data_7SR2
# 
_entry.id   7SR2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.380 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7SR2         pdb_00007sr2 10.2210/pdb7sr2/pdb 
WWPDB D_1000260918 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        'wild-type version of the same structure' 
_pdbx_database_related.db_id          7SR1 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7SR2 
_pdbx_database_status.recvd_initial_deposition_date   2021-11-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Collins, B.M.'  1 0000-0002-6070-3774 
'Paul, B.'       2 ?                   
'Weeratunga, S.' 3 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CH 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Front Cell Dev Biol' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2296-634X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                826688 
_citation.page_last                 826688 
_citation.title                     
'Structural Predictions of the SNX-RGS Proteins Suggest They Belong to a New Class of Lipid Transfer Proteins.' 
_citation.year                      2022 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.3389/fcell.2022.826688 
_citation.pdbx_database_id_PubMed   35223850 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Paul, B.'       1 ? 
primary 'Weeratunga, S.' 2 ? 
primary 'Tillu, V.A.'    3 ? 
primary 'Hariri, H.'     4 ? 
primary 'Henne, W.M.'    5 ? 
primary 'Collins, B.M.'  6 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   109.270 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7SR2 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     44.035 
_cell.length_a_esd                 ? 
_cell.length_b                     75.864 
_cell.length_b_esd                 ? 
_cell.length_c                     51.109 
_cell.length_c_esd                 ? 
_cell.volume                       161172.558 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7SR2 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            'P 2yb' 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Sorting nexin-25' 14938.986 2  ? C526A ? ? 
2 non-polymer syn 'ZINC ION'         65.409    1  ? ?     ? ? 
3 non-polymer syn LEUCINE            131.173   1  ? ?     ? ? 
4 non-polymer syn 'ACETATE ION'      59.044    1  ? ?     ? ? 
5 water       nat water              18.015    30 ? ?     ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SQKILQFEDILANTFYREHFGMYMERMDKRALISFWESVEHLKNANKNEIPQLVGEIYQNFFVESKEISVEKSLYKEIQQ
ALVGNKGIEVFYKIQEDVYETLKDRYYPSFIVSDLYEKLLIKEE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SQKILQFEDILANTFYREHFGMYMERMDKRALISFWESVEHLKNANKNEIPQLVGEIYQNFFVESKEISVEKSLYKEIQQ
ALVGNKGIEVFYKIQEDVYETLKDRYYPSFIVSDLYEKLLIKEE
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLN n 
1 3   LYS n 
1 4   ILE n 
1 5   LEU n 
1 6   GLN n 
1 7   PHE n 
1 8   GLU n 
1 9   ASP n 
1 10  ILE n 
1 11  LEU n 
1 12  ALA n 
1 13  ASN n 
1 14  THR n 
1 15  PHE n 
1 16  TYR n 
1 17  ARG n 
1 18  GLU n 
1 19  HIS n 
1 20  PHE n 
1 21  GLY n 
1 22  MET n 
1 23  TYR n 
1 24  MET n 
1 25  GLU n 
1 26  ARG n 
1 27  MET n 
1 28  ASP n 
1 29  LYS n 
1 30  ARG n 
1 31  ALA n 
1 32  LEU n 
1 33  ILE n 
1 34  SER n 
1 35  PHE n 
1 36  TRP n 
1 37  GLU n 
1 38  SER n 
1 39  VAL n 
1 40  GLU n 
1 41  HIS n 
1 42  LEU n 
1 43  LYS n 
1 44  ASN n 
1 45  ALA n 
1 46  ASN n 
1 47  LYS n 
1 48  ASN n 
1 49  GLU n 
1 50  ILE n 
1 51  PRO n 
1 52  GLN n 
1 53  LEU n 
1 54  VAL n 
1 55  GLY n 
1 56  GLU n 
1 57  ILE n 
1 58  TYR n 
1 59  GLN n 
1 60  ASN n 
1 61  PHE n 
1 62  PHE n 
1 63  VAL n 
1 64  GLU n 
1 65  SER n 
1 66  LYS n 
1 67  GLU n 
1 68  ILE n 
1 69  SER n 
1 70  VAL n 
1 71  GLU n 
1 72  LYS n 
1 73  SER n 
1 74  LEU n 
1 75  TYR n 
1 76  LYS n 
1 77  GLU n 
1 78  ILE n 
1 79  GLN n 
1 80  GLN n 
1 81  ALA n 
1 82  LEU n 
1 83  VAL n 
1 84  GLY n 
1 85  ASN n 
1 86  LYS n 
1 87  GLY n 
1 88  ILE n 
1 89  GLU n 
1 90  VAL n 
1 91  PHE n 
1 92  TYR n 
1 93  LYS n 
1 94  ILE n 
1 95  GLN n 
1 96  GLU n 
1 97  ASP n 
1 98  VAL n 
1 99  TYR n 
1 100 GLU n 
1 101 THR n 
1 102 LEU n 
1 103 LYS n 
1 104 ASP n 
1 105 ARG n 
1 106 TYR n 
1 107 TYR n 
1 108 PRO n 
1 109 SER n 
1 110 PHE n 
1 111 ILE n 
1 112 VAL n 
1 113 SER n 
1 114 ASP n 
1 115 LEU n 
1 116 TYR n 
1 117 GLU n 
1 118 LYS n 
1 119 LEU n 
1 120 LEU n 
1 121 ILE n 
1 122 LYS n 
1 123 GLU n 
1 124 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   124 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SNX25 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A0A494C0S0_HUMAN 
_struct_ref.pdbx_db_accession          A0A494C0S0 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SQKILQFEDILANTFYREHFGMYMERMDKRALISFWESVEHLKNANKNEIPQLVGEIYQNFFVESKEISVEKSLYKEIQQ
CLVGNKGIEVFYKIQEDVYETLKDRYYPSFIVSDLYEKLLIKEE
;
_struct_ref.pdbx_align_begin           446 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 7SR2 A 1 ? 124 ? A0A494C0S0 446 ? 569 ? 446 569 
2 1 7SR2 B 1 ? 124 ? A0A494C0S0 446 ? 569 ? 446 569 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 7SR2 ALA A 81 ? UNP A0A494C0S0 CYS 526 'engineered mutation' 526 1 
2 7SR2 ALA B 81 ? UNP A0A494C0S0 CYS 526 'engineered mutation' 526 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'   ? 'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7SR2 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.70 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.40 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '18% PEG 8000, 0.1 M calcium acetate, 0.1 M sodium cacodylate, pH 6.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2021-02-22 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.95364 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.95364 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   MX2 
_diffrn_source.pdbx_synchrotron_site       'Australian Synchrotron' 
# 
_reflns.B_iso_Wilson_estimate                          43.54 
_reflns.entry_id                                       7SR2 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              2.42 
_reflns.d_resolution_low                               48.25 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     11882 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     ? 
_reflns.observed_criterion_sigma_I                     ? 
_reflns.percent_possible_obs                           97.9 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                6.8 
_reflns.pdbx_Rmerge_I_obs                              ? 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                ? 
_reflns.pdbx_netI_over_av_sigmaI                       ? 
_reflns.pdbx_netI_over_sigmaI                          7.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               ? 
_reflns.pdbx_scaling_rejects                           ? 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                ? 
_reflns.pdbx_Rpim_I_all                                0.07 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       ? 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   0.992 
_reflns.pdbx_CC_star                                   ? 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
# 
_reflns_shell.d_res_high                                    2.42 
_reflns_shell.d_res_low                                     2.52 
_reflns_shell.meanI_over_sigI_all                           ? 
_reflns_shell.meanI_over_sigI_obs                           1.4 
_reflns_shell.number_measured_all                           ? 
_reflns_shell.number_measured_obs                           ? 
_reflns_shell.number_possible                               ? 
_reflns_shell.number_unique_all                             ? 
_reflns_shell.number_unique_obs                             7264 
_reflns_shell.percent_possible_all                          ? 
_reflns_shell.percent_possible_obs                          ? 
_reflns_shell.Rmerge_F_all                                  ? 
_reflns_shell.Rmerge_F_obs                                  ? 
_reflns_shell.Rmerge_I_all                                  ? 
_reflns_shell.Rmerge_I_obs                                  ? 
_reflns_shell.meanI_over_sigI_gt                            ? 
_reflns_shell.meanI_over_uI_all                             ? 
_reflns_shell.meanI_over_uI_gt                              ? 
_reflns_shell.number_measured_gt                            ? 
_reflns_shell.number_unique_gt                              ? 
_reflns_shell.percent_possible_gt                           ? 
_reflns_shell.Rmerge_F_gt                                   ? 
_reflns_shell.Rmerge_I_gt                                   ? 
_reflns_shell.pdbx_redundancy                               ? 
_reflns_shell.pdbx_Rsym_value                               ? 
_reflns_shell.pdbx_chi_squared                              ? 
_reflns_shell.pdbx_netI_over_sigmaI_all                     ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs                     ? 
_reflns_shell.pdbx_Rrim_I_all                               ? 
_reflns_shell.pdbx_Rpim_I_all                               0.410 
_reflns_shell.pdbx_rejects                                  ? 
_reflns_shell.pdbx_ordinal                                  1 
_reflns_shell.pdbx_diffrn_id                                1 
_reflns_shell.pdbx_CC_half                                  0.631 
_reflns_shell.pdbx_CC_star                                  ? 
_reflns_shell.pdbx_R_split                                  ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal             ? 
_reflns_shell.pdbx_percent_possible_spherical               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous   ? 
_reflns_shell.pdbx_percent_possible_spherical_anomalous     ? 
_reflns_shell.pdbx_redundancy_anomalous                     ? 
_reflns_shell.pdbx_CC_half_anomalous                        ? 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous             ? 
_reflns_shell.pdbx_percent_possible_anomalous               ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               52.86 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7SR2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.42 
_refine.ls_d_res_low                             41.57 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     11860 
_refine.ls_number_reflns_R_free                  1186 
_refine.ls_number_reflns_R_work                  10674 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.73 
_refine.ls_percent_reflns_R_free                 10.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2144 
_refine.ls_R_factor_R_free                       0.2470 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2108 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      7SR1 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library + CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.7525 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3710 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.42 
_refine_hist.d_res_low                        41.57 
_refine_hist.number_atoms_solvent             30 
_refine_hist.number_atoms_total               2026 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        1983 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         13 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0070  ? 2037 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.9036  ? 2736 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0583  ? 287  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0058  ? 348  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 19.8216 ? 257  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.42 2.53  . . 135 1216 90.61 . . . 0.3744 . 0.3279 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.53 2.67  . . 147 1330 98.27 . . . 0.3070 . 0.2664 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.67 2.83  . . 150 1340 98.48 . . . 0.2824 . 0.2438 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.83 3.05  . . 149 1344 98.42 . . . 0.2793 . 0.2389 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.05 3.36  . . 150 1347 98.55 . . . 0.2498 . 0.2011 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.36 3.84  . . 149 1348 99.07 . . . 0.2559 . 0.1896 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.85 4.84  . . 151 1360 98.95 . . . 0.2087 . 0.1796 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.84 41.57 . . 155 1389 99.29 . . . 0.2183 . 0.2062 . . . . . . . . . . . 
# 
_struct.entry_id                     7SR2 
_struct.title                        'Crystal structure of the human SNX25 regulator of G-protein signalling (RGS) domain' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7SR2 
_struct_keywords.text            'endosome, sorting nexin, SNX, RGS, SNX25, lipid droplet, SIGNALING PROTEIN' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLN A 6   ? ASN A 13  ? GLN A 451 ASN A 458 1 ? 8  
HELX_P HELX_P2  AA2 ASN A 13  ? MET A 27  ? ASN A 458 MET A 472 1 ? 15 
HELX_P HELX_P3  AA3 LYS A 29  ? ASN A 44  ? LYS A 474 ASN A 489 1 ? 16 
HELX_P HELX_P4  AA4 GLU A 49  ? PHE A 61  ? GLU A 494 PHE A 506 1 ? 13 
HELX_P HELX_P5  AA5 LEU A 74  ? VAL A 83  ? LEU A 519 VAL A 528 1 ? 10 
HELX_P HELX_P6  AA6 ILE A 88  ? TYR A 106 ? ILE A 533 TYR A 551 1 ? 19 
HELX_P HELX_P7  AA7 TYR A 106 ? ILE A 111 ? TYR A 551 ILE A 556 1 ? 6  
HELX_P HELX_P8  AA8 SER A 113 ? LYS A 118 ? SER A 558 LYS A 563 1 ? 6  
HELX_P HELX_P9  AA9 GLN B 6   ? ASN B 13  ? GLN B 451 ASN B 458 1 ? 8  
HELX_P HELX_P10 AB1 ASN B 13  ? ARG B 26  ? ASN B 458 ARG B 471 1 ? 14 
HELX_P HELX_P11 AB2 MET B 27  ? LYS B 29  ? MET B 472 LYS B 474 5 ? 3  
HELX_P HELX_P12 AB3 ARG B 30  ? ALA B 45  ? ARG B 475 ALA B 490 1 ? 16 
HELX_P HELX_P13 AB4 GLU B 49  ? VAL B 63  ? GLU B 494 VAL B 508 1 ? 15 
HELX_P HELX_P14 AB5 GLU B 71  ? GLY B 84  ? GLU B 516 GLY B 529 1 ? 14 
HELX_P HELX_P15 AB6 ILE B 88  ? ARG B 105 ? ILE B 533 ARG B 550 1 ? 18 
HELX_P HELX_P16 AB7 TYR B 106 ? VAL B 112 ? TYR B 551 VAL B 557 1 ? 7  
HELX_P HELX_P17 AB8 SER B 113 ? LEU B 119 ? SER B 558 LEU B 564 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A HIS 41 NE2 ? ? ? 1_555 C ZN  .  ZN  ? ? A HIS 486 A ZN  590 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
metalc2 metalc ? ? A GLU 49 OE1 ? ? ? 1_555 C ZN  .  ZN  ? ? A GLU 494 A ZN  590 1_555 ? ? ? ? ? ? ? 1.788 ? ? 
metalc3 metalc ? ? C ZN  .  ZN  ? ? ? 1_555 B HIS 41 NE2 ? ? A ZN  590 B HIS 486 1_555 ? ? ? ? ? ? ? 1.937 ? ? 
metalc4 metalc ? ? C ZN  .  ZN  ? ? ? 1_555 B GLU 49 OE2 ? ? A ZN  590 B GLU 494 1_555 ? ? ? ? ? ? ? 1.950 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_atom_sites.entry_id                    7SR2 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.022709 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.007939 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013181 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020727 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C  ? ? 3.54356  2.42580 ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N  ? ? 4.01032  2.96436 ? ? 19.97189 1.75589  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O  ? ? 4.49882  3.47563 ? ? 15.80542 1.70748  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S  ? ? 9.55732  6.39887 ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
ZN ? ? 24.64596 5.25405 ? ? 2.14387  29.76375 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   446 ?   ?   ?   A . n 
A 1 2   GLN 2   447 ?   ?   ?   A . n 
A 1 3   LYS 3   448 ?   ?   ?   A . n 
A 1 4   ILE 4   449 285 ILE ILE A . n 
A 1 5   LEU 5   450 286 LEU LEU A . n 
A 1 6   GLN 6   451 287 GLN GLN A . n 
A 1 7   PHE 7   452 288 PHE PHE A . n 
A 1 8   GLU 8   453 289 GLU GLU A . n 
A 1 9   ASP 9   454 290 ASP ASP A . n 
A 1 10  ILE 10  455 291 ILE ILE A . n 
A 1 11  LEU 11  456 292 LEU LEU A . n 
A 1 12  ALA 12  457 293 ALA ALA A . n 
A 1 13  ASN 13  458 294 ASN ASN A . n 
A 1 14  THR 14  459 295 THR THR A . n 
A 1 15  PHE 15  460 296 PHE PHE A . n 
A 1 16  TYR 16  461 297 TYR TYR A . n 
A 1 17  ARG 17  462 298 ARG ARG A . n 
A 1 18  GLU 18  463 299 GLU GLU A . n 
A 1 19  HIS 19  464 300 HIS HIS A . n 
A 1 20  PHE 20  465 301 PHE PHE A . n 
A 1 21  GLY 21  466 302 GLY GLY A . n 
A 1 22  MET 22  467 303 MET MET A . n 
A 1 23  TYR 23  468 304 TYR TYR A . n 
A 1 24  MET 24  469 305 MET MET A . n 
A 1 25  GLU 25  470 306 GLU GLU A . n 
A 1 26  ARG 26  471 307 ARG ARG A . n 
A 1 27  MET 27  472 308 MET MET A . n 
A 1 28  ASP 28  473 309 ASP ASP A . n 
A 1 29  LYS 29  474 310 LYS LYS A . n 
A 1 30  ARG 30  475 311 ARG ARG A . n 
A 1 31  ALA 31  476 312 ALA ALA A . n 
A 1 32  LEU 32  477 313 LEU LEU A . n 
A 1 33  ILE 33  478 314 ILE ILE A . n 
A 1 34  SER 34  479 315 SER SER A . n 
A 1 35  PHE 35  480 316 PHE PHE A . n 
A 1 36  TRP 36  481 317 TRP TRP A . n 
A 1 37  GLU 37  482 318 GLU GLU A . n 
A 1 38  SER 38  483 319 SER SER A . n 
A 1 39  VAL 39  484 320 VAL VAL A . n 
A 1 40  GLU 40  485 321 GLU GLU A . n 
A 1 41  HIS 41  486 322 HIS HIS A . n 
A 1 42  LEU 42  487 323 LEU LEU A . n 
A 1 43  LYS 43  488 324 LYS LYS A . n 
A 1 44  ASN 44  489 325 ASN ASN A . n 
A 1 45  ALA 45  490 326 ALA ALA A . n 
A 1 46  ASN 46  491 327 ASN ASN A . n 
A 1 47  LYS 47  492 328 LYS LYS A . n 
A 1 48  ASN 48  493 329 ASN ASN A . n 
A 1 49  GLU 49  494 330 GLU GLU A . n 
A 1 50  ILE 50  495 331 ILE ILE A . n 
A 1 51  PRO 51  496 332 PRO PRO A . n 
A 1 52  GLN 52  497 333 GLN GLN A . n 
A 1 53  LEU 53  498 334 LEU LEU A . n 
A 1 54  VAL 54  499 335 VAL VAL A . n 
A 1 55  GLY 55  500 336 GLY GLY A . n 
A 1 56  GLU 56  501 337 GLU GLU A . n 
A 1 57  ILE 57  502 338 ILE ILE A . n 
A 1 58  TYR 58  503 339 TYR TYR A . n 
A 1 59  GLN 59  504 340 GLN GLN A . n 
A 1 60  ASN 60  505 341 ASN ASN A . n 
A 1 61  PHE 61  506 342 PHE PHE A . n 
A 1 62  PHE 62  507 343 PHE PHE A . n 
A 1 63  VAL 63  508 344 VAL VAL A . n 
A 1 64  GLU 64  509 345 GLU GLU A . n 
A 1 65  SER 65  510 346 SER SER A . n 
A 1 66  LYS 66  511 347 LYS LYS A . n 
A 1 67  GLU 67  512 348 GLU GLU A . n 
A 1 68  ILE 68  513 349 ILE ILE A . n 
A 1 69  SER 69  514 350 SER SER A . n 
A 1 70  VAL 70  515 351 VAL VAL A . n 
A 1 71  GLU 71  516 352 GLU GLU A . n 
A 1 72  LYS 72  517 353 LYS LYS A . n 
A 1 73  SER 73  518 354 SER SER A . n 
A 1 74  LEU 74  519 355 LEU LEU A . n 
A 1 75  TYR 75  520 356 TYR TYR A . n 
A 1 76  LYS 76  521 357 LYS LYS A . n 
A 1 77  GLU 77  522 358 GLU GLU A . n 
A 1 78  ILE 78  523 359 ILE ILE A . n 
A 1 79  GLN 79  524 360 GLN GLN A . n 
A 1 80  GLN 80  525 361 GLN GLN A . n 
A 1 81  ALA 81  526 362 ALA ALA A . n 
A 1 82  LEU 82  527 363 LEU LEU A . n 
A 1 83  VAL 83  528 364 VAL VAL A . n 
A 1 84  GLY 84  529 365 GLY GLY A . n 
A 1 85  ASN 85  530 366 ASN ASN A . n 
A 1 86  LYS 86  531 367 LYS LYS A . n 
A 1 87  GLY 87  532 368 GLY GLY A . n 
A 1 88  ILE 88  533 369 ILE ILE A . n 
A 1 89  GLU 89  534 370 GLU GLU A . n 
A 1 90  VAL 90  535 371 VAL VAL A . n 
A 1 91  PHE 91  536 372 PHE PHE A . n 
A 1 92  TYR 92  537 373 TYR TYR A . n 
A 1 93  LYS 93  538 374 LYS LYS A . n 
A 1 94  ILE 94  539 375 ILE ILE A . n 
A 1 95  GLN 95  540 376 GLN GLN A . n 
A 1 96  GLU 96  541 377 GLU GLU A . n 
A 1 97  ASP 97  542 378 ASP ASP A . n 
A 1 98  VAL 98  543 379 VAL VAL A . n 
A 1 99  TYR 99  544 380 TYR TYR A . n 
A 1 100 GLU 100 545 381 GLU GLU A . n 
A 1 101 THR 101 546 382 THR THR A . n 
A 1 102 LEU 102 547 383 LEU LEU A . n 
A 1 103 LYS 103 548 384 LYS LYS A . n 
A 1 104 ASP 104 549 385 ASP ASP A . n 
A 1 105 ARG 105 550 386 ARG ARG A . n 
A 1 106 TYR 106 551 387 TYR TYR A . n 
A 1 107 TYR 107 552 388 TYR TYR A . n 
A 1 108 PRO 108 553 389 PRO PRO A . n 
A 1 109 SER 109 554 390 SER SER A . n 
A 1 110 PHE 110 555 391 PHE PHE A . n 
A 1 111 ILE 111 556 392 ILE ILE A . n 
A 1 112 VAL 112 557 393 VAL VAL A . n 
A 1 113 SER 113 558 394 SER SER A . n 
A 1 114 ASP 114 559 395 ASP ASP A . n 
A 1 115 LEU 115 560 396 LEU LEU A . n 
A 1 116 TYR 116 561 397 TYR TYR A . n 
A 1 117 GLU 117 562 398 GLU GLU A . n 
A 1 118 LYS 118 563 399 LYS LYS A . n 
A 1 119 LEU 119 564 400 LEU LEU A . n 
A 1 120 LEU 120 565 ?   ?   ?   A . n 
A 1 121 ILE 121 566 ?   ?   ?   A . n 
A 1 122 LYS 122 567 ?   ?   ?   A . n 
A 1 123 GLU 123 568 ?   ?   ?   A . n 
A 1 124 GLU 124 569 ?   ?   ?   A . n 
B 1 1   SER 1   446 ?   ?   ?   B . n 
B 1 2   GLN 2   447 ?   ?   ?   B . n 
B 1 3   LYS 3   448 284 LYS LYS B . n 
B 1 4   ILE 4   449 285 ILE ILE B . n 
B 1 5   LEU 5   450 286 LEU LEU B . n 
B 1 6   GLN 6   451 287 GLN GLN B . n 
B 1 7   PHE 7   452 288 PHE PHE B . n 
B 1 8   GLU 8   453 289 GLU GLU B . n 
B 1 9   ASP 9   454 290 ASP ASP B . n 
B 1 10  ILE 10  455 291 ILE ILE B . n 
B 1 11  LEU 11  456 292 LEU LEU B . n 
B 1 12  ALA 12  457 293 ALA ALA B . n 
B 1 13  ASN 13  458 294 ASN ASN B . n 
B 1 14  THR 14  459 295 THR THR B . n 
B 1 15  PHE 15  460 296 PHE PHE B . n 
B 1 16  TYR 16  461 297 TYR TYR B . n 
B 1 17  ARG 17  462 298 ARG ARG B . n 
B 1 18  GLU 18  463 299 GLU GLU B . n 
B 1 19  HIS 19  464 300 HIS HIS B . n 
B 1 20  PHE 20  465 301 PHE PHE B . n 
B 1 21  GLY 21  466 302 GLY GLY B . n 
B 1 22  MET 22  467 303 MET MET B . n 
B 1 23  TYR 23  468 304 TYR TYR B . n 
B 1 24  MET 24  469 305 MET MET B . n 
B 1 25  GLU 25  470 306 GLU GLU B . n 
B 1 26  ARG 26  471 307 ARG ARG B . n 
B 1 27  MET 27  472 308 MET MET B . n 
B 1 28  ASP 28  473 309 ASP ASP B . n 
B 1 29  LYS 29  474 310 LYS LYS B . n 
B 1 30  ARG 30  475 311 ARG ARG B . n 
B 1 31  ALA 31  476 312 ALA ALA B . n 
B 1 32  LEU 32  477 313 LEU LEU B . n 
B 1 33  ILE 33  478 314 ILE ILE B . n 
B 1 34  SER 34  479 315 SER SER B . n 
B 1 35  PHE 35  480 316 PHE PHE B . n 
B 1 36  TRP 36  481 317 TRP TRP B . n 
B 1 37  GLU 37  482 318 GLU GLU B . n 
B 1 38  SER 38  483 319 SER SER B . n 
B 1 39  VAL 39  484 320 VAL VAL B . n 
B 1 40  GLU 40  485 321 GLU GLU B . n 
B 1 41  HIS 41  486 322 HIS HIS B . n 
B 1 42  LEU 42  487 323 LEU LEU B . n 
B 1 43  LYS 43  488 324 LYS LYS B . n 
B 1 44  ASN 44  489 325 ASN ASN B . n 
B 1 45  ALA 45  490 326 ALA ALA B . n 
B 1 46  ASN 46  491 327 ASN ASN B . n 
B 1 47  LYS 47  492 328 LYS LYS B . n 
B 1 48  ASN 48  493 329 ASN ASN B . n 
B 1 49  GLU 49  494 330 GLU GLU B . n 
B 1 50  ILE 50  495 331 ILE ILE B . n 
B 1 51  PRO 51  496 332 PRO PRO B . n 
B 1 52  GLN 52  497 333 GLN GLN B . n 
B 1 53  LEU 53  498 334 LEU LEU B . n 
B 1 54  VAL 54  499 335 VAL VAL B . n 
B 1 55  GLY 55  500 336 GLY GLY B . n 
B 1 56  GLU 56  501 337 GLU GLU B . n 
B 1 57  ILE 57  502 338 ILE ILE B . n 
B 1 58  TYR 58  503 339 TYR TYR B . n 
B 1 59  GLN 59  504 340 GLN GLN B . n 
B 1 60  ASN 60  505 341 ASN ASN B . n 
B 1 61  PHE 61  506 342 PHE PHE B . n 
B 1 62  PHE 62  507 343 PHE PHE B . n 
B 1 63  VAL 63  508 344 VAL VAL B . n 
B 1 64  GLU 64  509 345 GLU GLU B . n 
B 1 65  SER 65  510 346 SER SER B . n 
B 1 66  LYS 66  511 347 LYS LYS B . n 
B 1 67  GLU 67  512 348 GLU GLU B . n 
B 1 68  ILE 68  513 349 ILE ILE B . n 
B 1 69  SER 69  514 350 SER SER B . n 
B 1 70  VAL 70  515 351 VAL VAL B . n 
B 1 71  GLU 71  516 352 GLU GLU B . n 
B 1 72  LYS 72  517 353 LYS LYS B . n 
B 1 73  SER 73  518 354 SER SER B . n 
B 1 74  LEU 74  519 355 LEU LEU B . n 
B 1 75  TYR 75  520 356 TYR TYR B . n 
B 1 76  LYS 76  521 357 LYS LYS B . n 
B 1 77  GLU 77  522 358 GLU GLU B . n 
B 1 78  ILE 78  523 359 ILE ILE B . n 
B 1 79  GLN 79  524 360 GLN GLN B . n 
B 1 80  GLN 80  525 361 GLN GLN B . n 
B 1 81  ALA 81  526 362 ALA ALA B . n 
B 1 82  LEU 82  527 363 LEU LEU B . n 
B 1 83  VAL 83  528 364 VAL VAL B . n 
B 1 84  GLY 84  529 365 GLY GLY B . n 
B 1 85  ASN 85  530 366 ASN ASN B . n 
B 1 86  LYS 86  531 367 LYS LYS B . n 
B 1 87  GLY 87  532 368 GLY GLY B . n 
B 1 88  ILE 88  533 369 ILE ILE B . n 
B 1 89  GLU 89  534 370 GLU GLU B . n 
B 1 90  VAL 90  535 371 VAL VAL B . n 
B 1 91  PHE 91  536 372 PHE PHE B . n 
B 1 92  TYR 92  537 373 TYR TYR B . n 
B 1 93  LYS 93  538 374 LYS LYS B . n 
B 1 94  ILE 94  539 375 ILE ILE B . n 
B 1 95  GLN 95  540 376 GLN GLN B . n 
B 1 96  GLU 96  541 377 GLU GLU B . n 
B 1 97  ASP 97  542 378 ASP ASP B . n 
B 1 98  VAL 98  543 379 VAL VAL B . n 
B 1 99  TYR 99  544 380 TYR TYR B . n 
B 1 100 GLU 100 545 381 GLU GLU B . n 
B 1 101 THR 101 546 382 THR THR B . n 
B 1 102 LEU 102 547 383 LEU LEU B . n 
B 1 103 LYS 103 548 384 LYS LYS B . n 
B 1 104 ASP 104 549 385 ASP ASP B . n 
B 1 105 ARG 105 550 386 ARG ARG B . n 
B 1 106 TYR 106 551 387 TYR TYR B . n 
B 1 107 TYR 107 552 388 TYR TYR B . n 
B 1 108 PRO 108 553 389 PRO PRO B . n 
B 1 109 SER 109 554 390 SER SER B . n 
B 1 110 PHE 110 555 391 PHE PHE B . n 
B 1 111 ILE 111 556 392 ILE ILE B . n 
B 1 112 VAL 112 557 393 VAL VAL B . n 
B 1 113 SER 113 558 394 SER SER B . n 
B 1 114 ASP 114 559 395 ASP ASP B . n 
B 1 115 LEU 115 560 396 LEU LEU B . n 
B 1 116 TYR 116 561 397 TYR TYR B . n 
B 1 117 GLU 117 562 398 GLU GLU B . n 
B 1 118 LYS 118 563 399 LYS LYS B . n 
B 1 119 LEU 119 564 400 LEU LEU B . n 
B 1 120 LEU 120 565 ?   ?   ?   B . n 
B 1 121 ILE 121 566 ?   ?   ?   B . n 
B 1 122 LYS 122 567 ?   ?   ?   B . n 
B 1 123 GLU 123 568 ?   ?   ?   B . n 
B 1 124 GLU 124 569 ?   ?   ?   B . n 
# 
_pdbx_contact_author.id                 2 
_pdbx_contact_author.email              b.collins@imb.uq.edu.au 
_pdbx_contact_author.name_first         Brett 
_pdbx_contact_author.name_last          Collins 
_pdbx_contact_author.name_mi            M 
_pdbx_contact_author.role               'principal investigator/group leader' 
_pdbx_contact_author.identifier_ORCID   0000-0002-6070-3774 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1  590 1   ZN  ZN  A . 
D 3 LEU 1  590 401 LEU LEU B . 
E 4 ACT 1  591 501 ACT ACT B . 
F 5 HOH 1  601 22  HOH HOH A . 
F 5 HOH 2  602 20  HOH HOH A . 
F 5 HOH 3  603 21  HOH HOH A . 
F 5 HOH 4  604 19  HOH HOH A . 
F 5 HOH 5  605 13  HOH HOH A . 
F 5 HOH 6  606 7   HOH HOH A . 
F 5 HOH 7  607 30  HOH HOH A . 
F 5 HOH 8  608 17  HOH HOH A . 
F 5 HOH 9  609 2   HOH HOH A . 
F 5 HOH 10 610 6   HOH HOH A . 
F 5 HOH 11 611 1   HOH HOH A . 
F 5 HOH 12 612 28  HOH HOH A . 
F 5 HOH 13 613 25  HOH HOH A . 
F 5 HOH 14 614 23  HOH HOH A . 
F 5 HOH 15 615 27  HOH HOH A . 
F 5 HOH 16 616 8   HOH HOH A . 
F 5 HOH 17 617 4   HOH HOH A . 
F 5 HOH 18 618 11  HOH HOH A . 
F 5 HOH 19 619 14  HOH HOH A . 
G 5 HOH 1  601 24  HOH HOH B . 
G 5 HOH 2  602 16  HOH HOH B . 
G 5 HOH 3  603 3   HOH HOH B . 
G 5 HOH 4  604 5   HOH HOH B . 
G 5 HOH 5  605 12  HOH HOH B . 
G 5 HOH 6  606 10  HOH HOH B . 
G 5 HOH 7  607 15  HOH HOH B . 
G 5 HOH 8  608 29  HOH HOH B . 
G 5 HOH 9  609 18  HOH HOH B . 
G 5 HOH 10 610 9   HOH HOH B . 
G 5 HOH 11 611 26  HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,F   
2 1 B,D,E,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? A HIS 41 ? A HIS 486 ? 1_555 ZN ? C ZN . ? A ZN 590 ? 1_555 OE1 ? A GLU 49 ? A GLU 494 ? 1_555 96.6  ? 
2 NE2 ? A HIS 41 ? A HIS 486 ? 1_555 ZN ? C ZN . ? A ZN 590 ? 1_555 NE2 ? B HIS 41 ? B HIS 486 ? 1_555 106.6 ? 
3 OE1 ? A GLU 49 ? A GLU 494 ? 1_555 ZN ? C ZN . ? A ZN 590 ? 1_555 NE2 ? B HIS 41 ? B HIS 486 ? 1_555 126.0 ? 
4 NE2 ? A HIS 41 ? A HIS 486 ? 1_555 ZN ? C ZN . ? A ZN 590 ? 1_555 OE2 ? B GLU 49 ? B GLU 494 ? 1_555 94.8  ? 
5 OE1 ? A GLU 49 ? A GLU 494 ? 1_555 ZN ? C ZN . ? A ZN 590 ? 1_555 OE2 ? B GLU 49 ? B GLU 494 ? 1_555 107.0 ? 
6 NE2 ? B HIS 41 ? B HIS 486 ? 1_555 ZN ? C ZN . ? A ZN 590 ? 1_555 OE2 ? B GLU 49 ? B GLU 494 ? 1_555 118.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2021-11-17 
2 'Structure model' 1 1 2022-06-01 
3 'Structure model' 1 2 2023-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                      
2 2 'Structure model' citation_author               
3 3 'Structure model' chem_comp_atom                
4 3 'Structure model' chem_comp_bond                
5 3 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_CSD'          
4  2 'Structure model' '_citation.journal_id_ISSN'         
5  2 'Structure model' '_citation.journal_volume'          
6  2 'Structure model' '_citation.page_first'              
7  2 'Structure model' '_citation.page_last'               
8  2 'Structure model' '_citation.pdbx_database_id_DOI'    
9  2 'Structure model' '_citation.pdbx_database_id_PubMed' 
10 2 'Structure model' '_citation.title'                   
11 2 'Structure model' '_citation.year'                    
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z       
2 -x,y+1/2,-z 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? 1.20rc3_4406 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .            2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .            3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .            4 
# 
_pdbx_entry_details.entry_id                 7SR2 
_pdbx_entry_details.has_ligand_of_interest   N 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OG  A SER 554 ? ? O A HOH 601 ? ? 2.04 
2 1 OE2 A GLU 485 ? ? O A HOH 602 ? ? 2.16 
3 1 OD1 A ASN 493 ? ? O A HOH 603 ? ? 2.17 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     604 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     610 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_656 
_pdbx_validate_symm_contact.dist              1.98 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 507 ? ? 68.13   -13.21  
2 1 VAL A 508 ? ? -130.47 -68.17  
3 1 GLU A 516 ? ? 60.87   -122.08 
4 1 LYS B 531 ? ? 46.42   -136.52 
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     N 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     B 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     LEU 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      590 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     OXT 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    D 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    LEU 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     1 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    OXT 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 446 ? A SER 1   
2  1 Y 1 A GLN 447 ? A GLN 2   
3  1 Y 1 A LYS 448 ? A LYS 3   
4  1 Y 1 A LEU 565 ? A LEU 120 
5  1 Y 1 A ILE 566 ? A ILE 121 
6  1 Y 1 A LYS 567 ? A LYS 122 
7  1 Y 1 A GLU 568 ? A GLU 123 
8  1 Y 1 A GLU 569 ? A GLU 124 
9  1 Y 1 B SER 446 ? B SER 1   
10 1 Y 1 B GLN 447 ? B GLN 2   
11 1 Y 1 B LEU 565 ? B LEU 120 
12 1 Y 1 B ILE 566 ? B ILE 121 
13 1 Y 1 B LYS 567 ? B LYS 122 
14 1 Y 1 B GLU 568 ? B GLU 123 
15 1 Y 1 B GLU 569 ? B GLU 124 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ACT C    C  N N 1   
ACT O    O  N N 2   
ACT OXT  O  N N 3   
ACT CH3  C  N N 4   
ACT H1   H  N N 5   
ACT H2   H  N N 6   
ACT H3   H  N N 7   
ALA N    N  N N 8   
ALA CA   C  N S 9   
ALA C    C  N N 10  
ALA O    O  N N 11  
ALA CB   C  N N 12  
ALA OXT  O  N N 13  
ALA H    H  N N 14  
ALA H2   H  N N 15  
ALA HA   H  N N 16  
ALA HB1  H  N N 17  
ALA HB2  H  N N 18  
ALA HB3  H  N N 19  
ALA HXT  H  N N 20  
ARG N    N  N N 21  
ARG CA   C  N S 22  
ARG C    C  N N 23  
ARG O    O  N N 24  
ARG CB   C  N N 25  
ARG CG   C  N N 26  
ARG CD   C  N N 27  
ARG NE   N  N N 28  
ARG CZ   C  N N 29  
ARG NH1  N  N N 30  
ARG NH2  N  N N 31  
ARG OXT  O  N N 32  
ARG H    H  N N 33  
ARG H2   H  N N 34  
ARG HA   H  N N 35  
ARG HB2  H  N N 36  
ARG HB3  H  N N 37  
ARG HG2  H  N N 38  
ARG HG3  H  N N 39  
ARG HD2  H  N N 40  
ARG HD3  H  N N 41  
ARG HE   H  N N 42  
ARG HH11 H  N N 43  
ARG HH12 H  N N 44  
ARG HH21 H  N N 45  
ARG HH22 H  N N 46  
ARG HXT  H  N N 47  
ASN N    N  N N 48  
ASN CA   C  N S 49  
ASN C    C  N N 50  
ASN O    O  N N 51  
ASN CB   C  N N 52  
ASN CG   C  N N 53  
ASN OD1  O  N N 54  
ASN ND2  N  N N 55  
ASN OXT  O  N N 56  
ASN H    H  N N 57  
ASN H2   H  N N 58  
ASN HA   H  N N 59  
ASN HB2  H  N N 60  
ASN HB3  H  N N 61  
ASN HD21 H  N N 62  
ASN HD22 H  N N 63  
ASN HXT  H  N N 64  
ASP N    N  N N 65  
ASP CA   C  N S 66  
ASP C    C  N N 67  
ASP O    O  N N 68  
ASP CB   C  N N 69  
ASP CG   C  N N 70  
ASP OD1  O  N N 71  
ASP OD2  O  N N 72  
ASP OXT  O  N N 73  
ASP H    H  N N 74  
ASP H2   H  N N 75  
ASP HA   H  N N 76  
ASP HB2  H  N N 77  
ASP HB3  H  N N 78  
ASP HD2  H  N N 79  
ASP HXT  H  N N 80  
CYS N    N  N N 81  
CYS CA   C  N R 82  
CYS C    C  N N 83  
CYS O    O  N N 84  
CYS CB   C  N N 85  
CYS SG   S  N N 86  
CYS OXT  O  N N 87  
CYS H    H  N N 88  
CYS H2   H  N N 89  
CYS HA   H  N N 90  
CYS HB2  H  N N 91  
CYS HB3  H  N N 92  
CYS HG   H  N N 93  
CYS HXT  H  N N 94  
GLN N    N  N N 95  
GLN CA   C  N S 96  
GLN C    C  N N 97  
GLN O    O  N N 98  
GLN CB   C  N N 99  
GLN CG   C  N N 100 
GLN CD   C  N N 101 
GLN OE1  O  N N 102 
GLN NE2  N  N N 103 
GLN OXT  O  N N 104 
GLN H    H  N N 105 
GLN H2   H  N N 106 
GLN HA   H  N N 107 
GLN HB2  H  N N 108 
GLN HB3  H  N N 109 
GLN HG2  H  N N 110 
GLN HG3  H  N N 111 
GLN HE21 H  N N 112 
GLN HE22 H  N N 113 
GLN HXT  H  N N 114 
GLU N    N  N N 115 
GLU CA   C  N S 116 
GLU C    C  N N 117 
GLU O    O  N N 118 
GLU CB   C  N N 119 
GLU CG   C  N N 120 
GLU CD   C  N N 121 
GLU OE1  O  N N 122 
GLU OE2  O  N N 123 
GLU OXT  O  N N 124 
GLU H    H  N N 125 
GLU H2   H  N N 126 
GLU HA   H  N N 127 
GLU HB2  H  N N 128 
GLU HB3  H  N N 129 
GLU HG2  H  N N 130 
GLU HG3  H  N N 131 
GLU HE2  H  N N 132 
GLU HXT  H  N N 133 
GLY N    N  N N 134 
GLY CA   C  N N 135 
GLY C    C  N N 136 
GLY O    O  N N 137 
GLY OXT  O  N N 138 
GLY H    H  N N 139 
GLY H2   H  N N 140 
GLY HA2  H  N N 141 
GLY HA3  H  N N 142 
GLY HXT  H  N N 143 
HIS N    N  N N 144 
HIS CA   C  N S 145 
HIS C    C  N N 146 
HIS O    O  N N 147 
HIS CB   C  N N 148 
HIS CG   C  Y N 149 
HIS ND1  N  Y N 150 
HIS CD2  C  Y N 151 
HIS CE1  C  Y N 152 
HIS NE2  N  Y N 153 
HIS OXT  O  N N 154 
HIS H    H  N N 155 
HIS H2   H  N N 156 
HIS HA   H  N N 157 
HIS HB2  H  N N 158 
HIS HB3  H  N N 159 
HIS HD1  H  N N 160 
HIS HD2  H  N N 161 
HIS HE1  H  N N 162 
HIS HE2  H  N N 163 
HIS HXT  H  N N 164 
HOH O    O  N N 165 
HOH H1   H  N N 166 
HOH H2   H  N N 167 
ILE N    N  N N 168 
ILE CA   C  N S 169 
ILE C    C  N N 170 
ILE O    O  N N 171 
ILE CB   C  N S 172 
ILE CG1  C  N N 173 
ILE CG2  C  N N 174 
ILE CD1  C  N N 175 
ILE OXT  O  N N 176 
ILE H    H  N N 177 
ILE H2   H  N N 178 
ILE HA   H  N N 179 
ILE HB   H  N N 180 
ILE HG12 H  N N 181 
ILE HG13 H  N N 182 
ILE HG21 H  N N 183 
ILE HG22 H  N N 184 
ILE HG23 H  N N 185 
ILE HD11 H  N N 186 
ILE HD12 H  N N 187 
ILE HD13 H  N N 188 
ILE HXT  H  N N 189 
LEU N    N  N N 190 
LEU CA   C  N S 191 
LEU C    C  N N 192 
LEU O    O  N N 193 
LEU CB   C  N N 194 
LEU CG   C  N N 195 
LEU CD1  C  N N 196 
LEU CD2  C  N N 197 
LEU OXT  O  N N 198 
LEU H    H  N N 199 
LEU H2   H  N N 200 
LEU HA   H  N N 201 
LEU HB2  H  N N 202 
LEU HB3  H  N N 203 
LEU HG   H  N N 204 
LEU HD11 H  N N 205 
LEU HD12 H  N N 206 
LEU HD13 H  N N 207 
LEU HD21 H  N N 208 
LEU HD22 H  N N 209 
LEU HD23 H  N N 210 
LEU HXT  H  N N 211 
LYS N    N  N N 212 
LYS CA   C  N S 213 
LYS C    C  N N 214 
LYS O    O  N N 215 
LYS CB   C  N N 216 
LYS CG   C  N N 217 
LYS CD   C  N N 218 
LYS CE   C  N N 219 
LYS NZ   N  N N 220 
LYS OXT  O  N N 221 
LYS H    H  N N 222 
LYS H2   H  N N 223 
LYS HA   H  N N 224 
LYS HB2  H  N N 225 
LYS HB3  H  N N 226 
LYS HG2  H  N N 227 
LYS HG3  H  N N 228 
LYS HD2  H  N N 229 
LYS HD3  H  N N 230 
LYS HE2  H  N N 231 
LYS HE3  H  N N 232 
LYS HZ1  H  N N 233 
LYS HZ2  H  N N 234 
LYS HZ3  H  N N 235 
LYS HXT  H  N N 236 
MET N    N  N N 237 
MET CA   C  N S 238 
MET C    C  N N 239 
MET O    O  N N 240 
MET CB   C  N N 241 
MET CG   C  N N 242 
MET SD   S  N N 243 
MET CE   C  N N 244 
MET OXT  O  N N 245 
MET H    H  N N 246 
MET H2   H  N N 247 
MET HA   H  N N 248 
MET HB2  H  N N 249 
MET HB3  H  N N 250 
MET HG2  H  N N 251 
MET HG3  H  N N 252 
MET HE1  H  N N 253 
MET HE2  H  N N 254 
MET HE3  H  N N 255 
MET HXT  H  N N 256 
PHE N    N  N N 257 
PHE CA   C  N S 258 
PHE C    C  N N 259 
PHE O    O  N N 260 
PHE CB   C  N N 261 
PHE CG   C  Y N 262 
PHE CD1  C  Y N 263 
PHE CD2  C  Y N 264 
PHE CE1  C  Y N 265 
PHE CE2  C  Y N 266 
PHE CZ   C  Y N 267 
PHE OXT  O  N N 268 
PHE H    H  N N 269 
PHE H2   H  N N 270 
PHE HA   H  N N 271 
PHE HB2  H  N N 272 
PHE HB3  H  N N 273 
PHE HD1  H  N N 274 
PHE HD2  H  N N 275 
PHE HE1  H  N N 276 
PHE HE2  H  N N 277 
PHE HZ   H  N N 278 
PHE HXT  H  N N 279 
PRO N    N  N N 280 
PRO CA   C  N S 281 
PRO C    C  N N 282 
PRO O    O  N N 283 
PRO CB   C  N N 284 
PRO CG   C  N N 285 
PRO CD   C  N N 286 
PRO OXT  O  N N 287 
PRO H    H  N N 288 
PRO HA   H  N N 289 
PRO HB2  H  N N 290 
PRO HB3  H  N N 291 
PRO HG2  H  N N 292 
PRO HG3  H  N N 293 
PRO HD2  H  N N 294 
PRO HD3  H  N N 295 
PRO HXT  H  N N 296 
SER N    N  N N 297 
SER CA   C  N S 298 
SER C    C  N N 299 
SER O    O  N N 300 
SER CB   C  N N 301 
SER OG   O  N N 302 
SER OXT  O  N N 303 
SER H    H  N N 304 
SER H2   H  N N 305 
SER HA   H  N N 306 
SER HB2  H  N N 307 
SER HB3  H  N N 308 
SER HG   H  N N 309 
SER HXT  H  N N 310 
THR N    N  N N 311 
THR CA   C  N S 312 
THR C    C  N N 313 
THR O    O  N N 314 
THR CB   C  N R 315 
THR OG1  O  N N 316 
THR CG2  C  N N 317 
THR OXT  O  N N 318 
THR H    H  N N 319 
THR H2   H  N N 320 
THR HA   H  N N 321 
THR HB   H  N N 322 
THR HG1  H  N N 323 
THR HG21 H  N N 324 
THR HG22 H  N N 325 
THR HG23 H  N N 326 
THR HXT  H  N N 327 
TRP N    N  N N 328 
TRP CA   C  N S 329 
TRP C    C  N N 330 
TRP O    O  N N 331 
TRP CB   C  N N 332 
TRP CG   C  Y N 333 
TRP CD1  C  Y N 334 
TRP CD2  C  Y N 335 
TRP NE1  N  Y N 336 
TRP CE2  C  Y N 337 
TRP CE3  C  Y N 338 
TRP CZ2  C  Y N 339 
TRP CZ3  C  Y N 340 
TRP CH2  C  Y N 341 
TRP OXT  O  N N 342 
TRP H    H  N N 343 
TRP H2   H  N N 344 
TRP HA   H  N N 345 
TRP HB2  H  N N 346 
TRP HB3  H  N N 347 
TRP HD1  H  N N 348 
TRP HE1  H  N N 349 
TRP HE3  H  N N 350 
TRP HZ2  H  N N 351 
TRP HZ3  H  N N 352 
TRP HH2  H  N N 353 
TRP HXT  H  N N 354 
TYR N    N  N N 355 
TYR CA   C  N S 356 
TYR C    C  N N 357 
TYR O    O  N N 358 
TYR CB   C  N N 359 
TYR CG   C  Y N 360 
TYR CD1  C  Y N 361 
TYR CD2  C  Y N 362 
TYR CE1  C  Y N 363 
TYR CE2  C  Y N 364 
TYR CZ   C  Y N 365 
TYR OH   O  N N 366 
TYR OXT  O  N N 367 
TYR H    H  N N 368 
TYR H2   H  N N 369 
TYR HA   H  N N 370 
TYR HB2  H  N N 371 
TYR HB3  H  N N 372 
TYR HD1  H  N N 373 
TYR HD2  H  N N 374 
TYR HE1  H  N N 375 
TYR HE2  H  N N 376 
TYR HH   H  N N 377 
TYR HXT  H  N N 378 
VAL N    N  N N 379 
VAL CA   C  N S 380 
VAL C    C  N N 381 
VAL O    O  N N 382 
VAL CB   C  N N 383 
VAL CG1  C  N N 384 
VAL CG2  C  N N 385 
VAL OXT  O  N N 386 
VAL H    H  N N 387 
VAL H2   H  N N 388 
VAL HA   H  N N 389 
VAL HB   H  N N 390 
VAL HG11 H  N N 391 
VAL HG12 H  N N 392 
VAL HG13 H  N N 393 
VAL HG21 H  N N 394 
VAL HG22 H  N N 395 
VAL HG23 H  N N 396 
VAL HXT  H  N N 397 
ZN  ZN   ZN N N 398 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ACT C   O    doub N N 1   
ACT C   OXT  sing N N 2   
ACT C   CH3  sing N N 3   
ACT CH3 H1   sing N N 4   
ACT CH3 H2   sing N N 5   
ACT CH3 H3   sing N N 6   
ALA N   CA   sing N N 7   
ALA N   H    sing N N 8   
ALA N   H2   sing N N 9   
ALA CA  C    sing N N 10  
ALA CA  CB   sing N N 11  
ALA CA  HA   sing N N 12  
ALA C   O    doub N N 13  
ALA C   OXT  sing N N 14  
ALA CB  HB1  sing N N 15  
ALA CB  HB2  sing N N 16  
ALA CB  HB3  sing N N 17  
ALA OXT HXT  sing N N 18  
ARG N   CA   sing N N 19  
ARG N   H    sing N N 20  
ARG N   H2   sing N N 21  
ARG CA  C    sing N N 22  
ARG CA  CB   sing N N 23  
ARG CA  HA   sing N N 24  
ARG C   O    doub N N 25  
ARG C   OXT  sing N N 26  
ARG CB  CG   sing N N 27  
ARG CB  HB2  sing N N 28  
ARG CB  HB3  sing N N 29  
ARG CG  CD   sing N N 30  
ARG CG  HG2  sing N N 31  
ARG CG  HG3  sing N N 32  
ARG CD  NE   sing N N 33  
ARG CD  HD2  sing N N 34  
ARG CD  HD3  sing N N 35  
ARG NE  CZ   sing N N 36  
ARG NE  HE   sing N N 37  
ARG CZ  NH1  sing N N 38  
ARG CZ  NH2  doub N N 39  
ARG NH1 HH11 sing N N 40  
ARG NH1 HH12 sing N N 41  
ARG NH2 HH21 sing N N 42  
ARG NH2 HH22 sing N N 43  
ARG OXT HXT  sing N N 44  
ASN N   CA   sing N N 45  
ASN N   H    sing N N 46  
ASN N   H2   sing N N 47  
ASN CA  C    sing N N 48  
ASN CA  CB   sing N N 49  
ASN CA  HA   sing N N 50  
ASN C   O    doub N N 51  
ASN C   OXT  sing N N 52  
ASN CB  CG   sing N N 53  
ASN CB  HB2  sing N N 54  
ASN CB  HB3  sing N N 55  
ASN CG  OD1  doub N N 56  
ASN CG  ND2  sing N N 57  
ASN ND2 HD21 sing N N 58  
ASN ND2 HD22 sing N N 59  
ASN OXT HXT  sing N N 60  
ASP N   CA   sing N N 61  
ASP N   H    sing N N 62  
ASP N   H2   sing N N 63  
ASP CA  C    sing N N 64  
ASP CA  CB   sing N N 65  
ASP CA  HA   sing N N 66  
ASP C   O    doub N N 67  
ASP C   OXT  sing N N 68  
ASP CB  CG   sing N N 69  
ASP CB  HB2  sing N N 70  
ASP CB  HB3  sing N N 71  
ASP CG  OD1  doub N N 72  
ASP CG  OD2  sing N N 73  
ASP OD2 HD2  sing N N 74  
ASP OXT HXT  sing N N 75  
CYS N   CA   sing N N 76  
CYS N   H    sing N N 77  
CYS N   H2   sing N N 78  
CYS CA  C    sing N N 79  
CYS CA  CB   sing N N 80  
CYS CA  HA   sing N N 81  
CYS C   O    doub N N 82  
CYS C   OXT  sing N N 83  
CYS CB  SG   sing N N 84  
CYS CB  HB2  sing N N 85  
CYS CB  HB3  sing N N 86  
CYS SG  HG   sing N N 87  
CYS OXT HXT  sing N N 88  
GLN N   CA   sing N N 89  
GLN N   H    sing N N 90  
GLN N   H2   sing N N 91  
GLN CA  C    sing N N 92  
GLN CA  CB   sing N N 93  
GLN CA  HA   sing N N 94  
GLN C   O    doub N N 95  
GLN C   OXT  sing N N 96  
GLN CB  CG   sing N N 97  
GLN CB  HB2  sing N N 98  
GLN CB  HB3  sing N N 99  
GLN CG  CD   sing N N 100 
GLN CG  HG2  sing N N 101 
GLN CG  HG3  sing N N 102 
GLN CD  OE1  doub N N 103 
GLN CD  NE2  sing N N 104 
GLN NE2 HE21 sing N N 105 
GLN NE2 HE22 sing N N 106 
GLN OXT HXT  sing N N 107 
GLU N   CA   sing N N 108 
GLU N   H    sing N N 109 
GLU N   H2   sing N N 110 
GLU CA  C    sing N N 111 
GLU CA  CB   sing N N 112 
GLU CA  HA   sing N N 113 
GLU C   O    doub N N 114 
GLU C   OXT  sing N N 115 
GLU CB  CG   sing N N 116 
GLU CB  HB2  sing N N 117 
GLU CB  HB3  sing N N 118 
GLU CG  CD   sing N N 119 
GLU CG  HG2  sing N N 120 
GLU CG  HG3  sing N N 121 
GLU CD  OE1  doub N N 122 
GLU CD  OE2  sing N N 123 
GLU OE2 HE2  sing N N 124 
GLU OXT HXT  sing N N 125 
GLY N   CA   sing N N 126 
GLY N   H    sing N N 127 
GLY N   H2   sing N N 128 
GLY CA  C    sing N N 129 
GLY CA  HA2  sing N N 130 
GLY CA  HA3  sing N N 131 
GLY C   O    doub N N 132 
GLY C   OXT  sing N N 133 
GLY OXT HXT  sing N N 134 
HIS N   CA   sing N N 135 
HIS N   H    sing N N 136 
HIS N   H2   sing N N 137 
HIS CA  C    sing N N 138 
HIS CA  CB   sing N N 139 
HIS CA  HA   sing N N 140 
HIS C   O    doub N N 141 
HIS C   OXT  sing N N 142 
HIS CB  CG   sing N N 143 
HIS CB  HB2  sing N N 144 
HIS CB  HB3  sing N N 145 
HIS CG  ND1  sing Y N 146 
HIS CG  CD2  doub Y N 147 
HIS ND1 CE1  doub Y N 148 
HIS ND1 HD1  sing N N 149 
HIS CD2 NE2  sing Y N 150 
HIS CD2 HD2  sing N N 151 
HIS CE1 NE2  sing Y N 152 
HIS CE1 HE1  sing N N 153 
HIS NE2 HE2  sing N N 154 
HIS OXT HXT  sing N N 155 
HOH O   H1   sing N N 156 
HOH O   H2   sing N N 157 
ILE N   CA   sing N N 158 
ILE N   H    sing N N 159 
ILE N   H2   sing N N 160 
ILE CA  C    sing N N 161 
ILE CA  CB   sing N N 162 
ILE CA  HA   sing N N 163 
ILE C   O    doub N N 164 
ILE C   OXT  sing N N 165 
ILE CB  CG1  sing N N 166 
ILE CB  CG2  sing N N 167 
ILE CB  HB   sing N N 168 
ILE CG1 CD1  sing N N 169 
ILE CG1 HG12 sing N N 170 
ILE CG1 HG13 sing N N 171 
ILE CG2 HG21 sing N N 172 
ILE CG2 HG22 sing N N 173 
ILE CG2 HG23 sing N N 174 
ILE CD1 HD11 sing N N 175 
ILE CD1 HD12 sing N N 176 
ILE CD1 HD13 sing N N 177 
ILE OXT HXT  sing N N 178 
LEU N   CA   sing N N 179 
LEU N   H    sing N N 180 
LEU N   H2   sing N N 181 
LEU CA  C    sing N N 182 
LEU CA  CB   sing N N 183 
LEU CA  HA   sing N N 184 
LEU C   O    doub N N 185 
LEU C   OXT  sing N N 186 
LEU CB  CG   sing N N 187 
LEU CB  HB2  sing N N 188 
LEU CB  HB3  sing N N 189 
LEU CG  CD1  sing N N 190 
LEU CG  CD2  sing N N 191 
LEU CG  HG   sing N N 192 
LEU CD1 HD11 sing N N 193 
LEU CD1 HD12 sing N N 194 
LEU CD1 HD13 sing N N 195 
LEU CD2 HD21 sing N N 196 
LEU CD2 HD22 sing N N 197 
LEU CD2 HD23 sing N N 198 
LEU OXT HXT  sing N N 199 
LYS N   CA   sing N N 200 
LYS N   H    sing N N 201 
LYS N   H2   sing N N 202 
LYS CA  C    sing N N 203 
LYS CA  CB   sing N N 204 
LYS CA  HA   sing N N 205 
LYS C   O    doub N N 206 
LYS C   OXT  sing N N 207 
LYS CB  CG   sing N N 208 
LYS CB  HB2  sing N N 209 
LYS CB  HB3  sing N N 210 
LYS CG  CD   sing N N 211 
LYS CG  HG2  sing N N 212 
LYS CG  HG3  sing N N 213 
LYS CD  CE   sing N N 214 
LYS CD  HD2  sing N N 215 
LYS CD  HD3  sing N N 216 
LYS CE  NZ   sing N N 217 
LYS CE  HE2  sing N N 218 
LYS CE  HE3  sing N N 219 
LYS NZ  HZ1  sing N N 220 
LYS NZ  HZ2  sing N N 221 
LYS NZ  HZ3  sing N N 222 
LYS OXT HXT  sing N N 223 
MET N   CA   sing N N 224 
MET N   H    sing N N 225 
MET N   H2   sing N N 226 
MET CA  C    sing N N 227 
MET CA  CB   sing N N 228 
MET CA  HA   sing N N 229 
MET C   O    doub N N 230 
MET C   OXT  sing N N 231 
MET CB  CG   sing N N 232 
MET CB  HB2  sing N N 233 
MET CB  HB3  sing N N 234 
MET CG  SD   sing N N 235 
MET CG  HG2  sing N N 236 
MET CG  HG3  sing N N 237 
MET SD  CE   sing N N 238 
MET CE  HE1  sing N N 239 
MET CE  HE2  sing N N 240 
MET CE  HE3  sing N N 241 
MET OXT HXT  sing N N 242 
PHE N   CA   sing N N 243 
PHE N   H    sing N N 244 
PHE N   H2   sing N N 245 
PHE CA  C    sing N N 246 
PHE CA  CB   sing N N 247 
PHE CA  HA   sing N N 248 
PHE C   O    doub N N 249 
PHE C   OXT  sing N N 250 
PHE CB  CG   sing N N 251 
PHE CB  HB2  sing N N 252 
PHE CB  HB3  sing N N 253 
PHE CG  CD1  doub Y N 254 
PHE CG  CD2  sing Y N 255 
PHE CD1 CE1  sing Y N 256 
PHE CD1 HD1  sing N N 257 
PHE CD2 CE2  doub Y N 258 
PHE CD2 HD2  sing N N 259 
PHE CE1 CZ   doub Y N 260 
PHE CE1 HE1  sing N N 261 
PHE CE2 CZ   sing Y N 262 
PHE CE2 HE2  sing N N 263 
PHE CZ  HZ   sing N N 264 
PHE OXT HXT  sing N N 265 
PRO N   CA   sing N N 266 
PRO N   CD   sing N N 267 
PRO N   H    sing N N 268 
PRO CA  C    sing N N 269 
PRO CA  CB   sing N N 270 
PRO CA  HA   sing N N 271 
PRO C   O    doub N N 272 
PRO C   OXT  sing N N 273 
PRO CB  CG   sing N N 274 
PRO CB  HB2  sing N N 275 
PRO CB  HB3  sing N N 276 
PRO CG  CD   sing N N 277 
PRO CG  HG2  sing N N 278 
PRO CG  HG3  sing N N 279 
PRO CD  HD2  sing N N 280 
PRO CD  HD3  sing N N 281 
PRO OXT HXT  sing N N 282 
SER N   CA   sing N N 283 
SER N   H    sing N N 284 
SER N   H2   sing N N 285 
SER CA  C    sing N N 286 
SER CA  CB   sing N N 287 
SER CA  HA   sing N N 288 
SER C   O    doub N N 289 
SER C   OXT  sing N N 290 
SER CB  OG   sing N N 291 
SER CB  HB2  sing N N 292 
SER CB  HB3  sing N N 293 
SER OG  HG   sing N N 294 
SER OXT HXT  sing N N 295 
THR N   CA   sing N N 296 
THR N   H    sing N N 297 
THR N   H2   sing N N 298 
THR CA  C    sing N N 299 
THR CA  CB   sing N N 300 
THR CA  HA   sing N N 301 
THR C   O    doub N N 302 
THR C   OXT  sing N N 303 
THR CB  OG1  sing N N 304 
THR CB  CG2  sing N N 305 
THR CB  HB   sing N N 306 
THR OG1 HG1  sing N N 307 
THR CG2 HG21 sing N N 308 
THR CG2 HG22 sing N N 309 
THR CG2 HG23 sing N N 310 
THR OXT HXT  sing N N 311 
TRP N   CA   sing N N 312 
TRP N   H    sing N N 313 
TRP N   H2   sing N N 314 
TRP CA  C    sing N N 315 
TRP CA  CB   sing N N 316 
TRP CA  HA   sing N N 317 
TRP C   O    doub N N 318 
TRP C   OXT  sing N N 319 
TRP CB  CG   sing N N 320 
TRP CB  HB2  sing N N 321 
TRP CB  HB3  sing N N 322 
TRP CG  CD1  doub Y N 323 
TRP CG  CD2  sing Y N 324 
TRP CD1 NE1  sing Y N 325 
TRP CD1 HD1  sing N N 326 
TRP CD2 CE2  doub Y N 327 
TRP CD2 CE3  sing Y N 328 
TRP NE1 CE2  sing Y N 329 
TRP NE1 HE1  sing N N 330 
TRP CE2 CZ2  sing Y N 331 
TRP CE3 CZ3  doub Y N 332 
TRP CE3 HE3  sing N N 333 
TRP CZ2 CH2  doub Y N 334 
TRP CZ2 HZ2  sing N N 335 
TRP CZ3 CH2  sing Y N 336 
TRP CZ3 HZ3  sing N N 337 
TRP CH2 HH2  sing N N 338 
TRP OXT HXT  sing N N 339 
TYR N   CA   sing N N 340 
TYR N   H    sing N N 341 
TYR N   H2   sing N N 342 
TYR CA  C    sing N N 343 
TYR CA  CB   sing N N 344 
TYR CA  HA   sing N N 345 
TYR C   O    doub N N 346 
TYR C   OXT  sing N N 347 
TYR CB  CG   sing N N 348 
TYR CB  HB2  sing N N 349 
TYR CB  HB3  sing N N 350 
TYR CG  CD1  doub Y N 351 
TYR CG  CD2  sing Y N 352 
TYR CD1 CE1  sing Y N 353 
TYR CD1 HD1  sing N N 354 
TYR CD2 CE2  doub Y N 355 
TYR CD2 HD2  sing N N 356 
TYR CE1 CZ   doub Y N 357 
TYR CE1 HE1  sing N N 358 
TYR CE2 CZ   sing Y N 359 
TYR CE2 HE2  sing N N 360 
TYR CZ  OH   sing N N 361 
TYR OH  HH   sing N N 362 
TYR OXT HXT  sing N N 363 
VAL N   CA   sing N N 364 
VAL N   H    sing N N 365 
VAL N   H2   sing N N 366 
VAL CA  C    sing N N 367 
VAL CA  CB   sing N N 368 
VAL CA  HA   sing N N 369 
VAL C   O    doub N N 370 
VAL C   OXT  sing N N 371 
VAL CB  CG1  sing N N 372 
VAL CB  CG2  sing N N 373 
VAL CB  HB   sing N N 374 
VAL CG1 HG11 sing N N 375 
VAL CG1 HG12 sing N N 376 
VAL CG1 HG13 sing N N 377 
VAL CG2 HG21 sing N N 378 
VAL CG2 HG22 sing N N 379 
VAL CG2 HG23 sing N N 380 
VAL OXT HXT  sing N N 381 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Australian Research Council (ARC)'                               Australia DP200102551 1 
'National Health and Medical Research Council (NHMRC, Australia)' Australia APP1136021  2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'    ZN  
3 LEUCINE       LEU 
4 'ACETATE ION' ACT 
5 water         HOH 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   7SR1 
_pdbx_initial_refinement_model.details          ? 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_space_group.name_H-M_alt     'P 1 21 1' 
_space_group.name_Hall        'P 2yb' 
_space_group.IT_number        4 
_space_group.crystal_system   monoclinic 
_space_group.id               1 
#