data_7SAF # _entry.id 7SAF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7SAF pdb_00007saf 10.2210/pdb7saf/pdb WWPDB D_1000259902 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7SAF _pdbx_database_status.recvd_initial_deposition_date 2021-09-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kolesinski, P.' 1 0000-0001-6034-8445 'Ghosh, P.' 2 0000-0003-0254-5218 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Elife _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2050-084X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'An M protein coiled coil unfurls and exposes its hydrophobic core to capture LL-37' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.7554/eLife.77989 _citation.pdbx_database_id_PubMed 35726694 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kolesinski, P.' 1 ? primary 'Wang, K.C.' 2 ? primary 'Hirose, Y.' 3 ? primary 'Nizet, V.' 4 ? primary 'Ghosh, P.' 5 ? primary 'Stallings, C.L.' 6 ? primary 'Dotsch, V.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7SAF _cell.details ? _cell.formula_units_Z ? _cell.length_a 97.223 _cell.length_a_esd ? _cell.length_b 97.223 _cell.length_b_esd ? _cell.length_c 40.681 _cell.length_c_esd ? _cell.volume 384533.429 _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7SAF _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall 'P 4nw 2abw' _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'General control transcription factor GCN4/M protein chimera' 8542.565 2 ? ? ? ;Amino acids 35-38: partial PreScission protease site; amino acids 39-67: GCN4 adaptor - GCN4 from Saccharomyces cerevisiae (amino acids 250-278); amino acids 68-105: M87 protein fragment from Streptococcus pyogenes (amino acids 68-105) ; 2 non-polymer syn 'PHOSPHATE ION' 94.971 2 ? ? ? ? 3 water nat water 18.015 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Amino acid biosynthesis regulatory protein,General control protein GCN4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPGSMKQLEDKVEELLSKNYHLENEVARLKKLVSKLEKQLEEAQKDYSEIEGKLEQFWHDYDKLEKENKEY _entity_poly.pdbx_seq_one_letter_code_can GPGSMKQLEDKVEELLSKNYHLENEVARLKKLVSKLEKQLEEAQKDYSEIEGKLEQFWHDYDKLEKENKEY _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 MET n 1 6 LYS n 1 7 GLN n 1 8 LEU n 1 9 GLU n 1 10 ASP n 1 11 LYS n 1 12 VAL n 1 13 GLU n 1 14 GLU n 1 15 LEU n 1 16 LEU n 1 17 SER n 1 18 LYS n 1 19 ASN n 1 20 TYR n 1 21 HIS n 1 22 LEU n 1 23 GLU n 1 24 ASN n 1 25 GLU n 1 26 VAL n 1 27 ALA n 1 28 ARG n 1 29 LEU n 1 30 LYS n 1 31 LYS n 1 32 LEU n 1 33 VAL n 1 34 SER n 1 35 LYS n 1 36 LEU n 1 37 GLU n 1 38 LYS n 1 39 GLN n 1 40 LEU n 1 41 GLU n 1 42 GLU n 1 43 ALA n 1 44 GLN n 1 45 LYS n 1 46 ASP n 1 47 TYR n 1 48 SER n 1 49 GLU n 1 50 ILE n 1 51 GLU n 1 52 GLY n 1 53 LYS n 1 54 LEU n 1 55 GLU n 1 56 GLN n 1 57 PHE n 1 58 TRP n 1 59 HIS n 1 60 ASP n 1 61 TYR n 1 62 ASP n 1 63 LYS n 1 64 LEU n 1 65 GLU n 1 66 LYS n 1 67 GLU n 1 68 ASN n 1 69 LYS n 1 70 GLU n 1 71 TYR n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 33 ;Baker's yeast ; ? 'GCN4, AAS101, AAS3, ARG9, YEL009C' ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; 866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 34 71 ? ? emm ? ? ? ? ? ? 'Streptococcus pyogenes' 1314 ? ? ? ? ? ? ? ? ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; 866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP GCN4_YEAST P03069 ? 1 MKQLEDKVEELLSKNYHLENEVARLKKLV 250 2 UNP Q6TLP8_STRPY Q6TLP8 ? 1 SKLEKQLEEAQKDYSEIEGKLEQFWHDYDKLEKENKEY 49 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7SAF A 5 ? 33 ? P03069 250 ? 278 ? 39 67 2 2 7SAF A 34 ? 71 ? Q6TLP8 49 ? 86 ? 68 105 3 1 7SAF B 5 ? 33 ? P03069 250 ? 278 ? 39 67 4 2 7SAF B 34 ? 71 ? Q6TLP8 49 ? 86 ? 68 105 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7SAF GLY A 1 ? UNP P03069 ? ? 'expression tag' 35 1 1 7SAF PRO A 2 ? UNP P03069 ? ? 'expression tag' 36 2 1 7SAF GLY A 3 ? UNP P03069 ? ? 'expression tag' 37 3 1 7SAF SER A 4 ? UNP P03069 ? ? 'expression tag' 38 4 3 7SAF GLY B 1 ? UNP P03069 ? ? 'expression tag' 35 5 3 7SAF PRO B 2 ? UNP P03069 ? ? 'expression tag' 36 6 3 7SAF GLY B 3 ? UNP P03069 ? ? 'expression tag' 37 7 3 7SAF SER B 4 ? UNP P03069 ? ? 'expression tag' 38 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7SAF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.81 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.28 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.6 M monobasic ammonium phosphate, 0.1 M Tris-HCl, pH 8.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-02-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 55.23 _reflns.entry_id 7SAF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.45 _reflns.d_resolution_low 43.48 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7580 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.75 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.1 _reflns.pdbx_Rmerge_I_obs 0.3865 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 31.40 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.4042 _reflns.pdbx_Rpim_I_all 0.1165 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.987 _reflns.pdbx_CC_star 0.997 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.45 _reflns_shell.d_res_low 2.538 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.78 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 738 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 4.684 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 4.911 _reflns_shell.pdbx_Rpim_I_all 1.459 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.556 _reflns_shell.pdbx_CC_star 0.846 _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 76.91 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7SAF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.45 _refine.ls_d_res_low 43.48 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7563 _refine.ls_number_reflns_R_free 383 _refine.ls_number_reflns_R_work 7180 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.76 _refine.ls_percent_reflns_R_free 5.06 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2581 _refine.ls_R_factor_R_free 0.2717 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2574 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1KQL _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.9661 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3889 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.45 _refine_hist.d_res_low 43.48 _refine_hist.number_atoms_solvent 2 _refine_hist.number_atoms_total 1058 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1046 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0072 ? 1070 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8697 ? 1447 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0391 ? 157 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0043 ? 189 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.1067 ? 140 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.45 2.80 . . 120 2330 99.88 . . . 0.3807 . 0.2920 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.80 3.53 . . 110 2376 99.92 . . . 0.3184 . 0.3070 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.53 43.48 . . 153 2474 99.55 . . . 0.2454 . 0.2331 . . . . . . . . . . . # _struct.entry_id 7SAF _struct.title 'Fragment of streptococcal M87 protein fused to GCN4 adaptor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7SAF _struct_keywords.text 'coiled-coil, virulence factor, CELL ADHESION' _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 4 ? LYS A 63 ? SER A 38 LYS A 97 1 ? 60 HELX_P HELX_P2 AA2 GLY B 3 ? GLU B 70 ? GLY B 37 GLU B 104 1 ? 68 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 7SAF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010286 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010286 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024581 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 35 ? ? ? A . n A 1 2 PRO 2 36 ? ? ? A . n A 1 3 GLY 3 37 ? ? ? A . n A 1 4 SER 4 38 38 SER SER A . n A 1 5 MET 5 39 39 MET MET A . n A 1 6 LYS 6 40 40 LYS LYS A . n A 1 7 GLN 7 41 41 GLN GLN A . n A 1 8 LEU 8 42 42 LEU LEU A . n A 1 9 GLU 9 43 43 GLU GLU A . n A 1 10 ASP 10 44 44 ASP ASP A . n A 1 11 LYS 11 45 45 LYS LYS A . n A 1 12 VAL 12 46 46 VAL VAL A . n A 1 13 GLU 13 47 47 GLU GLU A . n A 1 14 GLU 14 48 48 GLU GLU A . n A 1 15 LEU 15 49 49 LEU LEU A . n A 1 16 LEU 16 50 50 LEU LEU A . n A 1 17 SER 17 51 51 SER SER A . n A 1 18 LYS 18 52 52 LYS LYS A . n A 1 19 ASN 19 53 53 ASN ASN A . n A 1 20 TYR 20 54 54 TYR TYR A . n A 1 21 HIS 21 55 55 HIS HIS A . n A 1 22 LEU 22 56 56 LEU LEU A . n A 1 23 GLU 23 57 57 GLU GLU A . n A 1 24 ASN 24 58 58 ASN ASN A . n A 1 25 GLU 25 59 59 GLU GLU A . n A 1 26 VAL 26 60 60 VAL VAL A . n A 1 27 ALA 27 61 61 ALA ALA A . n A 1 28 ARG 28 62 62 ARG ARG A . n A 1 29 LEU 29 63 63 LEU LEU A . n A 1 30 LYS 30 64 64 LYS LYS A . n A 1 31 LYS 31 65 65 LYS LYS A . n A 1 32 LEU 32 66 66 LEU LEU A . n A 1 33 VAL 33 67 67 VAL VAL A . n A 1 34 SER 34 68 68 SER SER A . n A 1 35 LYS 35 69 69 LYS LYS A . n A 1 36 LEU 36 70 70 LEU LEU A . n A 1 37 GLU 37 71 71 GLU GLU A . n A 1 38 LYS 38 72 72 LYS LYS A . n A 1 39 GLN 39 73 73 GLN GLN A . n A 1 40 LEU 40 74 74 LEU LEU A . n A 1 41 GLU 41 75 75 GLU GLU A . n A 1 42 GLU 42 76 76 GLU GLU A . n A 1 43 ALA 43 77 77 ALA ALA A . n A 1 44 GLN 44 78 78 GLN GLN A . n A 1 45 LYS 45 79 79 LYS LYS A . n A 1 46 ASP 46 80 80 ASP ASP A . n A 1 47 TYR 47 81 81 TYR TYR A . n A 1 48 SER 48 82 82 SER SER A . n A 1 49 GLU 49 83 83 GLU GLU A . n A 1 50 ILE 50 84 84 ILE ILE A . n A 1 51 GLU 51 85 85 GLU GLU A . n A 1 52 GLY 52 86 86 GLY GLY A . n A 1 53 LYS 53 87 87 LYS LYS A . n A 1 54 LEU 54 88 88 LEU LEU A . n A 1 55 GLU 55 89 89 GLU GLU A . n A 1 56 GLN 56 90 90 GLN GLN A . n A 1 57 PHE 57 91 91 PHE PHE A . n A 1 58 TRP 58 92 92 TRP TRP A . n A 1 59 HIS 59 93 93 HIS HIS A . n A 1 60 ASP 60 94 94 ASP ASP A . n A 1 61 TYR 61 95 95 TYR TYR A . n A 1 62 ASP 62 96 96 ASP ASP A . n A 1 63 LYS 63 97 97 LYS LYS A . n A 1 64 LEU 64 98 98 LEU LEU A . n A 1 65 GLU 65 99 99 GLU GLU A . n A 1 66 LYS 66 100 ? ? ? A . n A 1 67 GLU 67 101 ? ? ? A . n A 1 68 ASN 68 102 ? ? ? A . n A 1 69 LYS 69 103 ? ? ? A . n A 1 70 GLU 70 104 ? ? ? A . n A 1 71 TYR 71 105 ? ? ? A . n B 1 1 GLY 1 35 ? ? ? B . n B 1 2 PRO 2 36 36 PRO PRO B . n B 1 3 GLY 3 37 37 GLY GLY B . n B 1 4 SER 4 38 38 SER SER B . n B 1 5 MET 5 39 39 MET MET B . n B 1 6 LYS 6 40 40 LYS LYS B . n B 1 7 GLN 7 41 41 GLN GLN B . n B 1 8 LEU 8 42 42 LEU LEU B . n B 1 9 GLU 9 43 43 GLU GLU B . n B 1 10 ASP 10 44 44 ASP ASP B . n B 1 11 LYS 11 45 45 LYS LYS B . n B 1 12 VAL 12 46 46 VAL VAL B . n B 1 13 GLU 13 47 47 GLU GLU B . n B 1 14 GLU 14 48 48 GLU GLU B . n B 1 15 LEU 15 49 49 LEU LEU B . n B 1 16 LEU 16 50 50 LEU LEU B . n B 1 17 SER 17 51 51 SER SER B . n B 1 18 LYS 18 52 52 LYS LYS B . n B 1 19 ASN 19 53 53 ASN ASN B . n B 1 20 TYR 20 54 54 TYR TYR B . n B 1 21 HIS 21 55 55 HIS HIS B . n B 1 22 LEU 22 56 56 LEU LEU B . n B 1 23 GLU 23 57 57 GLU GLU B . n B 1 24 ASN 24 58 58 ASN ASN B . n B 1 25 GLU 25 59 59 GLU GLU B . n B 1 26 VAL 26 60 60 VAL VAL B . n B 1 27 ALA 27 61 61 ALA ALA B . n B 1 28 ARG 28 62 62 ARG ARG B . n B 1 29 LEU 29 63 63 LEU LEU B . n B 1 30 LYS 30 64 64 LYS LYS B . n B 1 31 LYS 31 65 65 LYS LYS B . n B 1 32 LEU 32 66 66 LEU LEU B . n B 1 33 VAL 33 67 67 VAL VAL B . n B 1 34 SER 34 68 68 SER SER B . n B 1 35 LYS 35 69 69 LYS LYS B . n B 1 36 LEU 36 70 70 LEU LEU B . n B 1 37 GLU 37 71 71 GLU GLU B . n B 1 38 LYS 38 72 72 LYS LYS B . n B 1 39 GLN 39 73 73 GLN GLN B . n B 1 40 LEU 40 74 74 LEU LEU B . n B 1 41 GLU 41 75 75 GLU GLU B . n B 1 42 GLU 42 76 76 GLU GLU B . n B 1 43 ALA 43 77 77 ALA ALA B . n B 1 44 GLN 44 78 78 GLN GLN B . n B 1 45 LYS 45 79 79 LYS LYS B . n B 1 46 ASP 46 80 80 ASP ASP B . n B 1 47 TYR 47 81 81 TYR TYR B . n B 1 48 SER 48 82 82 SER SER B . n B 1 49 GLU 49 83 83 GLU GLU B . n B 1 50 ILE 50 84 84 ILE ILE B . n B 1 51 GLU 51 85 85 GLU GLU B . n B 1 52 GLY 52 86 86 GLY GLY B . n B 1 53 LYS 53 87 87 LYS LYS B . n B 1 54 LEU 54 88 88 LEU LEU B . n B 1 55 GLU 55 89 89 GLU GLU B . n B 1 56 GLN 56 90 90 GLN GLN B . n B 1 57 PHE 57 91 91 PHE PHE B . n B 1 58 TRP 58 92 92 TRP TRP B . n B 1 59 HIS 59 93 93 HIS HIS B . n B 1 60 ASP 60 94 94 ASP ASP B . n B 1 61 TYR 61 95 95 TYR TYR B . n B 1 62 ASP 62 96 96 ASP ASP B . n B 1 63 LYS 63 97 97 LYS LYS B . n B 1 64 LEU 64 98 98 LEU LEU B . n B 1 65 GLU 65 99 99 GLU GLU B . n B 1 66 LYS 66 100 100 LYS LYS B . n B 1 67 GLU 67 101 101 GLU GLU B . n B 1 68 ASN 68 102 102 ASN ASN B . n B 1 69 LYS 69 103 103 LYS LYS B . n B 1 70 GLU 70 104 104 GLU GLU B . n B 1 71 TYR 71 105 105 TYR TYR B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 PO4 1 201 1 PO4 PO4 A . D 2 PO4 1 201 2 PO4 PO4 B . E 3 HOH 1 301 2 HOH HOH A . F 3 HOH 1 301 1 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3290 ? 1 MORE -47 ? 1 'SSA (A^2)' 9630 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-07-13 2 'Structure model' 1 1 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+3/4 3 y+1/2,-x+1/2,z+1/4 4 x+1/2,-y+1/2,-z+1/4 5 -x+1/2,y+1/2,-z+3/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -35.0808537886 -11.8872846029 -6.01472093243 0.516787297585 ? 0.0651711268954 ? 0.182361230079 ? 0.635041183727 ? 0.27558206106 ? 0.534401919528 ? 7.37851836879 ? 3.79837844163 ? -7.67641977127 ? 3.13013287091 ? -4.1544011174 ? 9.49861317043 ? -0.124993887131 ? 0.349200114388 ? 0.1557136122 ? 0.246293716072 ? -0.128267603216 ? 0.0154623846253 ? -0.0299458545529 ? -0.0366273286582 ? 0.167166922238 ? 2 'X-RAY DIFFRACTION' ? refined -29.3954327967 -9.69367445621 -4.92870465136 0.720357350942 ? -0.0119716063727 ? 0.155520392604 ? 1.04268387297 ? 0.433433527451 ? 0.724405496845 ? 6.60436980182 ? 7.87279489152 ? -8.37103816723 ? 8.00695267918 ? -6.87896058577 ? 8.13625352993 ? -0.22432843299 ? -0.342485178318 ? -0.741762926371 ? -0.0641115028177 ? -0.523847236182 ? -0.683918992551 ? 0.167722618958 ? 0.675347886562 ? 0.842877057493 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;(chain 'A' and resid 38 through 99) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;(chain 'B' and resid 36 through 105) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 7SAF _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 B _pdbx_validate_symm_contact.auth_comp_id_1 TYR _pdbx_validate_symm_contact.auth_seq_id_1 95 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OH _pdbx_validate_symm_contact.auth_asym_id_2 B _pdbx_validate_symm_contact.auth_comp_id_2 TYR _pdbx_validate_symm_contact.auth_seq_id_2 95 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 8_553 _pdbx_validate_symm_contact.dist 2.09 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 40 ? CG ? A LYS 6 CG 2 1 Y 1 A LYS 40 ? CD ? A LYS 6 CD 3 1 Y 1 A LYS 40 ? CE ? A LYS 6 CE 4 1 Y 1 A LYS 40 ? NZ ? A LYS 6 NZ 5 1 Y 1 A LYS 52 ? CG ? A LYS 18 CG 6 1 Y 1 A LYS 52 ? CD ? A LYS 18 CD 7 1 Y 1 A LYS 52 ? CE ? A LYS 18 CE 8 1 Y 1 A LYS 52 ? NZ ? A LYS 18 NZ 9 1 Y 1 A LYS 65 ? CG ? A LYS 31 CG 10 1 Y 1 A LYS 65 ? CD ? A LYS 31 CD 11 1 Y 1 A LYS 65 ? CE ? A LYS 31 CE 12 1 Y 1 A LYS 65 ? NZ ? A LYS 31 NZ 13 1 Y 1 A LYS 72 ? CG ? A LYS 38 CG 14 1 Y 1 A LYS 72 ? CD ? A LYS 38 CD 15 1 Y 1 A LYS 72 ? CE ? A LYS 38 CE 16 1 Y 1 A LYS 72 ? NZ ? A LYS 38 NZ 17 1 Y 1 A GLU 75 ? CG ? A GLU 41 CG 18 1 Y 1 A GLU 75 ? CD ? A GLU 41 CD 19 1 Y 1 A GLU 75 ? OE1 ? A GLU 41 OE1 20 1 Y 1 A GLU 75 ? OE2 ? A GLU 41 OE2 21 1 Y 1 A GLU 76 ? CG ? A GLU 42 CG 22 1 Y 1 A GLU 76 ? CD ? A GLU 42 CD 23 1 Y 1 A GLU 76 ? OE1 ? A GLU 42 OE1 24 1 Y 1 A GLU 76 ? OE2 ? A GLU 42 OE2 25 1 Y 1 A LYS 79 ? CG ? A LYS 45 CG 26 1 Y 1 A LYS 79 ? CD ? A LYS 45 CD 27 1 Y 1 A LYS 79 ? CE ? A LYS 45 CE 28 1 Y 1 A LYS 79 ? NZ ? A LYS 45 NZ 29 1 Y 1 A GLU 89 ? CG ? A GLU 55 CG 30 1 Y 1 A GLU 89 ? CD ? A GLU 55 CD 31 1 Y 1 A GLU 89 ? OE1 ? A GLU 55 OE1 32 1 Y 1 A GLU 89 ? OE2 ? A GLU 55 OE2 33 1 Y 1 A LYS 97 ? CG ? A LYS 63 CG 34 1 Y 1 A LYS 97 ? CD ? A LYS 63 CD 35 1 Y 1 A LYS 97 ? CE ? A LYS 63 CE 36 1 Y 1 A LYS 97 ? NZ ? A LYS 63 NZ 37 1 Y 1 B LYS 40 ? CG ? B LYS 6 CG 38 1 Y 1 B LYS 40 ? CD ? B LYS 6 CD 39 1 Y 1 B LYS 40 ? CE ? B LYS 6 CE 40 1 Y 1 B LYS 40 ? NZ ? B LYS 6 NZ 41 1 Y 1 B GLN 41 ? CG ? B GLN 7 CG 42 1 Y 1 B GLN 41 ? CD ? B GLN 7 CD 43 1 Y 1 B GLN 41 ? OE1 ? B GLN 7 OE1 44 1 Y 1 B GLN 41 ? NE2 ? B GLN 7 NE2 45 1 Y 1 B LYS 45 ? CG ? B LYS 11 CG 46 1 Y 1 B LYS 45 ? CD ? B LYS 11 CD 47 1 Y 1 B LYS 45 ? CE ? B LYS 11 CE 48 1 Y 1 B LYS 45 ? NZ ? B LYS 11 NZ 49 1 Y 1 B LYS 65 ? CG ? B LYS 31 CG 50 1 Y 1 B LYS 65 ? CD ? B LYS 31 CD 51 1 Y 1 B LYS 65 ? CE ? B LYS 31 CE 52 1 Y 1 B LYS 65 ? NZ ? B LYS 31 NZ 53 1 Y 1 B LYS 72 ? CG ? B LYS 38 CG 54 1 Y 1 B LYS 72 ? CD ? B LYS 38 CD 55 1 Y 1 B LYS 72 ? CE ? B LYS 38 CE 56 1 Y 1 B LYS 72 ? NZ ? B LYS 38 NZ 57 1 Y 1 B LYS 79 ? CG ? B LYS 45 CG 58 1 Y 1 B LYS 79 ? CD ? B LYS 45 CD 59 1 Y 1 B LYS 79 ? CE ? B LYS 45 CE 60 1 Y 1 B LYS 79 ? NZ ? B LYS 45 NZ 61 1 Y 1 B GLU 85 ? CG ? B GLU 51 CG 62 1 Y 1 B GLU 85 ? CD ? B GLU 51 CD 63 1 Y 1 B GLU 85 ? OE1 ? B GLU 51 OE1 64 1 Y 1 B GLU 85 ? OE2 ? B GLU 51 OE2 65 1 Y 1 B GLU 89 ? CG ? B GLU 55 CG 66 1 Y 1 B GLU 89 ? CD ? B GLU 55 CD 67 1 Y 1 B GLU 89 ? OE1 ? B GLU 55 OE1 68 1 Y 1 B GLU 89 ? OE2 ? B GLU 55 OE2 69 1 Y 1 B LYS 97 ? CG ? B LYS 63 CG 70 1 Y 1 B LYS 97 ? CD ? B LYS 63 CD 71 1 Y 1 B LYS 97 ? CE ? B LYS 63 CE 72 1 Y 1 B LYS 97 ? NZ ? B LYS 63 NZ 73 1 Y 1 B LYS 100 ? CG ? B LYS 66 CG 74 1 Y 1 B LYS 100 ? CD ? B LYS 66 CD 75 1 Y 1 B LYS 100 ? CE ? B LYS 66 CE 76 1 Y 1 B LYS 100 ? NZ ? B LYS 66 NZ 77 1 Y 1 B LYS 103 ? CG ? B LYS 69 CG 78 1 Y 1 B LYS 103 ? CD ? B LYS 69 CD 79 1 Y 1 B LYS 103 ? CE ? B LYS 69 CE 80 1 Y 1 B LYS 103 ? NZ ? B LYS 69 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 35 ? A GLY 1 2 1 Y 1 A PRO 36 ? A PRO 2 3 1 Y 1 A GLY 37 ? A GLY 3 4 1 Y 1 A LYS 100 ? A LYS 66 5 1 Y 1 A GLU 101 ? A GLU 67 6 1 Y 1 A ASN 102 ? A ASN 68 7 1 Y 1 A LYS 103 ? A LYS 69 8 1 Y 1 A GLU 104 ? A GLU 70 9 1 Y 1 A TYR 105 ? A TYR 71 10 1 Y 1 B GLY 35 ? B GLY 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PO4 P P N N 259 PO4 O1 O N N 260 PO4 O2 O N N 261 PO4 O3 O N N 262 PO4 O4 O N N 263 PRO N N N N 264 PRO CA C N S 265 PRO C C N N 266 PRO O O N N 267 PRO CB C N N 268 PRO CG C N N 269 PRO CD C N N 270 PRO OXT O N N 271 PRO H H N N 272 PRO HA H N N 273 PRO HB2 H N N 274 PRO HB3 H N N 275 PRO HG2 H N N 276 PRO HG3 H N N 277 PRO HD2 H N N 278 PRO HD3 H N N 279 PRO HXT H N N 280 SER N N N N 281 SER CA C N S 282 SER C C N N 283 SER O O N N 284 SER CB C N N 285 SER OG O N N 286 SER OXT O N N 287 SER H H N N 288 SER H2 H N N 289 SER HA H N N 290 SER HB2 H N N 291 SER HB3 H N N 292 SER HG H N N 293 SER HXT H N N 294 TRP N N N N 295 TRP CA C N S 296 TRP C C N N 297 TRP O O N N 298 TRP CB C N N 299 TRP CG C Y N 300 TRP CD1 C Y N 301 TRP CD2 C Y N 302 TRP NE1 N Y N 303 TRP CE2 C Y N 304 TRP CE3 C Y N 305 TRP CZ2 C Y N 306 TRP CZ3 C Y N 307 TRP CH2 C Y N 308 TRP OXT O N N 309 TRP H H N N 310 TRP H2 H N N 311 TRP HA H N N 312 TRP HB2 H N N 313 TRP HB3 H N N 314 TRP HD1 H N N 315 TRP HE1 H N N 316 TRP HE3 H N N 317 TRP HZ2 H N N 318 TRP HZ3 H N N 319 TRP HH2 H N N 320 TRP HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 VAL N N N N 346 VAL CA C N S 347 VAL C C N N 348 VAL O O N N 349 VAL CB C N N 350 VAL CG1 C N N 351 VAL CG2 C N N 352 VAL OXT O N N 353 VAL H H N N 354 VAL H2 H N N 355 VAL HA H N N 356 VAL HB H N N 357 VAL HG11 H N N 358 VAL HG12 H N N 359 VAL HG13 H N N 360 VAL HG21 H N N 361 VAL HG22 H N N 362 VAL HG23 H N N 363 VAL HXT H N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PO4 P O1 doub N N 247 PO4 P O2 sing N N 248 PO4 P O3 sing N N 249 PO4 P O4 sing N N 250 PRO N CA sing N N 251 PRO N CD sing N N 252 PRO N H sing N N 253 PRO CA C sing N N 254 PRO CA CB sing N N 255 PRO CA HA sing N N 256 PRO C O doub N N 257 PRO C OXT sing N N 258 PRO CB CG sing N N 259 PRO CB HB2 sing N N 260 PRO CB HB3 sing N N 261 PRO CG CD sing N N 262 PRO CG HG2 sing N N 263 PRO CG HG3 sing N N 264 PRO CD HD2 sing N N 265 PRO CD HD3 sing N N 266 PRO OXT HXT sing N N 267 SER N CA sing N N 268 SER N H sing N N 269 SER N H2 sing N N 270 SER CA C sing N N 271 SER CA CB sing N N 272 SER CA HA sing N N 273 SER C O doub N N 274 SER C OXT sing N N 275 SER CB OG sing N N 276 SER CB HB2 sing N N 277 SER CB HB3 sing N N 278 SER OG HG sing N N 279 SER OXT HXT sing N N 280 TRP N CA sing N N 281 TRP N H sing N N 282 TRP N H2 sing N N 283 TRP CA C sing N N 284 TRP CA CB sing N N 285 TRP CA HA sing N N 286 TRP C O doub N N 287 TRP C OXT sing N N 288 TRP CB CG sing N N 289 TRP CB HB2 sing N N 290 TRP CB HB3 sing N N 291 TRP CG CD1 doub Y N 292 TRP CG CD2 sing Y N 293 TRP CD1 NE1 sing Y N 294 TRP CD1 HD1 sing N N 295 TRP CD2 CE2 doub Y N 296 TRP CD2 CE3 sing Y N 297 TRP NE1 CE2 sing Y N 298 TRP NE1 HE1 sing N N 299 TRP CE2 CZ2 sing Y N 300 TRP CE3 CZ3 doub Y N 301 TRP CE3 HE3 sing N N 302 TRP CZ2 CH2 doub Y N 303 TRP CZ2 HZ2 sing N N 304 TRP CZ3 CH2 sing Y N 305 TRP CZ3 HZ3 sing N N 306 TRP CH2 HH2 sing N N 307 TRP OXT HXT sing N N 308 TYR N CA sing N N 309 TYR N H sing N N 310 TYR N H2 sing N N 311 TYR CA C sing N N 312 TYR CA CB sing N N 313 TYR CA HA sing N N 314 TYR C O doub N N 315 TYR C OXT sing N N 316 TYR CB CG sing N N 317 TYR CB HB2 sing N N 318 TYR CB HB3 sing N N 319 TYR CG CD1 doub Y N 320 TYR CG CD2 sing Y N 321 TYR CD1 CE1 sing Y N 322 TYR CD1 HD1 sing N N 323 TYR CD2 CE2 doub Y N 324 TYR CD2 HD2 sing N N 325 TYR CE1 CZ doub Y N 326 TYR CE1 HE1 sing N N 327 TYR CE2 CZ sing Y N 328 TYR CE2 HE2 sing N N 329 TYR CZ OH sing N N 330 TYR OH HH sing N N 331 TYR OXT HXT sing N N 332 VAL N CA sing N N 333 VAL N H sing N N 334 VAL N H2 sing N N 335 VAL CA C sing N N 336 VAL CA CB sing N N 337 VAL CA HA sing N N 338 VAL C O doub N N 339 VAL C OXT sing N N 340 VAL CB CG1 sing N N 341 VAL CB CG2 sing N N 342 VAL CB HB sing N N 343 VAL CG1 HG11 sing N N 344 VAL CG1 HG12 sing N N 345 VAL CG1 HG13 sing N N 346 VAL CG2 HG21 sing N N 347 VAL CG2 HG22 sing N N 348 VAL CG2 HG23 sing N N 349 VAL OXT HXT sing N N 350 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHATE ION' PO4 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1KQL _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 43 21 2' _space_group.name_Hall 'P 4nw 2abw' _space_group.IT_number 96 _space_group.crystal_system tetragonal _space_group.id 1 #