data_7SC3 # _entry.id 7SC3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.353 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7SC3 pdb_00007sc3 10.2210/pdb7sc3/pdb WWPDB D_1000259432 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7SC3 _pdbx_database_status.recvd_initial_deposition_date 2021-09-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Sack, J.S.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0003-1542-9515 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr.,Sect.F' _citation.journal_id_ASTM ACSFEN _citation.journal_id_CSD ? _citation.journal_id_ISSN 2053-230X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 78 _citation.language ? _citation.page_first 17 _citation.page_last 24 _citation.title 'X-ray structure of a human cardiac muscle troponin C/troponin I chimera in two crystal forms.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2053230X21012395 _citation.pdbx_database_id_PubMed 34981771 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yan, C.' 1 ? primary 'Sack, J.S.' 2 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7SC3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 38.849 _cell.length_a_esd ? _cell.length_b 40.958 _cell.length_b_esd ? _cell.length_c 66.997 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7SC3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Troponin C, slow skeletal and cardiac muscles,Troponin I, cardiac muscle chimera' 14186.127 1 ? C35S,C84S ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 water nat water 18.015 8 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TN-C,Cardiac troponin I' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRSMKDDSKGKFKRPTLRRVRISADAMMQALLGARAKGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRSMKDDSKGKFKRPTLRRVRISADAMMQALLGARAKGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ASP n 1 4 ILE n 1 5 TYR n 1 6 LYS n 1 7 ALA n 1 8 ALA n 1 9 VAL n 1 10 GLU n 1 11 GLN n 1 12 LEU n 1 13 THR n 1 14 GLU n 1 15 GLU n 1 16 GLN n 1 17 LYS n 1 18 ASN n 1 19 GLU n 1 20 PHE n 1 21 LYS n 1 22 ALA n 1 23 ALA n 1 24 PHE n 1 25 ASP n 1 26 ILE n 1 27 PHE n 1 28 VAL n 1 29 LEU n 1 30 GLY n 1 31 ALA n 1 32 GLU n 1 33 ASP n 1 34 GLY n 1 35 SER n 1 36 ILE n 1 37 SER n 1 38 THR n 1 39 LYS n 1 40 GLU n 1 41 LEU n 1 42 GLY n 1 43 LYS n 1 44 VAL n 1 45 MET n 1 46 ARG n 1 47 MET n 1 48 LEU n 1 49 GLY n 1 50 GLN n 1 51 ASN n 1 52 PRO n 1 53 THR n 1 54 PRO n 1 55 GLU n 1 56 GLU n 1 57 LEU n 1 58 GLN n 1 59 GLU n 1 60 MET n 1 61 ILE n 1 62 ASP n 1 63 GLU n 1 64 VAL n 1 65 ASP n 1 66 GLU n 1 67 ASP n 1 68 GLY n 1 69 SER n 1 70 GLY n 1 71 THR n 1 72 VAL n 1 73 ASP n 1 74 PHE n 1 75 ASP n 1 76 GLU n 1 77 PHE n 1 78 LEU n 1 79 VAL n 1 80 MET n 1 81 MET n 1 82 VAL n 1 83 ARG n 1 84 SER n 1 85 MET n 1 86 LYS n 1 87 ASP n 1 88 ASP n 1 89 SER n 1 90 LYS n 1 91 GLY n 1 92 LYS n 1 93 PHE n 1 94 LYS n 1 95 ARG n 1 96 PRO n 1 97 THR n 1 98 LEU n 1 99 ARG n 1 100 ARG n 1 101 VAL n 1 102 ARG n 1 103 ILE n 1 104 SER n 1 105 ALA n 1 106 ASP n 1 107 ALA n 1 108 MET n 1 109 MET n 1 110 GLN n 1 111 ALA n 1 112 LEU n 1 113 LEU n 1 114 GLY n 1 115 ALA n 1 116 ARG n 1 117 ALA n 1 118 LYS n 1 119 GLY n 1 120 HIS n 1 121 HIS n 1 122 HIS n 1 123 HIS n 1 124 HIS n 1 125 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 92 Human ? 'TNNC1, TNNC' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 93 125 Human ? 'TNNI3, TNNC1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP TNNC1_HUMAN P63316 ? 1 ;MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRCMKDDSKGK ; 1 2 UNP TNNI3_HUMAN P19429 ? 1 FKRPTLRRVRISADAMMQALLGARAK 139 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7SC3 A 1 ? 92 ? P63316 1 ? 92 ? 1 137 2 2 7SC3 A 93 ? 118 ? P19429 139 ? 164 ? 138 163 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7SC3 SER A 35 ? UNP P63316 CYS 35 'engineered mutation' 35 1 1 7SC3 SER A 84 ? UNP P63316 CYS 84 'engineered mutation' 84 2 2 7SC3 GLY A 119 ? UNP P19429 ? ? 'expression tag' 164 3 2 7SC3 HIS A 120 ? UNP P19429 ? ? 'expression tag' 165 4 2 7SC3 HIS A 121 ? UNP P19429 ? ? 'expression tag' 166 5 2 7SC3 HIS A 122 ? UNP P19429 ? ? 'expression tag' 167 6 2 7SC3 HIS A 123 ? UNP P19429 ? ? 'expression tag' 168 7 2 7SC3 HIS A 124 ? UNP P19429 ? ? 'expression tag' 169 8 2 7SC3 HIS A 125 ? UNP P19429 ? ? 'expression tag' 170 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7SC3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.88 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 34.53 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '18% PEG 4000, 0.1M NA ACETATE PH 4.5, 0.2M NAH4-ACETATE, 5% DMSO' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-11-13 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 41.97 _reflns.entry_id 7SC3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.229 _reflns.d_resolution_low 34.95 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3441 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 0. _reflns.percent_possible_obs 64.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.0 _reflns.pdbx_Rmerge_I_obs 0.252 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.26 _reflns_shell.d_res_low 2.51 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 431 _reflns_shell.percent_possible_all 14.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.705 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.08840 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][2] -0.99320 _refine.aniso_B[2][3] 0.00000 _refine.aniso_B[3][3] 0.90480 _refine.B_iso_max ? _refine.B_iso_mean 38.41 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.894 _refine.correlation_coeff_Fo_to_Fc_free 0.846 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7SC3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.229 _refine.ls_d_res_low 34.95 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3441 _refine.ls_number_reflns_R_free 165 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 61.6 _refine.ls_percent_reflns_R_free 4.800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2448 _refine.ls_R_factor_R_free 0.2784 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2431 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.347 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.351 _refine.pdbx_overall_SU_R_Blow_DPI 1.674 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 1.047 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 7SC3 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.46 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.229 _refine_hist.d_res_low 34.95 _refine_hist.number_atoms_solvent 11 _refine_hist.number_atoms_total 788 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 776 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 785 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 0.97 ? 1057 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 267 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_trig_c_planes ? ? 'X-RAY DIFFRACTION' ? ? ? 137 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 785 ? t_it 10.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 2.58 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 17.64 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 106 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 592 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.23 _refine_ls_shell.d_res_low 2.65 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_R_work 409 _refine_ls_shell.percent_reflns_obs 20.0 _refine_ls_shell.percent_reflns_R_free 5.10 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2259 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.1982 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7SC3 _struct.title ;CRYSTAL STRUCTURE OF THE N-DOMAIN OF CARDIAC MUSCLE TROPONIN C TETHERED TO THE SWITCH REGION OF CARDIAC MUSCLE TROPONIN I (ORTHORHOMBIC FORM) ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7SC3 _struct_keywords.text 'CALCIUM SENSITIZER, CONTRACTION REGULATION, CONTRACTILE PROTEIN, CARDIAC TROPONIN, MUSCLE REGULATION, CALCIUM-BINDING, EF-HAND' _struct_keywords.pdbx_keywords 'CONTRACTILE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TYR A 5 ? GLU A 10 ? TYR A 5 GLU A 10 1 ? 6 HELX_P HELX_P2 AA2 THR A 13 ? VAL A 28 ? THR A 13 VAL A 28 1 ? 16 HELX_P HELX_P3 AA3 SER A 37 ? LEU A 48 ? SER A 37 LEU A 48 1 ? 12 HELX_P HELX_P4 AA4 THR A 53 ? ASP A 65 ? THR A 53 ASP A 65 1 ? 13 HELX_P HELX_P5 AA5 ASP A 73 ? ASP A 88 ? ASP A 73 ASP A 88 1 ? 16 HELX_P HELX_P6 AA6 PHE A 93 ? GLY A 114 ? PHE A 138 GLY A 159 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 65 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 65 A CA 201 1_555 ? ? ? ? ? ? ? 2.073 ? ? metalc2 metalc ? ? A ASP 67 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 67 A CA 201 1_555 ? ? ? ? ? ? ? 2.353 ? ? metalc3 metalc ? ? A SER 69 OG ? ? ? 1_555 B CA . CA ? ? A SER 69 A CA 201 1_555 ? ? ? ? ? ? ? 2.775 ? ? metalc4 metalc ? ? A THR 71 O ? ? ? 1_555 B CA . CA ? ? A THR 71 A CA 201 1_555 ? ? ? ? ? ? ? 2.131 ? ? metalc5 metalc ? ? A GLU 76 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 76 A CA 201 1_555 ? ? ? ? ? ? ? 2.117 ? ? metalc6 metalc ? ? A GLU 76 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 76 A CA 201 1_555 ? ? ? ? ? ? ? 2.923 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 90 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 90 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 GLY _struct_mon_prot_cis.pdbx_label_seq_id_2 91 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 GLY _struct_mon_prot_cis.pdbx_auth_seq_id_2 136 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.51 # _atom_sites.entry_id 7SC3 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.025741 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.024415 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014926 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 ILE 4 4 ? ? ? A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 GLY 91 136 136 GLY GLY A . n A 1 92 LYS 92 137 137 LYS LYS A . n A 1 93 PHE 93 138 138 PHE PHE A . n A 1 94 LYS 94 139 139 LYS LYS A . n A 1 95 ARG 95 140 140 ARG ARG A . n A 1 96 PRO 96 141 141 PRO PRO A . n A 1 97 THR 97 142 142 THR THR A . n A 1 98 LEU 98 143 143 LEU LEU A . n A 1 99 ARG 99 144 144 ARG ARG A . n A 1 100 ARG 100 145 145 ARG ARG A . n A 1 101 VAL 101 146 146 VAL VAL A . n A 1 102 ARG 102 147 147 ARG ARG A . n A 1 103 ILE 103 148 148 ILE ILE A . n A 1 104 SER 104 149 149 SER SER A . n A 1 105 ALA 105 150 150 ALA ALA A . n A 1 106 ASP 106 151 151 ASP ASP A . n A 1 107 ALA 107 152 152 ALA ALA A . n A 1 108 MET 108 153 153 MET MET A . n A 1 109 MET 109 154 154 MET MET A . n A 1 110 GLN 110 155 155 GLN GLN A . n A 1 111 ALA 111 156 156 ALA ALA A . n A 1 112 LEU 112 157 157 LEU LEU A . n A 1 113 LEU 113 158 158 LEU LEU A . n A 1 114 GLY 114 159 159 GLY GLY A . n A 1 115 ALA 115 160 ? ? ? A . n A 1 116 ARG 116 161 ? ? ? A . n A 1 117 ALA 117 162 ? ? ? A . n A 1 118 LYS 118 163 ? ? ? A . n A 1 119 GLY 119 164 ? ? ? A . n A 1 120 HIS 120 165 ? ? ? A . n A 1 121 HIS 121 166 ? ? ? A . n A 1 122 HIS 122 167 ? ? ? A . n A 1 123 HIS 123 168 ? ? ? A . n A 1 124 HIS 124 169 ? ? ? A . n A 1 125 HIS 125 170 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email sackjs@gmail.com _pdbx_contact_author.name_first John _pdbx_contact_author.name_last Sack _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1542-9515 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 201 1 CA CA A . C 3 HOH 1 301 10 HOH HOH A . C 3 HOH 2 302 5 HOH HOH A . C 3 HOH 3 303 2 HOH HOH A . C 3 HOH 4 304 11 HOH HOH A . C 3 HOH 5 305 3 HOH HOH A . C 3 HOH 6 306 12 HOH HOH A . C 3 HOH 7 307 4 HOH HOH A . C 3 HOH 8 308 7 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 84.4 ? 2 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OG ? A SER 69 ? A SER 69 ? 1_555 93.8 ? 3 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OG ? A SER 69 ? A SER 69 ? 1_555 67.8 ? 4 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A THR 71 ? A THR 71 ? 1_555 78.5 ? 5 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A THR 71 ? A THR 71 ? 1_555 145.1 ? 6 OG ? A SER 69 ? A SER 69 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A THR 71 ? A THR 71 ? 1_555 83.1 ? 7 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 76 ? A GLU 76 ? 1_555 118.2 ? 8 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 76 ? A GLU 76 ? 1_555 118.4 ? 9 OG ? A SER 69 ? A SER 69 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 76 ? A GLU 76 ? 1_555 147.4 ? 10 O ? A THR 71 ? A THR 71 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 76 ? A GLU 76 ? 1_555 96.5 ? 11 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 76 ? A GLU 76 ? 1_555 93.8 ? 12 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 76 ? A GLU 76 ? 1_555 75.6 ? 13 OG ? A SER 69 ? A SER 69 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 76 ? A GLU 76 ? 1_555 141.7 ? 14 O ? A THR 71 ? A THR 71 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 76 ? A GLU 76 ? 1_555 135.3 ? 15 OE1 ? A GLU 76 ? A GLU 76 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 76 ? A GLU 76 ? 1_555 48.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-12-01 2 'Structure model' 1 1 2022-01-05 3 'Structure model' 1 2 2022-01-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_DOI' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation.year' 7 3 'Structure model' '_citation.pdbx_database_id_PubMed' 8 3 'Structure model' '_citation.title' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? '2.11.7 (6-FEB-2020)' 3 # _pdbx_entry_details.entry_id 7SC3 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 11 ? ? -101.96 49.00 2 1 PHE A 138 ? ? -105.04 -60.26 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 6 ? CB ? A LYS 6 CB 2 1 Y 1 A LYS 6 ? CG ? A LYS 6 CG 3 1 Y 1 A LYS 6 ? CD ? A LYS 6 CD 4 1 Y 1 A LYS 6 ? CE ? A LYS 6 CE 5 1 Y 1 A LYS 6 ? NZ ? A LYS 6 NZ 6 1 Y 1 A VAL 9 ? CG1 ? A VAL 9 CG1 7 1 Y 1 A VAL 9 ? CG2 ? A VAL 9 CG2 8 1 Y 1 A GLU 10 ? CD ? A GLU 10 CD 9 1 Y 1 A GLU 10 ? OE1 ? A GLU 10 OE1 10 1 Y 1 A GLU 10 ? OE2 ? A GLU 10 OE2 11 1 Y 1 A GLN 11 ? OE1 ? A GLN 11 OE1 12 1 Y 1 A GLN 11 ? NE2 ? A GLN 11 NE2 13 1 Y 1 A GLU 14 ? CD ? A GLU 14 CD 14 1 Y 1 A GLU 14 ? OE1 ? A GLU 14 OE1 15 1 Y 1 A GLU 14 ? OE2 ? A GLU 14 OE2 16 1 Y 1 A GLU 15 ? CG ? A GLU 15 CG 17 1 Y 1 A GLU 15 ? CD ? A GLU 15 CD 18 1 Y 1 A GLU 15 ? OE1 ? A GLU 15 OE1 19 1 Y 1 A GLU 15 ? OE2 ? A GLU 15 OE2 20 1 Y 1 A GLU 19 ? CG ? A GLU 19 CG 21 1 Y 1 A GLU 19 ? CD ? A GLU 19 CD 22 1 Y 1 A GLU 19 ? OE1 ? A GLU 19 OE1 23 1 Y 1 A GLU 19 ? OE2 ? A GLU 19 OE2 24 1 Y 1 A GLU 32 ? CB ? A GLU 32 CB 25 1 Y 1 A GLU 32 ? CG ? A GLU 32 CG 26 1 Y 1 A GLU 32 ? CD ? A GLU 32 CD 27 1 Y 1 A GLU 32 ? OE1 ? A GLU 32 OE1 28 1 Y 1 A GLU 32 ? OE2 ? A GLU 32 OE2 29 1 Y 1 A ASP 33 ? CB ? A ASP 33 CB 30 1 Y 1 A ASP 33 ? CG ? A ASP 33 CG 31 1 Y 1 A ASP 33 ? OD1 ? A ASP 33 OD1 32 1 Y 1 A ASP 33 ? OD2 ? A ASP 33 OD2 33 1 Y 1 A LYS 39 ? CD ? A LYS 39 CD 34 1 Y 1 A LYS 39 ? CE ? A LYS 39 CE 35 1 Y 1 A LYS 39 ? NZ ? A LYS 39 NZ 36 1 Y 1 A LYS 43 ? CG ? A LYS 43 CG 37 1 Y 1 A LYS 43 ? CD ? A LYS 43 CD 38 1 Y 1 A LYS 43 ? CE ? A LYS 43 CE 39 1 Y 1 A LYS 43 ? NZ ? A LYS 43 NZ 40 1 Y 1 A MET 47 ? CG ? A MET 47 CG 41 1 Y 1 A MET 47 ? SD ? A MET 47 SD 42 1 Y 1 A MET 47 ? CE ? A MET 47 CE 43 1 Y 1 A GLN 58 ? CD ? A GLN 58 CD 44 1 Y 1 A GLN 58 ? OE1 ? A GLN 58 OE1 45 1 Y 1 A GLN 58 ? NE2 ? A GLN 58 NE2 46 1 Y 1 A ASP 62 ? CG ? A ASP 62 CG 47 1 Y 1 A ASP 62 ? OD1 ? A ASP 62 OD1 48 1 Y 1 A ASP 62 ? OD2 ? A ASP 62 OD2 49 1 Y 1 A GLU 63 ? CB ? A GLU 63 CB 50 1 Y 1 A GLU 63 ? CG ? A GLU 63 CG 51 1 Y 1 A GLU 63 ? CD ? A GLU 63 CD 52 1 Y 1 A GLU 63 ? OE1 ? A GLU 63 OE1 53 1 Y 1 A GLU 63 ? OE2 ? A GLU 63 OE2 54 1 Y 1 A GLU 66 ? CG ? A GLU 66 CG 55 1 Y 1 A GLU 66 ? CD ? A GLU 66 CD 56 1 Y 1 A GLU 66 ? OE1 ? A GLU 66 OE1 57 1 Y 1 A GLU 66 ? OE2 ? A GLU 66 OE2 58 1 Y 1 A MET 85 ? CG ? A MET 85 CG 59 1 Y 1 A MET 85 ? SD ? A MET 85 SD 60 1 Y 1 A MET 85 ? CE ? A MET 85 CE 61 1 Y 1 A LYS 86 ? CG ? A LYS 86 CG 62 1 Y 1 A LYS 86 ? CD ? A LYS 86 CD 63 1 Y 1 A LYS 86 ? CE ? A LYS 86 CE 64 1 Y 1 A LYS 86 ? NZ ? A LYS 86 NZ 65 1 Y 1 A ASP 87 ? CG ? A ASP 87 CG 66 1 Y 1 A ASP 87 ? OD1 ? A ASP 87 OD1 67 1 Y 1 A ASP 87 ? OD2 ? A ASP 87 OD2 68 1 Y 1 A ASP 88 ? CG ? A ASP 88 CG 69 1 Y 1 A ASP 88 ? OD1 ? A ASP 88 OD1 70 1 Y 1 A ASP 88 ? OD2 ? A ASP 88 OD2 71 1 Y 1 A SER 89 ? OG ? A SER 89 OG 72 1 Y 1 A LYS 90 ? CB ? A LYS 90 CB 73 1 Y 1 A LYS 90 ? CG ? A LYS 90 CG 74 1 Y 1 A LYS 90 ? CD ? A LYS 90 CD 75 1 Y 1 A LYS 90 ? CE ? A LYS 90 CE 76 1 Y 1 A LYS 90 ? NZ ? A LYS 90 NZ 77 1 Y 1 A LYS 137 ? CG ? A LYS 92 CG 78 1 Y 1 A LYS 137 ? CD ? A LYS 92 CD 79 1 Y 1 A LYS 137 ? CE ? A LYS 92 CE 80 1 Y 1 A LYS 137 ? NZ ? A LYS 92 NZ 81 1 Y 1 A ARG 140 ? CG ? A ARG 95 CG 82 1 Y 1 A ARG 140 ? CD ? A ARG 95 CD 83 1 Y 1 A ARG 140 ? NE ? A ARG 95 NE 84 1 Y 1 A ARG 140 ? CZ ? A ARG 95 CZ 85 1 Y 1 A ARG 140 ? NH1 ? A ARG 95 NH1 86 1 Y 1 A ARG 140 ? NH2 ? A ARG 95 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A ILE 4 ? A ILE 4 5 1 Y 1 A ALA 160 ? A ALA 115 6 1 Y 1 A ARG 161 ? A ARG 116 7 1 Y 1 A ALA 162 ? A ALA 117 8 1 Y 1 A LYS 163 ? A LYS 118 9 1 Y 1 A GLY 164 ? A GLY 119 10 1 Y 1 A HIS 165 ? A HIS 120 11 1 Y 1 A HIS 166 ? A HIS 121 12 1 Y 1 A HIS 167 ? A HIS 122 13 1 Y 1 A HIS 168 ? A HIS 123 14 1 Y 1 A HIS 169 ? A HIS 124 15 1 Y 1 A HIS 170 ? A HIS 125 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #