data_7S7P # _entry.id 7S7P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7S7P pdb_00007s7p 10.2210/pdb7s7p/pdb WWPDB D_1000259632 ? ? BMRB 30951 ? 10.13018/BMR30951 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-07-27 2 'Structure model' 1 1 2022-08-10 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Other 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' pdbx_database_status 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 3 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7S7P _pdbx_database_status.recvd_initial_deposition_date 2021-09-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR solution structure of a neurotoxic thionin from Urtica ferox' _pdbx_database_related.db_id 30951 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Durek, T.' 1 0000-0003-0686-227X 'Harvey, P.J.' 2 ? 'Craik, D.J.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 298 _citation.language ? _citation.page_first 102218 _citation.page_last 102218 _citation.title 'Neurotoxic and cytotoxic peptides underlie the painful stings of the tree nettle Urtica ferox.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jbc.2022.102218 _citation.pdbx_database_id_PubMed 35780839 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xie, J.' 1 ? primary 'Robinson, S.D.' 2 ? primary 'Gilding, E.K.' 3 ? primary 'Jami, S.' 4 ? primary 'Deuis, J.R.' 5 ? primary 'Rehm, F.B.H.' 6 ? primary 'Yap, K.' 7 ? primary 'Ragnarsson, L.' 8 ? primary 'Chan, L.Y.' 9 ? primary 'Hamilton, B.R.' 10 ? primary 'Harvey, P.J.' 11 ? primary 'Craik, D.J.' 12 ? primary 'Vetter, I.' 13 ? primary 'Durek, T.' 14 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description urthionin-Uf1a _entity.formula_weight 4379.144 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KSCCPSTTARNIYNTCRFGGGSRTLCAKLSGCKIVSGTTCPK _entity_poly.pdbx_seq_one_letter_code_can KSCCPSTTARNIYNTCRFGGGSRTLCAKLSGCKIVSGTTCPK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 SER n 1 3 CYS n 1 4 CYS n 1 5 PRO n 1 6 SER n 1 7 THR n 1 8 THR n 1 9 ALA n 1 10 ARG n 1 11 ASN n 1 12 ILE n 1 13 TYR n 1 14 ASN n 1 15 THR n 1 16 CYS n 1 17 ARG n 1 18 PHE n 1 19 GLY n 1 20 GLY n 1 21 GLY n 1 22 SER n 1 23 ARG n 1 24 THR n 1 25 LEU n 1 26 CYS n 1 27 ALA n 1 28 LYS n 1 29 LEU n 1 30 SER n 1 31 GLY n 1 32 CYS n 1 33 LYS n 1 34 ILE n 1 35 VAL n 1 36 SER n 1 37 GLY n 1 38 THR n 1 39 THR n 1 40 CYS n 1 41 PRO n 1 42 LYS n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 42 _pdbx_entity_src_syn.organism_scientific 'Urtica ferox' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 1435581 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 LYS 42 42 42 LYS LYS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7S7P _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7S7P _struct.title 'NMR solution structure of a neurotoxic thionin from Urtica ferox' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7S7P _struct_keywords.text 'thionin, plant, defensin, stinging nettle, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7S7P _struct_ref.pdbx_db_accession 7S7P _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7S7P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 42 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7S7P _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 42 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 42 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 6 ? GLY A 20 ? SER A 6 GLY A 20 1 ? 15 HELX_P HELX_P2 AA2 SER A 22 ? GLY A 31 ? SER A 22 GLY A 31 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 40 SG ? ? A CYS 3 A CYS 40 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf2 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 4 A CYS 32 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf3 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 16 A CYS 26 1_555 ? ? ? ? ? ? ? 2.045 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 3 ? CYS A 40 ? CYS A 3 ? 1_555 CYS A 40 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 4 ? CYS A 32 ? CYS A 4 ? 1_555 CYS A 32 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 16 ? CYS A 26 ? CYS A 16 ? 1_555 CYS A 26 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 2 ? CYS A 3 ? SER A 2 CYS A 3 AA1 2 LYS A 33 ? ILE A 34 ? LYS A 33 ILE A 34 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id CYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 3 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 3 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 33 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 33 # _pdbx_entry_details.entry_id 7S7P _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ1 A LYS 33 ? ? OXT A LYS 42 ? ? 1.57 2 7 HZ1 A LYS 33 ? ? OXT A LYS 42 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 3 SER A 36 ? ? -47.44 -70.75 2 3 CYS A 40 ? ? -163.43 97.70 3 7 CYS A 40 ? ? -164.82 107.63 # _pdbx_nmr_ensemble.entry_id 7S7P _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7S7P _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '4.4 mg/mL Urthi-1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label Urthi-1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '2.2 mg of Urthi in 500 microliter of 90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component Urthi-1 _pdbx_nmr_exptl_sample.concentration 4.4 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mg/mL _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'not defined' _pdbx_nmr_exptl_sample_conditions.details none _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label NMR_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err 0.1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '2D 1H-13C HSQC' 1 isotropic 4 1 1 '2D 1H-15N HSQC' 1 isotropic # _pdbx_nmr_refine.entry_id 7S7P _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger A. T. et.al.' 2 refinement CYANA 3.98.13 Guentert 3 processing TopSpin ? 'Bruker Biospin' 4 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 5 'structure calculation' CYANA 3.98.13 Guentert # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLY N N N N 72 GLY CA C N N 73 GLY C C N N 74 GLY O O N N 75 GLY OXT O N N 76 GLY H H N N 77 GLY H2 H N N 78 GLY HA2 H N N 79 GLY HA3 H N N 80 GLY HXT H N N 81 ILE N N N N 82 ILE CA C N S 83 ILE C C N N 84 ILE O O N N 85 ILE CB C N S 86 ILE CG1 C N N 87 ILE CG2 C N N 88 ILE CD1 C N N 89 ILE OXT O N N 90 ILE H H N N 91 ILE H2 H N N 92 ILE HA H N N 93 ILE HB H N N 94 ILE HG12 H N N 95 ILE HG13 H N N 96 ILE HG21 H N N 97 ILE HG22 H N N 98 ILE HG23 H N N 99 ILE HD11 H N N 100 ILE HD12 H N N 101 ILE HD13 H N N 102 ILE HXT H N N 103 LEU N N N N 104 LEU CA C N S 105 LEU C C N N 106 LEU O O N N 107 LEU CB C N N 108 LEU CG C N N 109 LEU CD1 C N N 110 LEU CD2 C N N 111 LEU OXT O N N 112 LEU H H N N 113 LEU H2 H N N 114 LEU HA H N N 115 LEU HB2 H N N 116 LEU HB3 H N N 117 LEU HG H N N 118 LEU HD11 H N N 119 LEU HD12 H N N 120 LEU HD13 H N N 121 LEU HD21 H N N 122 LEU HD22 H N N 123 LEU HD23 H N N 124 LEU HXT H N N 125 LYS N N N N 126 LYS CA C N S 127 LYS C C N N 128 LYS O O N N 129 LYS CB C N N 130 LYS CG C N N 131 LYS CD C N N 132 LYS CE C N N 133 LYS NZ N N N 134 LYS OXT O N N 135 LYS H H N N 136 LYS H2 H N N 137 LYS HA H N N 138 LYS HB2 H N N 139 LYS HB3 H N N 140 LYS HG2 H N N 141 LYS HG3 H N N 142 LYS HD2 H N N 143 LYS HD3 H N N 144 LYS HE2 H N N 145 LYS HE3 H N N 146 LYS HZ1 H N N 147 LYS HZ2 H N N 148 LYS HZ3 H N N 149 LYS HXT H N N 150 PHE N N N N 151 PHE CA C N S 152 PHE C C N N 153 PHE O O N N 154 PHE CB C N N 155 PHE CG C Y N 156 PHE CD1 C Y N 157 PHE CD2 C Y N 158 PHE CE1 C Y N 159 PHE CE2 C Y N 160 PHE CZ C Y N 161 PHE OXT O N N 162 PHE H H N N 163 PHE H2 H N N 164 PHE HA H N N 165 PHE HB2 H N N 166 PHE HB3 H N N 167 PHE HD1 H N N 168 PHE HD2 H N N 169 PHE HE1 H N N 170 PHE HE2 H N N 171 PHE HZ H N N 172 PHE HXT H N N 173 PRO N N N N 174 PRO CA C N S 175 PRO C C N N 176 PRO O O N N 177 PRO CB C N N 178 PRO CG C N N 179 PRO CD C N N 180 PRO OXT O N N 181 PRO H H N N 182 PRO HA H N N 183 PRO HB2 H N N 184 PRO HB3 H N N 185 PRO HG2 H N N 186 PRO HG3 H N N 187 PRO HD2 H N N 188 PRO HD3 H N N 189 PRO HXT H N N 190 SER N N N N 191 SER CA C N S 192 SER C C N N 193 SER O O N N 194 SER CB C N N 195 SER OG O N N 196 SER OXT O N N 197 SER H H N N 198 SER H2 H N N 199 SER HA H N N 200 SER HB2 H N N 201 SER HB3 H N N 202 SER HG H N N 203 SER HXT H N N 204 THR N N N N 205 THR CA C N S 206 THR C C N N 207 THR O O N N 208 THR CB C N R 209 THR OG1 O N N 210 THR CG2 C N N 211 THR OXT O N N 212 THR H H N N 213 THR H2 H N N 214 THR HA H N N 215 THR HB H N N 216 THR HG1 H N N 217 THR HG21 H N N 218 THR HG22 H N N 219 THR HG23 H N N 220 THR HXT H N N 221 TYR N N N N 222 TYR CA C N S 223 TYR C C N N 224 TYR O O N N 225 TYR CB C N N 226 TYR CG C Y N 227 TYR CD1 C Y N 228 TYR CD2 C Y N 229 TYR CE1 C Y N 230 TYR CE2 C Y N 231 TYR CZ C Y N 232 TYR OH O N N 233 TYR OXT O N N 234 TYR H H N N 235 TYR H2 H N N 236 TYR HA H N N 237 TYR HB2 H N N 238 TYR HB3 H N N 239 TYR HD1 H N N 240 TYR HD2 H N N 241 TYR HE1 H N N 242 TYR HE2 H N N 243 TYR HH H N N 244 TYR HXT H N N 245 VAL N N N N 246 VAL CA C N S 247 VAL C C N N 248 VAL O O N N 249 VAL CB C N N 250 VAL CG1 C N N 251 VAL CG2 C N N 252 VAL OXT O N N 253 VAL H H N N 254 VAL H2 H N N 255 VAL HA H N N 256 VAL HB H N N 257 VAL HG11 H N N 258 VAL HG12 H N N 259 VAL HG13 H N N 260 VAL HG21 H N N 261 VAL HG22 H N N 262 VAL HG23 H N N 263 VAL HXT H N N 264 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLY N CA sing N N 68 GLY N H sing N N 69 GLY N H2 sing N N 70 GLY CA C sing N N 71 GLY CA HA2 sing N N 72 GLY CA HA3 sing N N 73 GLY C O doub N N 74 GLY C OXT sing N N 75 GLY OXT HXT sing N N 76 ILE N CA sing N N 77 ILE N H sing N N 78 ILE N H2 sing N N 79 ILE CA C sing N N 80 ILE CA CB sing N N 81 ILE CA HA sing N N 82 ILE C O doub N N 83 ILE C OXT sing N N 84 ILE CB CG1 sing N N 85 ILE CB CG2 sing N N 86 ILE CB HB sing N N 87 ILE CG1 CD1 sing N N 88 ILE CG1 HG12 sing N N 89 ILE CG1 HG13 sing N N 90 ILE CG2 HG21 sing N N 91 ILE CG2 HG22 sing N N 92 ILE CG2 HG23 sing N N 93 ILE CD1 HD11 sing N N 94 ILE CD1 HD12 sing N N 95 ILE CD1 HD13 sing N N 96 ILE OXT HXT sing N N 97 LEU N CA sing N N 98 LEU N H sing N N 99 LEU N H2 sing N N 100 LEU CA C sing N N 101 LEU CA CB sing N N 102 LEU CA HA sing N N 103 LEU C O doub N N 104 LEU C OXT sing N N 105 LEU CB CG sing N N 106 LEU CB HB2 sing N N 107 LEU CB HB3 sing N N 108 LEU CG CD1 sing N N 109 LEU CG CD2 sing N N 110 LEU CG HG sing N N 111 LEU CD1 HD11 sing N N 112 LEU CD1 HD12 sing N N 113 LEU CD1 HD13 sing N N 114 LEU CD2 HD21 sing N N 115 LEU CD2 HD22 sing N N 116 LEU CD2 HD23 sing N N 117 LEU OXT HXT sing N N 118 LYS N CA sing N N 119 LYS N H sing N N 120 LYS N H2 sing N N 121 LYS CA C sing N N 122 LYS CA CB sing N N 123 LYS CA HA sing N N 124 LYS C O doub N N 125 LYS C OXT sing N N 126 LYS CB CG sing N N 127 LYS CB HB2 sing N N 128 LYS CB HB3 sing N N 129 LYS CG CD sing N N 130 LYS CG HG2 sing N N 131 LYS CG HG3 sing N N 132 LYS CD CE sing N N 133 LYS CD HD2 sing N N 134 LYS CD HD3 sing N N 135 LYS CE NZ sing N N 136 LYS CE HE2 sing N N 137 LYS CE HE3 sing N N 138 LYS NZ HZ1 sing N N 139 LYS NZ HZ2 sing N N 140 LYS NZ HZ3 sing N N 141 LYS OXT HXT sing N N 142 PHE N CA sing N N 143 PHE N H sing N N 144 PHE N H2 sing N N 145 PHE CA C sing N N 146 PHE CA CB sing N N 147 PHE CA HA sing N N 148 PHE C O doub N N 149 PHE C OXT sing N N 150 PHE CB CG sing N N 151 PHE CB HB2 sing N N 152 PHE CB HB3 sing N N 153 PHE CG CD1 doub Y N 154 PHE CG CD2 sing Y N 155 PHE CD1 CE1 sing Y N 156 PHE CD1 HD1 sing N N 157 PHE CD2 CE2 doub Y N 158 PHE CD2 HD2 sing N N 159 PHE CE1 CZ doub Y N 160 PHE CE1 HE1 sing N N 161 PHE CE2 CZ sing Y N 162 PHE CE2 HE2 sing N N 163 PHE CZ HZ sing N N 164 PHE OXT HXT sing N N 165 PRO N CA sing N N 166 PRO N CD sing N N 167 PRO N H sing N N 168 PRO CA C sing N N 169 PRO CA CB sing N N 170 PRO CA HA sing N N 171 PRO C O doub N N 172 PRO C OXT sing N N 173 PRO CB CG sing N N 174 PRO CB HB2 sing N N 175 PRO CB HB3 sing N N 176 PRO CG CD sing N N 177 PRO CG HG2 sing N N 178 PRO CG HG3 sing N N 179 PRO CD HD2 sing N N 180 PRO CD HD3 sing N N 181 PRO OXT HXT sing N N 182 SER N CA sing N N 183 SER N H sing N N 184 SER N H2 sing N N 185 SER CA C sing N N 186 SER CA CB sing N N 187 SER CA HA sing N N 188 SER C O doub N N 189 SER C OXT sing N N 190 SER CB OG sing N N 191 SER CB HB2 sing N N 192 SER CB HB3 sing N N 193 SER OG HG sing N N 194 SER OXT HXT sing N N 195 THR N CA sing N N 196 THR N H sing N N 197 THR N H2 sing N N 198 THR CA C sing N N 199 THR CA CB sing N N 200 THR CA HA sing N N 201 THR C O doub N N 202 THR C OXT sing N N 203 THR CB OG1 sing N N 204 THR CB CG2 sing N N 205 THR CB HB sing N N 206 THR OG1 HG1 sing N N 207 THR CG2 HG21 sing N N 208 THR CG2 HG22 sing N N 209 THR CG2 HG23 sing N N 210 THR OXT HXT sing N N 211 TYR N CA sing N N 212 TYR N H sing N N 213 TYR N H2 sing N N 214 TYR CA C sing N N 215 TYR CA CB sing N N 216 TYR CA HA sing N N 217 TYR C O doub N N 218 TYR C OXT sing N N 219 TYR CB CG sing N N 220 TYR CB HB2 sing N N 221 TYR CB HB3 sing N N 222 TYR CG CD1 doub Y N 223 TYR CG CD2 sing Y N 224 TYR CD1 CE1 sing Y N 225 TYR CD1 HD1 sing N N 226 TYR CD2 CE2 doub Y N 227 TYR CD2 HD2 sing N N 228 TYR CE1 CZ doub Y N 229 TYR CE1 HE1 sing N N 230 TYR CE2 CZ sing Y N 231 TYR CE2 HE2 sing N N 232 TYR CZ OH sing N N 233 TYR OH HH sing N N 234 TYR OXT HXT sing N N 235 VAL N CA sing N N 236 VAL N H sing N N 237 VAL N H2 sing N N 238 VAL CA C sing N N 239 VAL CA CB sing N N 240 VAL CA HA sing N N 241 VAL C O doub N N 242 VAL C OXT sing N N 243 VAL CB CG1 sing N N 244 VAL CB CG2 sing N N 245 VAL CB HB sing N N 246 VAL CG1 HG11 sing N N 247 VAL CG1 HG12 sing N N 248 VAL CG1 HG13 sing N N 249 VAL CG2 HG21 sing N N 250 VAL CG2 HG22 sing N N 251 VAL CG2 HG23 sing N N 252 VAL OXT HXT sing N N 253 # _pdbx_audit_support.funding_organization 'Australian Research Council (ARC)' _pdbx_audit_support.country Australia _pdbx_audit_support.grant_number DP200102377 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III HD' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7S7P _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #