.933 ? ? ? ? ? ? ? ? 26.556 ? ? ? ? 0.951 ? ? 7 1 0.982 ? ? ? ? ? ? ? ? ? ? 2.650 2.760 ? 9.400 ? ? ? ? 712 100.000 ? ? ? ? 0.529 ? ? ? ? ? ? ? ? 25.726 ? ? ? ? 0.540 ? ? 8 1 0.993 ? ? ? ? ? ? ? ? ? ? 2.760 2.890 ? 13.220 ? ? ? ? 677 100.000 ? ? ? ? 0.332 ? ? ? ? ? ? ? ? 24.696 ? ? ? ? 0.339 ? ? 9 1 0.997 ? ? ? ? ? ? ? ? ? ? 2.890 3.030 ? 18.420 ? ? ? ? 660 100.000 ? ? ? ? 0.232 ? ? ? ? ? ? ? ? 26.526 ? ? ? ? 0.237 ? ? 10 1 0.998 ? ? ? ? ? ? ? ? ? ? 3.030 3.190 ? 25.400 ? ? ? ? 628 100.000 ? ? ? ? 0.151 ? ? ? ? ? ? ? ? 26.390 ? ? ? ? 0.155 ? ? 11 1 0.999 ? ? ? ? ? ? ? ? ? ? 3.190 3.380 ? 33.280 ? ? ? ? 589 100.000 ? ? ? ? 0.104 ? ? ? ? ? ? ? ? 26.029 ? ? ? ? 0.107 ? ? 12 1 0.999 ? ? ? ? ? ? ? ? ? ? 3.380 3.620 ? 42.810 ? ? ? ? 564 100.000 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 23.856 ? ? ? ? 0.075 ? ? 13 1 0.999 ? ? ? ? ? ? ? ? ? ? 3.620 3.910 ? 51.730 ? ? ? ? 528 100.000 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 23.239 ? ? ? ? 0.059 ? ? 14 1 0.999 ? ? ? ? ? ? ? ? ? ? 3.910 4.280 ? 57.640 ? ? ? ? 482 100.000 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 24.396 ? ? ? ? 0.049 ? ? 15 1 0.999 ? ? ? ? ? ? ? ? ? ? 4.280 4.790 ? 60.110 ? ? ? ? 445 100.000 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 23.166 ? ? ? ? 0.048 ? ? 16 1 1.000 ? ? ? ? ? ? ? ? ? ? 4.790 5.530 ? 59.880 ? ? ? ? 397 99.700 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 21.345 ? ? ? ? 0.050 ? ? 17 1 0.999 ? ? ? ? ? ? ? ? ? ? 5.530 6.770 ? 62.010 ? ? ? ? 341 100.000 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 22.457 ? ? ? ? 0.046 ? ? 18 1 0.999 ? ? ? ? ? ? ? ? ? ? 6.770 9.570 ? 62.700 ? ? ? ? 272 100.000 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 20.783 ? ? ? ? 0.043 ? ? 19 1 0.999 ? ? ? ? ? ? ? ? ? ? 9.570 70.360 ? 58.360 ? ? ? ? 174 100.000 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 17.943 ? ? ? ? 0.038 ? ? 20 1 1.000 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 3.7300 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 3.7300 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -7.4600 _refine.B_iso_max 182.070 _refine.B_iso_mean 87.4140 _refine.B_iso_min 47.190 _refine.correlation_coeff_Fo_to_Fc 0.9750 _refine.correlation_coeff_Fo_to_Fc_free 0.9390 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7S18 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1400 _refine.ls_d_res_low 70.3600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11556 _refine.ls_number_reflns_R_free 568 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9400 _refine.ls_percent_reflns_R_free 4.7000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2013 _refine.ls_R_factor_R_free 0.2894 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1971 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3kku _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2480 _refine.pdbx_overall_ESU_R_Free 0.2380 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 13.2310 _refine.overall_SU_ML 0.2940 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.1400 _refine_hist.d_res_low 70.3600 _refine_hist.number_atoms_solvent 3 _refine_hist.number_atoms_total 1652 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 215 _refine_hist.pdbx_B_iso_mean_ligand 94.27 _refine_hist.pdbx_B_iso_mean_solvent 75.20 _refine_hist.pdbx_number_atoms_protein 1589 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 60 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.019 1695 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1517 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.898 1.954 2323 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.020 3.000 3487 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.930 5.000 214 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 40.748 25.672 67 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.611 15.000 230 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 11.719 15.000 3 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.087 0.200 257 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 1965 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 389 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.1400 _refine_ls_shell.d_res_low 2.1960 _refine_ls_shell.number_reflns_all 870 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 28 _refine_ls_shell.number_reflns_R_work 842 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4630 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.4950 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7S18 _struct.title 'Crystal structure of cruzain with gallinamide analog from 2-biaryl series' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7S18 _struct_keywords.text 'Cysteine Protease, Cruzain, Gallinamide, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 24 ? LEU A 40 ? SER A 24 LEU A 40 1 ? 17 HELX_P HELX_P2 AA2 GLU A 50 ? ASP A 57 ? GLU A 50 ASP A 57 1 ? 8 HELX_P HELX_P3 AA3 SER A 61 ? GLY A 65 ? SER A 61 GLY A 65 5 ? 5 HELX_P HELX_P4 AA4 LEU A 67 ? ASN A 80 ? LEU A 67 ASN A 80 1 ? 14 HELX_P HELX_P5 AA5 ASP A 121 ? GLY A 133 ? ASP A 121 GLY A 133 1 ? 13 HELX_P HELX_P6 AA6 SER A 143 ? TYR A 147 ? SER A 143 TYR A 147 5 ? 5 HELX_P HELX_P7 AA7 ASN A 201 ? VAL A 205 ? ASN A 201 VAL A 205 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 63 SG ? ? A CYS 22 A CYS 63 1_555 ? ? ? ? ? ? ? 2.075 ? ? disulf2 disulf ? ? A CYS 56 SG ? ? ? 1_555 A CYS 101 SG ? ? A CYS 56 A CYS 101 1_555 ? ? ? ? ? ? ? 2.106 ? ? disulf3 disulf ? ? A CYS 155 SG ? ? ? 1_555 A CYS 203 SG ? ? A CYS 155 A CYS 203 1_555 ? ? ? ? ? ? ? 2.048 ? ? covale1 covale none ? A CYS 25 SG ? ? ? 1_555 B 83E . C20 ? ? A CYS 25 A 83E 300 1_555 ? ? ? ? ? ? ? 1.797 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 4 ? ASP A 6 ? ALA A 4 ASP A 6 AA1 2 HIS A 162 ? ASN A 170 ? HIS A 162 ASN A 170 AA1 3 VAL A 135 ? VAL A 139 ? VAL A 135 VAL A 139 AA2 1 ALA A 4 ? ASP A 6 ? ALA A 4 ASP A 6 AA2 2 HIS A 162 ? ASN A 170 ? HIS A 162 ASN A 170 AA2 3 TYR A 177 ? LYS A 181 ? TYR A 177 LYS A 181 AA2 4 TYR A 193 ? ALA A 197 ? TYR A 193 ALA A 197 AA2 5 VAL A 151 ? MET A 152 ? VAL A 151 MET A 152 AA3 1 ALA A 82 ? TYR A 84 ? ALA A 82 TYR A 84 AA3 2 VAL A 108 ? THR A 111 ? VAL A 108 THR A 111 AA4 1 GLY A 114 ? GLU A 117 ? GLY A 114 GLU A 117 AA4 2 SER A 210 ? VAL A 213 ? SER A 210 VAL A 213 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 5 ? N VAL A 5 O TYR A 169 ? O TYR A 169 AA1 2 3 O LEU A 166 ? O LEU A 166 N VAL A 135 ? N VAL A 135 AA2 1 2 N VAL A 5 ? N VAL A 5 O TYR A 169 ? O TYR A 169 AA2 2 3 N VAL A 167 ? N VAL A 167 O ILE A 179 ? O ILE A 179 AA2 3 4 N ILE A 180 ? N ILE A 180 O ILE A 194 ? O ILE A 194 AA2 4 5 O ARG A 195 ? O ARG A 195 N MET A 152 ? N MET A 152 AA3 1 2 N VAL A 83 ? N VAL A 83 O ALA A 110 ? O ALA A 110 AA4 1 2 N GLY A 114 ? N GLY A 114 O VAL A 213 ? O VAL A 213 # _atom_sites.entry_id 7S18 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010050 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010050 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011714 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 TRP 38 38 38 TRP TRP A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 TRP 74 74 74 TRP TRP A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 GLN 124 124 124 GLN GLN A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 TRP 128 128 128 TRP TRP A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 TRP 144 144 144 TRP TRP A . n A 1 145 MET 145 145 145 MET MET A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 MET 152 152 152 MET MET A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 CYS 155 155 155 CYS CYS A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 SER 157 157 157 SER SER A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 HIS 162 162 162 HIS HIS A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 ASN 170 170 170 ASN ASN A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 SER 172 172 172 SER SER A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 TYR 177 177 177 TYR TYR A . n A 1 178 TRP 178 178 178 TRP TRP A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 ASN 182 182 182 ASN ASN A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 TRP 184 184 184 TRP TRP A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 THR 186 186 186 THR THR A . n A 1 187 GLN 187 187 187 GLN GLN A . n A 1 188 TRP 188 188 188 TRP TRP A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 GLU 191 191 191 GLU GLU A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 TYR 193 193 193 TYR TYR A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 ARG 195 195 195 ARG ARG A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 LYS 198 198 198 LYS LYS A . n A 1 199 GLY 199 199 199 GLY GLY A . n A 1 200 SER 200 200 200 SER SER A . n A 1 201 ASN 201 201 201 ASN ASN A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 CYS 203 203 203 CYS CYS A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 LYS 206 206 206 LYS LYS A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 SER 210 210 210 SER SER A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 GLY 215 215 215 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 83E 1 300 300 83E AT2 A . C 3 HOH 1 401 7 HOH HOH A . C 3 HOH 2 402 6 HOH HOH A . C 3 HOH 3 403 8 HOH HOH A . # _pdbx_molecule_features.prd_id PRD_002486 _pdbx_molecule_features.name 'Gallinamide A analog' _pdbx_molecule_features.type ? _pdbx_molecule_features.class ? _pdbx_molecule_features.details ? # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_002486 _pdbx_molecule.asym_id B # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-03-02 2 'Structure model' 1 1 2022-03-23 3 'Structure model' 1 2 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0135 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_entry_details.entry_id 7S18 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 CYS _pdbx_validate_rmsd_angle.auth_seq_id_1 155 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 CYS _pdbx_validate_rmsd_angle.auth_seq_id_2 155 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 SG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 CYS _pdbx_validate_rmsd_angle.auth_seq_id_3 155 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 122.04 _pdbx_validate_rmsd_angle.angle_target_value 114.20 _pdbx_validate_rmsd_angle.angle_deviation 7.84 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.10 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 6 ? ? -159.89 86.29 2 1 GLN A 21 ? ? -91.37 42.77 3 1 ALA A 41 ? ? -102.34 50.80 4 1 TYR A 89 ? ? -151.00 68.15 5 1 HIS A 106 ? ? -116.48 -169.50 6 1 SER A 142 ? ? -34.09 -32.61 7 1 CYS A 155 ? ? 14.31 63.78 8 1 ASP A 161 ? ? -150.84 -7.55 9 1 ALA A 174 ? ? -24.29 -54.62 10 1 THR A 185 ? ? 75.65 166.84 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 158 ? CD ? A GLU 158 CD 2 1 Y 1 A GLU 158 ? OE1 ? A GLU 158 OE1 3 1 Y 1 A GLU 158 ? OE2 ? A GLU 158 OE2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 83E N4 N N N 1 83E C43 C N S 2 83E C42 C N N 3 83E O5 O N N 4 83E C44 C N N 5 83E C48 C N N 6 83E C47 C N N 7 83E C46 C N N 8 83E C45 C N N 9 83E N3 N N N 10 83E C37 C N S 11 83E C36 C N N 12 83E O4 O N N 13 83E C38 C N N 14 83E C39 C N N 15 83E C41 C N N 16 83E C40 C N N 17 83E N2 N N N 18 83E C31 C N S 19 83E C30 C N N 20 83E O3 O N N 21 83E C32 C N N 22 83E C33 C N N 23 83E C35 C N N 24 83E C34 C N N 25 83E C18 C N N 26 83E C19 C N N 27 83E N1 N N N 28 83E C21 C N S 29 83E C22 C N N 30 83E C23 C N N 31 83E C24 C Y N 32 83E C29 C Y N 33 83E C28 C Y N 34 83E C27 C Y N 35 83E C26 C Y N 36 83E C25 C Y N 37 83E C20 C N N 38 83E O2 O N N 39 83E C1 C N N 40 83E C2 C N N 41 83E C3 C N N 42 83E C4 C N S 43 83E C6 C Y N 44 83E C7 C Y N 45 83E C9 C Y N 46 83E C10 C Y N 47 83E C11 C Y N 48 83E C13 C Y N 49 83E C14 C Y N 50 83E C15 C Y N 51 83E N N N N 52 83E O1 O N N 53 83E O O N N 54 83E C C N N 55 83E C5 C N N 56 83E C8 C Y N 57 83E C12 C Y N 58 83E C17 C Y N 59 83E C16 C Y N 60 83E H11 H N N 61 83E H19 H N N 62 83E H13 H N N 63 83E H14 H N N 64 83E H15 H N N 65 83E H18 H N N 66 83E H16 H N N 67 83E H17 H N N 68 83E H22 H N N 69 83E H20 H N N 70 83E H21 H N N 71 83E H24 H N N 72 83E H25 H N N 73 83E H23 H N N 74 83E H26 H N N 75 83E H27 H N N 76 83E H28 H N N 77 83E H29 H N N 78 83E H30 H N N 79 83E H31 H N N 80 83E H32 H N N 81 83E H33 H N N 82 83E H34 H N N 83 83E H35 H N N 84 83E H36 H N N 85 83E H37 H N N 86 83E H38 H N N 87 83E H39 H N N 88 83E H40 H N N 89 83E H41 H N N 90 83E H42 H N N 91 83E H43 H N N 92 83E H44 H N N 93 83E H45 H N N 94 83E H46 H N N 95 83E H47 H N N 96 83E H9 H N N 97 83E H10 H N N 98 83E H48 H N N 99 83E H49 H N N 100 83E H50 H N N 101 83E H51 H N N 102 83E H52 H N N 103 83E H53 H N N 104 83E H54 H N N 105 83E H55 H N N 106 83E H56 H N N 107 83E H57 H N N 108 83E H58 H N N 109 83E H59 H N N 110 83E H60 H N N 111 83E H1 H N N 112 83E H2 H N N 113 83E H3 H N N 114 83E H4 H N N 115 83E H5 H N N 116 83E H6 H N N 117 83E H7 H N N 118 83E H8 H N N 119 83E H61 H N N 120 83E H62 H N N 121 83E H63 H N N 122 83E H64 H N N 123 83E H65 H N N 124 83E H66 H N N 125 83E H67 H N N 126 83E H68 H N N 127 ALA N N N N 128 ALA CA C N S 129 ALA C C N N 130 ALA O O N N 131 ALA CB C N N 132 ALA OXT O N N 133 ALA H H N N 134 ALA H2 H N N 135 ALA HA H N N 136 ALA HB1 H N N 137 ALA HB2 H N N 138 ALA HB3 H N N 139 ALA HXT H N N 140 ARG N N N N 141 ARG CA C N S 142 ARG C C N N 143 ARG O O N N 144 ARG CB C N N 145 ARG CG C N N 146 ARG CD C N N 147 ARG NE N N N 148 ARG CZ C N N 149 ARG NH1 N N N 150 ARG NH2 N N N 151 ARG OXT O N N 152 ARG H H N N 153 ARG H2 H N N 154 ARG HA H N N 155 ARG HB2 H N N 156 ARG HB3 H N N 157 ARG HG2 H N N 158 ARG HG3 H N N 159 ARG HD2 H N N 160 ARG HD3 H N N 161 ARG HE H N N 162 ARG HH11 H N N 163 ARG HH12 H N N 164 ARG HH21 H N N 165 ARG HH22 H N N 166 ARG HXT H N N 167 ASN N N N N 168 ASN CA C N S 169 ASN C C N N 170 ASN O O N N 171 ASN CB C N N 172 ASN CG C N N 173 ASN OD1 O N N 174 ASN ND2 N N N 175 ASN OXT O N N 176 ASN H H N N 177 ASN H2 H N N 178 ASN HA H N N 179 ASN HB2 H N N 180 ASN HB3 H N N 181 ASN HD21 H N N 182 ASN HD22 H N N 183 ASN HXT H N N 184 ASP N N N N 185 ASP CA C N S 186 ASP C C N N 187 ASP O O N N 188 ASP CB C N N 189 ASP CG C N N 190 ASP OD1 O N N 191 ASP OD2 O N N 192 ASP OXT O N N 193 ASP H H N N 194 ASP H2 H N N 195 ASP HA H N N 196 ASP HB2 H N N 197 ASP HB3 H N N 198 ASP HD2 H N N 199 ASP HXT H N N 200 CYS N N N N 201 CYS CA C N R 202 CYS C C N N 203 CYS O O N N 204 CYS CB C N N 205 CYS SG S N N 206 CYS OXT O N N 207 CYS H H N N 208 CYS H2 H N N 209 CYS HA H N N 210 CYS HB2 H N N 211 CYS HB3 H N N 212 CYS HG H N N 213 CYS HXT H N N 214 GLN N N N N 215 GLN CA C N S 216 GLN C C N N 217 GLN O O N N 218 GLN CB C N N 219 GLN CG C N N 220 GLN CD C N N 221 GLN OE1 O N N 222 GLN NE2 N N N 223 GLN OXT O N N 224 GLN H H N N 225 GLN H2 H N N 226 GLN HA H N N 227 GLN HB2 H N N 228 GLN HB3 H N N 229 GLN HG2 H N N 230 GLN HG3 H N N 231 GLN HE21 H N N 232 GLN HE22 H N N 233 GLN HXT H N N 234 GLU N N N N 235 GLU CA C N S 236 GLU C C N N 237 GLU O O N N 238 GLU CB C N N 239 GLU CG C N N 240 GLU CD C N N 241 GLU OE1 O N N 242 GLU OE2 O N N 243 GLU OXT O N N 244 GLU H H N N 245 GLU H2 H N N 246 GLU HA H N N 247 GLU HB2 H N N 248 GLU HB3 H N N 249 GLU HG2 H N N 250 GLU HG3 H N N 251 GLU HE2 H N N 252 GLU HXT H N N 253 GLY N N N N 254 GLY CA C N N 255 GLY C C N N 256 GLY O O N N 257 GLY OXT O N N 258 GLY H H N N 259 GLY H2 H N N 260 GLY HA2 H N N 261 GLY HA3 H N N 262 GLY HXT H N N 263 HIS N N N N 264 HIS CA C N S 265 HIS C C N N 266 HIS O O N N 267 HIS CB C N N 268 HIS CG C Y N 269 HIS ND1 N Y N 270 HIS CD2 C Y N 271 HIS CE1 C Y N 272 HIS NE2 N Y N 273 HIS OXT O N N 274 HIS H H N N 275 HIS H2 H N N 276 HIS HA H N N 277 HIS HB2 H N N 278 HIS HB3 H N N 279 HIS HD1 H N N 280 HIS HD2 H N N 281 HIS HE1 H N N 282 HIS HE2 H N N 283 HIS HXT H N N 284 HOH O O N N 285 HOH H1 H N N 286 HOH H2 H N N 287 ILE N N N N 288 ILE CA C N S 289 ILE C C N N 290 ILE O O N N 291 ILE CB C N S 292 ILE CG1 C N N 293 ILE CG2 C N N 294 ILE CD1 C N N 295 ILE OXT O N N 296 ILE H H N N 297 ILE H2 H N N 298 ILE HA H N N 299 ILE HB H N N 300 ILE HG12 H N N 301 ILE HG13 H N N 302 ILE HG21 H N N 303 ILE HG22 H N N 304 ILE HG23 H N N 305 ILE HD11 H N N 306 ILE HD12 H N N 307 ILE HD13 H N N 308 ILE HXT H N N 309 LEU N N N N 310 LEU CA C N S 311 LEU C C N N 312 LEU O O N N 313 LEU CB C N N 314 LEU CG C N N 315 LEU CD1 C N N 316 LEU CD2 C N N 317 LEU OXT O N N 318 LEU H H N N 319 LEU H2 H N N 320 LEU HA H N N 321 LEU HB2 H N N 322 LEU HB3 H N N 323 LEU HG H N N 324 LEU HD11 H N N 325 LEU HD12 H N N 326 LEU HD13 H N N 327 LEU HD21 H N N 328 LEU HD22 H N N 329 LEU HD23 H N N 330 LEU HXT H N N 331 LYS N N N N 332 LYS CA C N S 333 LYS C C N N 334 LYS O O N N 335 LYS CB C N N 336 LYS CG C N N 337 LYS CD C N N 338 LYS CE C N N 339 LYS NZ N N N 340 LYS OXT O N N 341 LYS H H N N 342 LYS H2 H N N 343 LYS HA H N N 344 LYS HB2 H N N 345 LYS HB3 H N N 346 LYS HG2 H N N 347 LYS HG3 H N N 348 LYS HD2 H N N 349 LYS HD3 H N N 350 LYS HE2 H N N 351 LYS HE3 H N N 352 LYS HZ1 H N N 353 LYS HZ2 H N N 354 LYS HZ3 H N N 355 LYS HXT H N N 356 MET N N N N 357 MET CA C N S 358 MET C C N N 359 MET O O N N 360 MET CB C N N 361 MET CG C N N 362 MET SD S N N 363 MET CE C N N 364 MET OXT O N N 365 MET H H N N 366 MET H2 H N N 367 MET HA H N N 368 MET HB2 H N N 369 MET HB3 H N N 370 MET HG2 H N N 371 MET HG3 H N N 372 MET HE1 H N N 373 MET HE2 H N N 374 MET HE3 H N N 375 MET HXT H N N 376 PHE N N N N 377 PHE CA C N S 378 PHE C C N N 379 PHE O O N N 380 PHE CB C N N 381 PHE CG C Y N 382 PHE CD1 C Y N 383 PHE CD2 C Y N 384 PHE CE1 C Y N 385 PHE CE2 C Y N 386 PHE CZ C Y N 387 PHE OXT O N N 388 PHE H H N N 389 PHE H2 H N N 390 PHE HA H N N 391 PHE HB2 H N N 392 PHE HB3 H N N 393 PHE HD1 H N N 394 PHE HD2 H N N 395 PHE HE1 H N N 396 PHE HE2 H N N 397 PHE HZ H N N 398 PHE HXT H N N 399 PRO N N N N 400 PRO CA C N S 401 PRO C C N N 402 PRO O O N N 403 PRO CB C N N 404 PRO CG C N N 405 PRO CD C N N 406 PRO OXT O N N 407 PRO H H N N 408 PRO HA H N N 409 PRO HB2 H N N 410 PRO HB3 H N N 411 PRO HG2 H N N 412 PRO HG3 H N N 413 PRO HD2 H N N 414 PRO HD3 H N N 415 PRO HXT H N N 416 SER N N N N 417 SER CA C N S 418 SER C C N N 419 SER O O N N 420 SER CB C N N 421 SER OG O N N 422 SER OXT O N N 423 SER H H N N 424 SER H2 H N N 425 SER HA H N N 426 SER HB2 H N N 427 SER HB3 H N N 428 SER HG H N N 429 SER HXT H N N 430 THR N N N N 431 THR CA C N S 432 THR C C N N 433 THR O O N N 434 THR CB C N R 435 THR OG1 O N N 436 THR CG2 C N N 437 THR OXT O N N 438 THR H H N N 439 THR H2 H N N 440 THR HA H N N 441 THR HB H N N 442 THR HG1 H N N 443 THR HG21 H N N 444 THR HG22 H N N 445 THR HG23 H N N 446 THR HXT H N N 447 TRP N N N N 448 TRP CA C N S 449 TRP C C N N 450 TRP O O N N 451 TRP CB C N N 452 TRP CG C Y N 453 TRP CD1 C Y N 454 TRP CD2 C Y N 455 TRP NE1 N Y N 456 TRP CE2 C Y N 457 TRP CE3 C Y N 458 TRP CZ2 C Y N 459 TRP CZ3 C Y N 460 TRP CH2 C Y N 461 TRP OXT O N N 462 TRP H H N N 463 TRP H2 H N N 464 TRP HA H N N 465 TRP HB2 H N N 466 TRP HB3 H N N 467 TRP HD1 H N N 468 TRP HE1 H N N 469 TRP HE3 H N N 470 TRP HZ2 H N N 471 TRP HZ3 H N N 472 TRP HH2 H N N 473 TRP HXT H N N 474 TYR N N N N 475 TYR CA C N S 476 TYR C C N N 477 TYR O O N N 478 TYR CB C N N 479 TYR CG C Y N 480 TYR CD1 C Y N 481 TYR CD2 C Y N 482 TYR CE1 C Y N 483 TYR CE2 C Y N 484 TYR CZ C Y N 485 TYR OH O N N 486 TYR OXT O N N 487 TYR H H N N 488 TYR H2 H N N 489 TYR HA H N N 490 TYR HB2 H N N 491 TYR HB3 H N N 492 TYR HD1 H N N 493 TYR HD2 H N N 494 TYR HE1 H N N 495 TYR HE2 H N N 496 TYR HH H N N 497 TYR HXT H N N 498 VAL N N N N 499 VAL CA C N S 500 VAL C C N N 501 VAL O O N N 502 VAL CB C N N 503 VAL CG1 C N N 504 VAL CG2 C N N 505 VAL OXT O N N 506 VAL H H N N 507 VAL H2 H N N 508 VAL HA H N N 509 VAL HB H N N 510 VAL HG11 H N N 511 VAL HG12 H N N 512 VAL HG13 H N N 513 VAL HG21 H N N 514 VAL HG22 H N N 515 VAL HG23 H N N 516 VAL HXT H N N 517 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 83E C40 C39 sing N N 1 83E O3 C30 doub N N 2 83E C41 C39 sing N N 3 83E C39 C38 sing N N 4 83E C20 C21 sing N N 5 83E C20 C19 sing N N 6 83E C21 N1 sing N N 7 83E C21 C22 sing N N 8 83E C30 N1 sing N N 9 83E C30 C31 sing N N 10 83E C38 C37 sing N N 11 83E C35 C33 sing N N 12 83E C32 C31 sing N N 13 83E C32 C33 sing N N 14 83E C29 C28 doub Y N 15 83E C29 C24 sing Y N 16 83E C23 C22 sing N N 17 83E C23 C24 sing N N 18 83E N2 C31 sing N N 19 83E N2 C36 sing N N 20 83E O2 C18 doub N N 21 83E C33 C34 sing N N 22 83E C28 C27 sing Y N 23 83E C24 C25 doub Y N 24 83E C19 C18 sing N N 25 83E C37 C36 sing N N 26 83E C37 N3 sing N N 27 83E C36 O4 doub N N 28 83E C18 N sing N N 29 83E C27 C26 doub Y N 30 83E C25 C26 sing Y N 31 83E N3 C42 sing N N 32 83E C47 N4 sing N N 33 83E O5 C42 doub N N 34 83E C5 C4 sing N N 35 83E C5 C6 sing N N 36 83E N C4 sing N N 37 83E N C3 sing N N 38 83E C4 C1 sing N N 39 83E C42 C43 sing N N 40 83E C7 C6 doub Y N 41 83E C7 C8 sing Y N 42 83E N4 C43 sing N N 43 83E N4 C48 sing N N 44 83E C6 C11 sing Y N 45 83E C3 O1 doub N N 46 83E C3 C2 sing N N 47 83E C43 C44 sing N N 48 83E C8 C9 doub Y N 49 83E C1 O sing N N 50 83E C1 C2 doub N N 51 83E C11 C10 doub Y N 52 83E O C sing N N 53 83E C46 C44 sing N N 54 83E C44 C45 sing N N 55 83E C9 C10 sing Y N 56 83E C9 C12 sing N N 57 83E C13 C12 doub Y N 58 83E C13 C14 sing Y N 59 83E C12 C17 sing Y N 60 83E C14 C15 doub Y N 61 83E C17 C16 doub Y N 62 83E C15 C16 sing Y N 63 83E C2 H1 sing N N 64 83E C4 H2 sing N N 65 83E C7 H3 sing N N 66 83E C10 H4 sing N N 67 83E C11 H5 sing N N 68 83E C13 H6 sing N N 69 83E C14 H7 sing N N 70 83E C15 H8 sing N N 71 83E C19 H9 sing N N 72 83E C19 H10 sing N N 73 83E C43 H11 sing N N 74 83E C48 H13 sing N N 75 83E C48 H14 sing N N 76 83E C48 H15 sing N N 77 83E C47 H16 sing N N 78 83E C47 H17 sing N N 79 83E C47 H18 sing N N 80 83E C44 H19 sing N N 81 83E C46 H20 sing N N 82 83E C46 H21 sing N N 83 83E C46 H22 sing N N 84 83E C45 H23 sing N N 85 83E C45 H24 sing N N 86 83E C45 H25 sing N N 87 83E N3 H26 sing N N 88 83E C37 H27 sing N N 89 83E C38 H28 sing N N 90 83E C38 H29 sing N N 91 83E C39 H30 sing N N 92 83E C41 H31 sing N N 93 83E C41 H32 sing N N 94 83E C41 H33 sing N N 95 83E C40 H34 sing N N 96 83E C40 H35 sing N N 97 83E C40 H36 sing N N 98 83E N2 H37 sing N N 99 83E C31 H38 sing N N 100 83E C32 H39 sing N N 101 83E C32 H40 sing N N 102 83E C33 H41 sing N N 103 83E C35 H42 sing N N 104 83E C35 H43 sing N N 105 83E C35 H44 sing N N 106 83E C34 H45 sing N N 107 83E C34 H46 sing N N 108 83E C34 H47 sing N N 109 83E N1 H48 sing N N 110 83E C21 H49 sing N N 111 83E C22 H50 sing N N 112 83E C22 H51 sing N N 113 83E C23 H52 sing N N 114 83E C23 H53 sing N N 115 83E C29 H54 sing N N 116 83E C28 H55 sing N N 117 83E C27 H56 sing N N 118 83E C26 H57 sing N N 119 83E C25 H58 sing N N 120 83E C20 H59 sing N N 121 83E C20 H60 sing N N 122 83E C H61 sing N N 123 83E C H62 sing N N 124 83E C H63 sing N N 125 83E C5 H64 sing N N 126 83E C5 H65 sing N N 127 83E C8 H66 sing N N 128 83E C17 H67 sing N N 129 83E C16 H68 sing N N 130 ALA N CA sing N N 131 ALA N H sing N N 132 ALA N H2 sing N N 133 ALA CA C sing N N 134 ALA CA CB sing N N 135 ALA CA HA sing N N 136 ALA C O doub N N 137 ALA C OXT sing N N 138 ALA CB HB1 sing N N 139 ALA CB HB2 sing N N 140 ALA CB HB3 sing N N 141 ALA OXT HXT sing N N 142 ARG N CA sing N N 143 ARG N H sing N N 144 ARG N H2 sing N N 145 ARG CA C sing N N 146 ARG CA CB sing N N 147 ARG CA HA sing N N 148 ARG C O doub N N 149 ARG C OXT sing N N 150 ARG CB CG sing N N 151 ARG CB HB2 sing N N 152 ARG CB HB3 sing N N 153 ARG CG CD sing N N 154 ARG CG HG2 sing N N 155 ARG CG HG3 sing N N 156 ARG CD NE sing N N 157 ARG CD HD2 sing N N 158 ARG CD HD3 sing N N 159 ARG NE CZ sing N N 160 ARG NE HE sing N N 161 ARG CZ NH1 sing N N 162 ARG CZ NH2 doub N N 163 ARG NH1 HH11 sing N N 164 ARG NH1 HH12 sing N N 165 ARG NH2 HH21 sing N N 166 ARG NH2 HH22 sing N N 167 ARG OXT HXT sing N N 168 ASN N CA sing N N 169 ASN N H sing N N 170 ASN N H2 sing N N 171 ASN CA C sing N N 172 ASN CA CB sing N N 173 ASN CA HA sing N N 174 ASN C O doub N N 175 ASN C OXT sing N N 176 ASN CB CG sing N N 177 ASN CB HB2 sing N N 178 ASN CB HB3 sing N N 179 ASN CG OD1 doub N N 180 ASN CG ND2 sing N N 181 ASN ND2 HD21 sing N N 182 ASN ND2 HD22 sing N N 183 ASN OXT HXT sing N N 184 ASP N CA sing N N 185 ASP N H sing N N 186 ASP N H2 sing N N 187 ASP CA C sing N N 188 ASP CA CB sing N N 189 ASP CA HA sing N N 190 ASP C O doub N N 191 ASP C OXT sing N N 192 ASP CB CG sing N N 193 ASP CB HB2 sing N N 194 ASP CB HB3 sing N N 195 ASP CG OD1 doub N N 196 ASP CG OD2 sing N N 197 ASP OD2 HD2 sing N N 198 ASP OXT HXT sing N N 199 CYS N CA sing N N 200 CYS N H sing N N 201 CYS N H2 sing N N 202 CYS CA C sing N N 203 CYS CA CB sing N N 204 CYS CA HA sing N N 205 CYS C O doub N N 206 CYS C OXT sing N N 207 CYS CB SG sing N N 208 CYS CB HB2 sing N N 209 CYS CB HB3 sing N N 210 CYS SG HG sing N N 211 CYS OXT HXT sing N N 212 GLN N CA sing N N 213 GLN N H sing N N 214 GLN N H2 sing N N 215 GLN CA C sing N N 216 GLN CA CB sing N N 217 GLN CA HA sing N N 218 GLN C O doub N N 219 GLN C OXT sing N N 220 GLN CB CG sing N N 221 GLN CB HB2 sing N N 222 GLN CB HB3 sing N N 223 GLN CG CD sing N N 224 GLN CG HG2 sing N N 225 GLN CG HG3 sing N N 226 GLN CD OE1 doub N N 227 GLN CD NE2 sing N N 228 GLN NE2 HE21 sing N N 229 GLN NE2 HE22 sing N N 230 GLN OXT HXT sing N N 231 GLU N CA sing N N 232 GLU N H sing N N 233 GLU N H2 sing N N 234 GLU CA C sing N N 235 GLU CA CB sing N N 236 GLU CA HA sing N N 237 GLU C O doub N N 238 GLU C OXT sing N N 239 GLU CB CG sing N N 240 GLU CB HB2 sing N N 241 GLU CB HB3 sing N N 242 GLU CG CD sing N N 243 GLU CG HG2 sing N N 244 GLU CG HG3 sing N N 245 GLU CD OE1 doub N N 246 GLU CD OE2 sing N N 247 GLU OE2 HE2 sing N N 248 GLU OXT HXT sing N N 249 GLY N CA sing N N 250 GLY N H sing N N 251 GLY N H2 sing N N 252 GLY CA C sing N N 253 GLY CA HA2 sing N N 254 GLY CA HA3 sing N N 255 GLY C O doub N N 256 GLY C OXT sing N N 257 GLY OXT HXT sing N N 258 HIS N CA sing N N 259 HIS N H sing N N 260 HIS N H2 sing N N 261 HIS CA C sing N N 262 HIS CA CB sing N N 263 HIS CA HA sing N N 264 HIS C O doub N N 265 HIS C OXT sing N N 266 HIS CB CG sing N N 267 HIS CB HB2 sing N N 268 HIS CB HB3 sing N N 269 HIS CG ND1 sing Y N 270 HIS CG CD2 doub Y N 271 HIS ND1 CE1 doub Y N 272 HIS ND1 HD1 sing N N 273 HIS CD2 NE2 sing Y N 274 HIS CD2 HD2 sing N N 275 HIS CE1 NE2 sing Y N 276 HIS CE1 HE1 sing N N 277 HIS NE2 HE2 sing N N 278 HIS OXT HXT sing N N 279 HOH O H1 sing N N 280 HOH O H2 sing N N 281 ILE N CA sing N N 282 ILE N H sing N N 283 ILE N H2 sing N N 284 ILE CA C sing N N 285 ILE CA CB sing N N 286 ILE CA HA sing N N 287 ILE C O doub N N 288 ILE C OXT sing N N 289 ILE CB CG1 sing N N 290 ILE CB CG2 sing N N 291 ILE CB HB sing N N 292 ILE CG1 CD1 sing N N 293 ILE CG1 HG12 sing N N 294 ILE CG1 HG13 sing N N 295 ILE CG2 HG21 sing N N 296 ILE CG2 HG22 sing N N 297 ILE CG2 HG23 sing N N 298 ILE CD1 HD11 sing N N 299 ILE CD1 HD12 sing N N 300 ILE CD1 HD13 sing N N 301 ILE OXT HXT sing N N 302 LEU N CA sing N N 303 LEU N H sing N N 304 LEU N H2 sing N N 305 LEU CA C sing N N 306 LEU CA CB sing N N 307 LEU CA HA sing N N 308 LEU C O doub N N 309 LEU C OXT sing N N 310 LEU CB CG sing N N 311 LEU CB HB2 sing N N 312 LEU CB HB3 sing N N 313 LEU CG CD1 sing N N 314 LEU CG CD2 sing N N 315 LEU CG HG sing N N 316 LEU CD1 HD11 sing N N 317 LEU CD1 HD12 sing N N 318 LEU CD1 HD13 sing N N 319 LEU CD2 HD21 sing N N 320 LEU CD2 HD22 sing N N 321 LEU CD2 HD23 sing N N 322 LEU OXT HXT sing N N 323 LYS N CA sing N N 324 LYS N H sing N N 325 LYS N H2 sing N N 326 LYS CA C sing N N 327 LYS CA CB sing N N 328 LYS CA HA sing N N 329 LYS C O doub N N 330 LYS C OXT sing N N 331 LYS CB CG sing N N 332 LYS CB HB2 sing N N 333 LYS CB HB3 sing N N 334 LYS CG CD sing N N 335 LYS CG HG2 sing N N 336 LYS CG HG3 sing N N 337 LYS CD CE sing N N 338 LYS CD HD2 sing N N 339 LYS CD HD3 sing N N 340 LYS CE NZ sing N N 341 LYS CE HE2 sing N N 342 LYS CE HE3 sing N N 343 LYS NZ HZ1 sing N N 344 LYS NZ HZ2 sing N N 345 LYS NZ HZ3 sing N N 346 LYS OXT HXT sing N N 347 MET N CA sing N N 348 MET N H sing N N 349 MET N H2 sing N N 350 MET CA C sing N N 351 MET CA CB sing N N 352 MET CA HA sing N N 353 MET C O doub N N 354 MET C OXT sing N N 355 MET CB CG sing N N 356 MET CB HB2 sing N N 357 MET CB HB3 sing N N 358 MET CG SD sing N N 359 MET CG HG2 sing N N 360 MET CG HG3 sing N N 361 MET SD CE sing N N 362 MET CE HE1 sing N N 363 MET CE HE2 sing N N 364 MET CE HE3 sing N N 365 MET OXT HXT sing N N 366 PHE N CA sing N N 367 PHE N H sing N N 368 PHE N H2 sing N N 369 PHE CA C sing N N 370 PHE CA CB sing N N 371 PHE CA HA sing N N 372 PHE C O doub N N 373 PHE C OXT sing N N 374 PHE CB CG sing N N 375 PHE CB HB2 sing N N 376 PHE CB HB3 sing N N 377 PHE CG CD1 doub Y N 378 PHE CG CD2 sing Y N 379 PHE CD1 CE1 sing Y N 380 PHE CD1 HD1 sing N N 381 PHE CD2 CE2 doub Y N 382 PHE CD2 HD2 sing N N 383 PHE CE1 CZ doub Y N 384 PHE CE1 HE1 sing N N 385 PHE CE2 CZ sing Y N 386 PHE CE2 HE2 sing N N 387 PHE CZ HZ sing N N 388 PHE OXT HXT sing N N 389 PRO N CA sing N N 390 PRO N CD sing N N 391 PRO N H sing N N 392 PRO CA C sing N N 393 PRO CA CB sing N N 394 PRO CA HA sing N N 395 PRO C O doub N N 396 PRO C OXT sing N N 397 PRO CB CG sing N N 398 PRO CB HB2 sing N N 399 PRO CB HB3 sing N N 400 PRO CG CD sing N N 401 PRO CG HG2 sing N N 402 PRO CG HG3 sing N N 403 PRO CD HD2 sing N N 404 PRO CD HD3 sing N N 405 PRO OXT HXT sing N N 406 SER N CA sing N N 407 SER N H sing N N 408 SER N H2 sing N N 409 SER CA C sing N N 410 SER CA CB sing N N 411 SER CA HA sing N N 412 SER C O doub N N 413 SER C OXT sing N N 414 SER CB OG sing N N 415 SER CB HB2 sing N N 416 SER CB HB3 sing N N 417 SER OG HG sing N N 418 SER OXT HXT sing N N 419 THR N CA sing N N 420 THR N H sing N N 421 THR N H2 sing N N 422 THR CA C sing N N 423 THR CA CB sing N N 424 THR CA HA sing N N 425 THR C O doub N N 426 THR C OXT sing N N 427 THR CB OG1 sing N N 428 THR CB CG2 sing N N 429 THR CB HB sing N N 430 THR OG1 HG1 sing N N 431 THR CG2 HG21 sing N N 432 THR CG2 HG22 sing N N 433 THR CG2 HG23 sing N N 434 THR OXT HXT sing N N 435 TRP N CA sing N N 436 TRP N H sing N N 437 TRP N H2 sing N N 438 TRP CA C sing N N 439 TRP CA CB sing N N 440 TRP CA HA sing N N 441 TRP C O doub N N 442 TRP C OXT sing N N 443 TRP CB CG sing N N 444 TRP CB HB2 sing N N 445 TRP CB HB3 sing N N 446 TRP CG CD1 doub Y N 447 TRP CG CD2 sing Y N 448 TRP CD1 NE1 sing Y N 449 TRP CD1 HD1 sing N N 450 TRP CD2 CE2 doub Y N 451 TRP CD2 CE3 sing Y N 452 TRP NE1 CE2 sing Y N 453 TRP NE1 HE1 sing N N 454 TRP CE2 CZ2 sing Y N 455 TRP CE3 CZ3 doub Y N 456 TRP CE3 HE3 sing N N 457 TRP CZ2 CH2 doub Y N 458 TRP CZ2 HZ2 sing N N 459 TRP CZ3 CH2 sing Y N 460 TRP CZ3 HZ3 sing N N 461 TRP CH2 HH2 sing N N 462 TRP OXT HXT sing N N 463 TYR N CA sing N N 464 TYR N H sing N N 465 TYR N H2 sing N N 466 TYR CA C sing N N 467 TYR CA CB sing N N 468 TYR CA HA sing N N 469 TYR C O doub N N 470 TYR C OXT sing N N 471 TYR CB CG sing N N 472 TYR CB HB2 sing N N 473 TYR CB HB3 sing N N 474 TYR CG CD1 doub Y N 475 TYR CG CD2 sing Y N 476 TYR CD1 CE1 sing Y N 477 TYR CD1 HD1 sing N N 478 TYR CD2 CE2 doub Y N 479 TYR CD2 HD2 sing N N 480 TYR CE1 CZ doub Y N 481 TYR CE1 HE1 sing N N 482 TYR CE2 CZ sing Y N 483 TYR CE2 HE2 sing N N 484 TYR CZ OH sing N N 485 TYR OH HH sing N N 486 TYR OXT HXT sing N N 487 VAL N CA sing N N 488 VAL N H sing N N 489 VAL N H2 sing N N 490 VAL CA C sing N N 491 VAL CA CB sing N N 492 VAL CA HA sing N N 493 VAL C O doub N N 494 VAL C OXT sing N N 495 VAL CB CG1 sing N N 496 VAL CB CG2 sing N N 497 VAL CB HB sing N N 498 VAL CG1 HG11 sing N N 499 VAL CG1 HG12 sing N N 500 VAL CG1 HG13 sing N N 501 VAL CG2 HG21 sing N N 502 VAL CG2 HG22 sing N N 503 VAL CG2 HG23 sing N N 504 VAL OXT HXT sing N N 505 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R21AI127505 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 83E _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 83E _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;N,N-dimethyl-L-valyl-L-leucyl-N-[(3S)-6-{(2S)-2-[([1,1'-biphenyl]-4-yl)methyl]-3-methoxy-5-oxo-2,5-dihydro-1H-pyrrol-1-yl}-6-oxo-1-phenylhexan-3-yl]-L-leucinamide ; 83E 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3KKU _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #