data_7T5U # _entry.id 7T5U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7T5U pdb_00007t5u 10.2210/pdb7t5u/pdb WWPDB D_1000261716 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-09-14 2 'Structure model' 1 1 2022-10-12 3 'Structure model' 1 2 2022-11-30 4 'Structure model' 1 3 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.page_first' 2 2 'Structure model' '_citation.page_last' 3 2 'Structure model' '_citation.pdbx_database_id_DOI' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation_author.identifier_ORCID' 7 3 'Structure model' '_citation.journal_volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7T5U _pdbx_database_status.recvd_initial_deposition_date 2021-12-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email kcorbett@ucsd.edu _pdbx_contact_author.name_first Kevin _pdbx_contact_author.name_last Corbett _pdbx_contact_author.name_mi D _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5854-2388 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lau, R.K.' 1 ? 'Corbett, K.D.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Embo J.' _citation.journal_id_ASTM EMJODG _citation.journal_id_CSD 0897 _citation.journal_id_ISSN 1460-2075 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 41 _citation.language ? _citation.page_first e111540 _citation.page_last e111540 _citation.title 'A conserved signaling pathway activates bacterial CBASS immune signaling in response to DNA damage.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.15252/embj.2022111540 _citation.pdbx_database_id_PubMed 36156805 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lau, R.K.' 1 0000-0002-4182-4394 primary 'Enustun, E.' 2 0000-0001-7550-7752 primary 'Gu, Y.' 3 0000-0002-1514-1477 primary 'Nguyen, J.V.' 4 ? primary 'Corbett, K.D.' 5 0000-0001-5854-2388 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Helix-turn-helix domain-containing protein' 7678.672 1 ? ? 'HTH cro/C1-type domain, residues 2-67' ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 water nat water 18.015 87 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Helix-turn-helix transcriptional regulator,Transcriptional regulator,XRE family transcriptional regulator' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SNAATRLGEKLRDLRKQRGLTLEKLADMAGLSKSYLWELENRESQRPSAEKLTALADALGVGTSFFLED _entity_poly.pdbx_seq_one_letter_code_can SNAATRLGEKLRDLRKQRGLTLEKLADMAGLSKSYLWELENRESQRPSAEKLTALADALGVGTSFFLED _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 ALA n 1 5 THR n 1 6 ARG n 1 7 LEU n 1 8 GLY n 1 9 GLU n 1 10 LYS n 1 11 LEU n 1 12 ARG n 1 13 ASP n 1 14 LEU n 1 15 ARG n 1 16 LYS n 1 17 GLN n 1 18 ARG n 1 19 GLY n 1 20 LEU n 1 21 THR n 1 22 LEU n 1 23 GLU n 1 24 LYS n 1 25 LEU n 1 26 ALA n 1 27 ASP n 1 28 MET n 1 29 ALA n 1 30 GLY n 1 31 LEU n 1 32 SER n 1 33 LYS n 1 34 SER n 1 35 TYR n 1 36 LEU n 1 37 TRP n 1 38 GLU n 1 39 LEU n 1 40 GLU n 1 41 ASN n 1 42 ARG n 1 43 GLU n 1 44 SER n 1 45 GLN n 1 46 ARG n 1 47 PRO n 1 48 SER n 1 49 ALA n 1 50 GLU n 1 51 LYS n 1 52 LEU n 1 53 THR n 1 54 ALA n 1 55 LEU n 1 56 ALA n 1 57 ASP n 1 58 ALA n 1 59 LEU n 1 60 GLY n 1 61 VAL n 1 62 GLY n 1 63 THR n 1 64 SER n 1 65 PHE n 1 66 PHE n 1 67 LEU n 1 68 GLU n 1 69 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 69 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'nadR_1, BHS87_27750, D9K17_19515, GRQ19_13110, HV109_14215, NCTC13216_00230' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -1 ? ? ? A . n A 1 2 ASN 2 0 ? ? ? A . n A 1 3 ALA 3 1 ? ? ? A . n A 1 4 ALA 4 2 2 ALA ALA A . n A 1 5 THR 5 3 3 THR THR A . n A 1 6 ARG 6 4 4 ARG ARG A . n A 1 7 LEU 7 5 5 LEU LEU A . n A 1 8 GLY 8 6 6 GLY GLY A . n A 1 9 GLU 9 7 7 GLU GLU A . n A 1 10 LYS 10 8 8 LYS LYS A . n A 1 11 LEU 11 9 9 LEU LEU A . n A 1 12 ARG 12 10 10 ARG ARG A . n A 1 13 ASP 13 11 11 ASP ASP A . n A 1 14 LEU 14 12 12 LEU LEU A . n A 1 15 ARG 15 13 13 ARG ARG A . n A 1 16 LYS 16 14 14 LYS LYS A . n A 1 17 GLN 17 15 15 GLN GLN A . n A 1 18 ARG 18 16 16 ARG ARG A . n A 1 19 GLY 19 17 17 GLY GLY A . n A 1 20 LEU 20 18 18 LEU LEU A . n A 1 21 THR 21 19 19 THR THR A . n A 1 22 LEU 22 20 20 LEU LEU A . n A 1 23 GLU 23 21 21 GLU GLU A . n A 1 24 LYS 24 22 22 LYS LYS A . n A 1 25 LEU 25 23 23 LEU LEU A . n A 1 26 ALA 26 24 24 ALA ALA A . n A 1 27 ASP 27 25 25 ASP ASP A . n A 1 28 MET 28 26 26 MET MET A . n A 1 29 ALA 29 27 27 ALA ALA A . n A 1 30 GLY 30 28 28 GLY GLY A . n A 1 31 LEU 31 29 29 LEU LEU A . n A 1 32 SER 32 30 30 SER SER A . n A 1 33 LYS 33 31 31 LYS LYS A . n A 1 34 SER 34 32 32 SER SER A . n A 1 35 TYR 35 33 33 TYR TYR A . n A 1 36 LEU 36 34 34 LEU LEU A . n A 1 37 TRP 37 35 35 TRP TRP A . n A 1 38 GLU 38 36 36 GLU GLU A . n A 1 39 LEU 39 37 37 LEU LEU A . n A 1 40 GLU 40 38 38 GLU GLU A . n A 1 41 ASN 41 39 39 ASN ASN A . n A 1 42 ARG 42 40 40 ARG ARG A . n A 1 43 GLU 43 41 41 GLU GLU A . n A 1 44 SER 44 42 42 SER SER A . n A 1 45 GLN 45 43 43 GLN GLN A . n A 1 46 ARG 46 44 44 ARG ARG A . n A 1 47 PRO 47 45 45 PRO PRO A . n A 1 48 SER 48 46 46 SER SER A . n A 1 49 ALA 49 47 47 ALA ALA A . n A 1 50 GLU 50 48 48 GLU GLU A . n A 1 51 LYS 51 49 49 LYS LYS A . n A 1 52 LEU 52 50 50 LEU LEU A . n A 1 53 THR 53 51 51 THR THR A . n A 1 54 ALA 54 52 52 ALA ALA A . n A 1 55 LEU 55 53 53 LEU LEU A . n A 1 56 ALA 56 54 54 ALA ALA A . n A 1 57 ASP 57 55 55 ASP ASP A . n A 1 58 ALA 58 56 56 ALA ALA A . n A 1 59 LEU 59 57 57 LEU LEU A . n A 1 60 GLY 60 58 58 GLY GLY A . n A 1 61 VAL 61 59 59 VAL VAL A . n A 1 62 GLY 62 60 60 GLY GLY A . n A 1 63 THR 63 61 61 THR THR A . n A 1 64 SER 64 62 62 SER SER A . n A 1 65 PHE 65 63 63 PHE PHE A . n A 1 66 PHE 66 64 64 PHE PHE A . n A 1 67 LEU 67 65 65 LEU LEU A . n A 1 68 GLU 68 66 66 GLU GLU A . n A 1 69 ASP 69 67 67 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 101 101 SO4 SO4 A . C 2 SO4 1 102 102 SO4 SO4 A . D 3 HOH 1 201 47 HOH HOH A . D 3 HOH 2 202 73 HOH HOH A . D 3 HOH 3 203 45 HOH HOH A . D 3 HOH 4 204 31 HOH HOH A . D 3 HOH 5 205 56 HOH HOH A . D 3 HOH 6 206 11 HOH HOH A . D 3 HOH 7 207 38 HOH HOH A . D 3 HOH 8 208 29 HOH HOH A . D 3 HOH 9 209 86 HOH HOH A . D 3 HOH 10 210 75 HOH HOH A . D 3 HOH 11 211 35 HOH HOH A . D 3 HOH 12 212 26 HOH HOH A . D 3 HOH 13 213 66 HOH HOH A . D 3 HOH 14 214 27 HOH HOH A . D 3 HOH 15 215 18 HOH HOH A . D 3 HOH 16 216 5 HOH HOH A . D 3 HOH 17 217 65 HOH HOH A . D 3 HOH 18 218 69 HOH HOH A . D 3 HOH 19 219 1 HOH HOH A . D 3 HOH 20 220 10 HOH HOH A . D 3 HOH 21 221 4 HOH HOH A . D 3 HOH 22 222 33 HOH HOH A . D 3 HOH 23 223 25 HOH HOH A . D 3 HOH 24 224 9 HOH HOH A . D 3 HOH 25 225 55 HOH HOH A . D 3 HOH 26 226 64 HOH HOH A . D 3 HOH 27 227 74 HOH HOH A . D 3 HOH 28 228 83 HOH HOH A . D 3 HOH 29 229 20 HOH HOH A . D 3 HOH 30 230 13 HOH HOH A . D 3 HOH 31 231 50 HOH HOH A . D 3 HOH 32 232 59 HOH HOH A . D 3 HOH 33 233 58 HOH HOH A . D 3 HOH 34 234 2 HOH HOH A . D 3 HOH 35 235 53 HOH HOH A . D 3 HOH 36 236 28 HOH HOH A . D 3 HOH 37 237 37 HOH HOH A . D 3 HOH 38 238 62 HOH HOH A . D 3 HOH 39 239 39 HOH HOH A . D 3 HOH 40 240 46 HOH HOH A . D 3 HOH 41 241 52 HOH HOH A . D 3 HOH 42 242 30 HOH HOH A . D 3 HOH 43 243 23 HOH HOH A . D 3 HOH 44 244 48 HOH HOH A . D 3 HOH 45 245 34 HOH HOH A . D 3 HOH 46 246 51 HOH HOH A . D 3 HOH 47 247 57 HOH HOH A . D 3 HOH 48 248 6 HOH HOH A . D 3 HOH 49 249 16 HOH HOH A . D 3 HOH 50 250 3 HOH HOH A . D 3 HOH 51 251 12 HOH HOH A . D 3 HOH 52 252 22 HOH HOH A . D 3 HOH 53 253 7 HOH HOH A . D 3 HOH 54 254 43 HOH HOH A . D 3 HOH 55 255 61 HOH HOH A . D 3 HOH 56 256 79 HOH HOH A . D 3 HOH 57 257 15 HOH HOH A . D 3 HOH 58 258 54 HOH HOH A . D 3 HOH 59 259 17 HOH HOH A . D 3 HOH 60 260 71 HOH HOH A . D 3 HOH 61 261 49 HOH HOH A . D 3 HOH 62 262 85 HOH HOH A . D 3 HOH 63 263 42 HOH HOH A . D 3 HOH 64 264 60 HOH HOH A . D 3 HOH 65 265 14 HOH HOH A . D 3 HOH 66 266 19 HOH HOH A . D 3 HOH 67 267 72 HOH HOH A . D 3 HOH 68 268 82 HOH HOH A . D 3 HOH 69 269 87 HOH HOH A . D 3 HOH 70 270 84 HOH HOH A . D 3 HOH 71 271 32 HOH HOH A . D 3 HOH 72 272 80 HOH HOH A . D 3 HOH 73 273 21 HOH HOH A . D 3 HOH 74 274 88 HOH HOH A . D 3 HOH 75 275 68 HOH HOH A . D 3 HOH 76 276 36 HOH HOH A . D 3 HOH 77 277 77 HOH HOH A . D 3 HOH 78 278 78 HOH HOH A . D 3 HOH 79 279 44 HOH HOH A . D 3 HOH 80 280 76 HOH HOH A . D 3 HOH 81 281 40 HOH HOH A . D 3 HOH 82 282 67 HOH HOH A . D 3 HOH 83 283 70 HOH HOH A . D 3 HOH 84 284 41 HOH HOH A . D 3 HOH 85 285 24 HOH HOH A . D 3 HOH 86 286 63 HOH HOH A . D 3 HOH 87 287 81 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 67 ? CG ? A ASP 69 CG 2 1 Y 1 A ASP 67 ? OD1 ? A ASP 69 OD1 3 1 Y 1 A ASP 67 ? OD2 ? A ASP 69 OD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.1_4122 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7T5U _cell.details ? _cell.formula_units_Z ? _cell.length_a 32.374 _cell.length_a_esd ? _cell.length_b 39.715 _cell.length_b_esd ? _cell.length_c 47.231 _cell.length_c_esd ? _cell.volume 60725.516 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7T5U _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7T5U _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.98 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 37.79 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M acetate pH 4.5, 2 M ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-04-25 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00003 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00003 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 8.99 _reflns.entry_id 7T5U _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.02 _reflns.d_resolution_low 39.72 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 25495 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 80.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.6 _reflns.pdbx_Rmerge_I_obs 0.067 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.03 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.02 _reflns_shell.d_res_low 1.04 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 136 _reflns_shell.percent_possible_all 8.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.398 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.298 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.754 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 12.21 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7T5U _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.02 _refine.ls_d_res_low 30.40 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 25448 _refine.ls_number_reflns_R_free 1197 _refine.ls_number_reflns_R_work 24251 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 80.65 _refine.ls_percent_reflns_R_free 4.70 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1637 _refine.ls_R_factor_R_free 0.1764 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1630 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.39 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'ideal alpha helix' _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.4139 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.0825 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.02 _refine_hist.d_res_low 30.40 _refine_hist.number_atoms_solvent 87 _refine_hist.number_atoms_total 614 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 517 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0083 ? 547 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9929 ? 738 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0690 ? 81 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0092 ? 94 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.8966 ? 211 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.02 1.06 . . 14 507 15.13 . . . 0.1700 . 0.1777 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.06 1.11 . . 68 1420 43.13 . . . 0.1555 . 0.1522 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.11 1.17 . . 109 2427 73.15 . . . 0.1302 . 0.1335 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.17 1.24 . . 154 3195 96.21 . . . 0.1784 . 0.1284 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.24 1.34 . . 156 3244 98.41 . . . 0.1331 . 0.1289 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.34 1.47 . . 168 3273 98.48 . . . 0.1809 . 0.1312 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.47 1.69 . . 168 3299 98.94 . . . 0.1574 . 0.1361 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.69 2.12 . . 164 3383 99.89 . . . 0.1673 . 0.1628 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.13 30.40 . . 196 3503 99.97 . . . 0.1954 . 0.1911 . . . . . . . . . . . # _struct.entry_id 7T5U _struct.title 'Structure of E. coli MS115-1 CapH N-terminal domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7T5U _struct_keywords.text 'Helix turn helix, HTH, DdrO, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A1X1LKI5_ECOLX _struct_ref.pdbx_db_accession A0A1X1LKI5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ATRLGEKLRDLRKQRGLTLEKLADMAGLSKSYLWELENRESQRPSAEKLTALADALGVGTSFFLED _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7T5U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 69 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A1X1LKI5 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 67 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 67 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7T5U SER A 1 ? UNP A0A1X1LKI5 ? ? 'expression tag' -1 1 1 7T5U ASN A 2 ? UNP A0A1X1LKI5 ? ? 'expression tag' 0 2 1 7T5U ALA A 3 ? UNP A0A1X1LKI5 ? ? 'expression tag' 1 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 5 ? ARG A 18 ? THR A 3 ARG A 16 1 ? 14 HELX_P HELX_P2 AA2 THR A 21 ? GLY A 30 ? THR A 19 GLY A 28 1 ? 10 HELX_P HELX_P3 AA3 SER A 32 ? ARG A 42 ? SER A 30 ARG A 40 1 ? 11 HELX_P HELX_P4 AA4 SER A 48 ? GLY A 60 ? SER A 46 GLY A 58 1 ? 13 HELX_P HELX_P5 AA5 THR A 63 ? GLU A 68 ? THR A 61 GLU A 66 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 257 ? ? O A HOH 279 ? ? 1.98 2 1 OD2 A ASP 25 ? A O A HOH 201 ? ? 2.07 3 1 O A HOH 202 ? ? O A HOH 271 ? ? 2.09 4 1 O A HOH 275 ? ? O A HOH 287 ? ? 2.10 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLN _pdbx_validate_symm_contact.auth_seq_id_1 15 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 B _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NH1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ARG _pdbx_validate_symm_contact.auth_seq_id_2 40 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_545 _pdbx_validate_symm_contact.dist 1.93 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # _pdbx_entry_details.entry_id 7T5U _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -1 ? A SER 1 2 1 Y 1 A ASN 0 ? A ASN 2 3 1 Y 1 A ALA 1 ? A ALA 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HOH O O N N 123 HOH H1 H N N 124 HOH H2 H N N 125 LEU N N N N 126 LEU CA C N S 127 LEU C C N N 128 LEU O O N N 129 LEU CB C N N 130 LEU CG C N N 131 LEU CD1 C N N 132 LEU CD2 C N N 133 LEU OXT O N N 134 LEU H H N N 135 LEU H2 H N N 136 LEU HA H N N 137 LEU HB2 H N N 138 LEU HB3 H N N 139 LEU HG H N N 140 LEU HD11 H N N 141 LEU HD12 H N N 142 LEU HD13 H N N 143 LEU HD21 H N N 144 LEU HD22 H N N 145 LEU HD23 H N N 146 LEU HXT H N N 147 LYS N N N N 148 LYS CA C N S 149 LYS C C N N 150 LYS O O N N 151 LYS CB C N N 152 LYS CG C N N 153 LYS CD C N N 154 LYS CE C N N 155 LYS NZ N N N 156 LYS OXT O N N 157 LYS H H N N 158 LYS H2 H N N 159 LYS HA H N N 160 LYS HB2 H N N 161 LYS HB3 H N N 162 LYS HG2 H N N 163 LYS HG3 H N N 164 LYS HD2 H N N 165 LYS HD3 H N N 166 LYS HE2 H N N 167 LYS HE3 H N N 168 LYS HZ1 H N N 169 LYS HZ2 H N N 170 LYS HZ3 H N N 171 LYS HXT H N N 172 MET N N N N 173 MET CA C N S 174 MET C C N N 175 MET O O N N 176 MET CB C N N 177 MET CG C N N 178 MET SD S N N 179 MET CE C N N 180 MET OXT O N N 181 MET H H N N 182 MET H2 H N N 183 MET HA H N N 184 MET HB2 H N N 185 MET HB3 H N N 186 MET HG2 H N N 187 MET HG3 H N N 188 MET HE1 H N N 189 MET HE2 H N N 190 MET HE3 H N N 191 MET HXT H N N 192 PHE N N N N 193 PHE CA C N S 194 PHE C C N N 195 PHE O O N N 196 PHE CB C N N 197 PHE CG C Y N 198 PHE CD1 C Y N 199 PHE CD2 C Y N 200 PHE CE1 C Y N 201 PHE CE2 C Y N 202 PHE CZ C Y N 203 PHE OXT O N N 204 PHE H H N N 205 PHE H2 H N N 206 PHE HA H N N 207 PHE HB2 H N N 208 PHE HB3 H N N 209 PHE HD1 H N N 210 PHE HD2 H N N 211 PHE HE1 H N N 212 PHE HE2 H N N 213 PHE HZ H N N 214 PHE HXT H N N 215 PRO N N N N 216 PRO CA C N S 217 PRO C C N N 218 PRO O O N N 219 PRO CB C N N 220 PRO CG C N N 221 PRO CD C N N 222 PRO OXT O N N 223 PRO H H N N 224 PRO HA H N N 225 PRO HB2 H N N 226 PRO HB3 H N N 227 PRO HG2 H N N 228 PRO HG3 H N N 229 PRO HD2 H N N 230 PRO HD3 H N N 231 PRO HXT H N N 232 SER N N N N 233 SER CA C N S 234 SER C C N N 235 SER O O N N 236 SER CB C N N 237 SER OG O N N 238 SER OXT O N N 239 SER H H N N 240 SER H2 H N N 241 SER HA H N N 242 SER HB2 H N N 243 SER HB3 H N N 244 SER HG H N N 245 SER HXT H N N 246 SO4 S S N N 247 SO4 O1 O N N 248 SO4 O2 O N N 249 SO4 O3 O N N 250 SO4 O4 O N N 251 THR N N N N 252 THR CA C N S 253 THR C C N N 254 THR O O N N 255 THR CB C N R 256 THR OG1 O N N 257 THR CG2 C N N 258 THR OXT O N N 259 THR H H N N 260 THR H2 H N N 261 THR HA H N N 262 THR HB H N N 263 THR HG1 H N N 264 THR HG21 H N N 265 THR HG22 H N N 266 THR HG23 H N N 267 THR HXT H N N 268 TRP N N N N 269 TRP CA C N S 270 TRP C C N N 271 TRP O O N N 272 TRP CB C N N 273 TRP CG C Y N 274 TRP CD1 C Y N 275 TRP CD2 C Y N 276 TRP NE1 N Y N 277 TRP CE2 C Y N 278 TRP CE3 C Y N 279 TRP CZ2 C Y N 280 TRP CZ3 C Y N 281 TRP CH2 C Y N 282 TRP OXT O N N 283 TRP H H N N 284 TRP H2 H N N 285 TRP HA H N N 286 TRP HB2 H N N 287 TRP HB3 H N N 288 TRP HD1 H N N 289 TRP HE1 H N N 290 TRP HE3 H N N 291 TRP HZ2 H N N 292 TRP HZ3 H N N 293 TRP HH2 H N N 294 TRP HXT H N N 295 TYR N N N N 296 TYR CA C N S 297 TYR C C N N 298 TYR O O N N 299 TYR CB C N N 300 TYR CG C Y N 301 TYR CD1 C Y N 302 TYR CD2 C Y N 303 TYR CE1 C Y N 304 TYR CE2 C Y N 305 TYR CZ C Y N 306 TYR OH O N N 307 TYR OXT O N N 308 TYR H H N N 309 TYR H2 H N N 310 TYR HA H N N 311 TYR HB2 H N N 312 TYR HB3 H N N 313 TYR HD1 H N N 314 TYR HD2 H N N 315 TYR HE1 H N N 316 TYR HE2 H N N 317 TYR HH H N N 318 TYR HXT H N N 319 VAL N N N N 320 VAL CA C N S 321 VAL C C N N 322 VAL O O N N 323 VAL CB C N N 324 VAL CG1 C N N 325 VAL CG2 C N N 326 VAL OXT O N N 327 VAL H H N N 328 VAL H2 H N N 329 VAL HA H N N 330 VAL HB H N N 331 VAL HG11 H N N 332 VAL HG12 H N N 333 VAL HG13 H N N 334 VAL HG21 H N N 335 VAL HG22 H N N 336 VAL HG23 H N N 337 VAL HXT H N N 338 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HOH O H1 sing N N 116 HOH O H2 sing N N 117 LEU N CA sing N N 118 LEU N H sing N N 119 LEU N H2 sing N N 120 LEU CA C sing N N 121 LEU CA CB sing N N 122 LEU CA HA sing N N 123 LEU C O doub N N 124 LEU C OXT sing N N 125 LEU CB CG sing N N 126 LEU CB HB2 sing N N 127 LEU CB HB3 sing N N 128 LEU CG CD1 sing N N 129 LEU CG CD2 sing N N 130 LEU CG HG sing N N 131 LEU CD1 HD11 sing N N 132 LEU CD1 HD12 sing N N 133 LEU CD1 HD13 sing N N 134 LEU CD2 HD21 sing N N 135 LEU CD2 HD22 sing N N 136 LEU CD2 HD23 sing N N 137 LEU OXT HXT sing N N 138 LYS N CA sing N N 139 LYS N H sing N N 140 LYS N H2 sing N N 141 LYS CA C sing N N 142 LYS CA CB sing N N 143 LYS CA HA sing N N 144 LYS C O doub N N 145 LYS C OXT sing N N 146 LYS CB CG sing N N 147 LYS CB HB2 sing N N 148 LYS CB HB3 sing N N 149 LYS CG CD sing N N 150 LYS CG HG2 sing N N 151 LYS CG HG3 sing N N 152 LYS CD CE sing N N 153 LYS CD HD2 sing N N 154 LYS CD HD3 sing N N 155 LYS CE NZ sing N N 156 LYS CE HE2 sing N N 157 LYS CE HE3 sing N N 158 LYS NZ HZ1 sing N N 159 LYS NZ HZ2 sing N N 160 LYS NZ HZ3 sing N N 161 LYS OXT HXT sing N N 162 MET N CA sing N N 163 MET N H sing N N 164 MET N H2 sing N N 165 MET CA C sing N N 166 MET CA CB sing N N 167 MET CA HA sing N N 168 MET C O doub N N 169 MET C OXT sing N N 170 MET CB CG sing N N 171 MET CB HB2 sing N N 172 MET CB HB3 sing N N 173 MET CG SD sing N N 174 MET CG HG2 sing N N 175 MET CG HG3 sing N N 176 MET SD CE sing N N 177 MET CE HE1 sing N N 178 MET CE HE2 sing N N 179 MET CE HE3 sing N N 180 MET OXT HXT sing N N 181 PHE N CA sing N N 182 PHE N H sing N N 183 PHE N H2 sing N N 184 PHE CA C sing N N 185 PHE CA CB sing N N 186 PHE CA HA sing N N 187 PHE C O doub N N 188 PHE C OXT sing N N 189 PHE CB CG sing N N 190 PHE CB HB2 sing N N 191 PHE CB HB3 sing N N 192 PHE CG CD1 doub Y N 193 PHE CG CD2 sing Y N 194 PHE CD1 CE1 sing Y N 195 PHE CD1 HD1 sing N N 196 PHE CD2 CE2 doub Y N 197 PHE CD2 HD2 sing N N 198 PHE CE1 CZ doub Y N 199 PHE CE1 HE1 sing N N 200 PHE CE2 CZ sing Y N 201 PHE CE2 HE2 sing N N 202 PHE CZ HZ sing N N 203 PHE OXT HXT sing N N 204 PRO N CA sing N N 205 PRO N CD sing N N 206 PRO N H sing N N 207 PRO CA C sing N N 208 PRO CA CB sing N N 209 PRO CA HA sing N N 210 PRO C O doub N N 211 PRO C OXT sing N N 212 PRO CB CG sing N N 213 PRO CB HB2 sing N N 214 PRO CB HB3 sing N N 215 PRO CG CD sing N N 216 PRO CG HG2 sing N N 217 PRO CG HG3 sing N N 218 PRO CD HD2 sing N N 219 PRO CD HD3 sing N N 220 PRO OXT HXT sing N N 221 SER N CA sing N N 222 SER N H sing N N 223 SER N H2 sing N N 224 SER CA C sing N N 225 SER CA CB sing N N 226 SER CA HA sing N N 227 SER C O doub N N 228 SER C OXT sing N N 229 SER CB OG sing N N 230 SER CB HB2 sing N N 231 SER CB HB3 sing N N 232 SER OG HG sing N N 233 SER OXT HXT sing N N 234 SO4 S O1 doub N N 235 SO4 S O2 doub N N 236 SO4 S O3 sing N N 237 SO4 S O4 sing N N 238 THR N CA sing N N 239 THR N H sing N N 240 THR N H2 sing N N 241 THR CA C sing N N 242 THR CA CB sing N N 243 THR CA HA sing N N 244 THR C O doub N N 245 THR C OXT sing N N 246 THR CB OG1 sing N N 247 THR CB CG2 sing N N 248 THR CB HB sing N N 249 THR OG1 HG1 sing N N 250 THR CG2 HG21 sing N N 251 THR CG2 HG22 sing N N 252 THR CG2 HG23 sing N N 253 THR OXT HXT sing N N 254 TRP N CA sing N N 255 TRP N H sing N N 256 TRP N H2 sing N N 257 TRP CA C sing N N 258 TRP CA CB sing N N 259 TRP CA HA sing N N 260 TRP C O doub N N 261 TRP C OXT sing N N 262 TRP CB CG sing N N 263 TRP CB HB2 sing N N 264 TRP CB HB3 sing N N 265 TRP CG CD1 doub Y N 266 TRP CG CD2 sing Y N 267 TRP CD1 NE1 sing Y N 268 TRP CD1 HD1 sing N N 269 TRP CD2 CE2 doub Y N 270 TRP CD2 CE3 sing Y N 271 TRP NE1 CE2 sing Y N 272 TRP NE1 HE1 sing N N 273 TRP CE2 CZ2 sing Y N 274 TRP CE3 CZ3 doub Y N 275 TRP CE3 HE3 sing N N 276 TRP CZ2 CH2 doub Y N 277 TRP CZ2 HZ2 sing N N 278 TRP CZ3 CH2 sing Y N 279 TRP CZ3 HZ3 sing N N 280 TRP CH2 HH2 sing N N 281 TRP OXT HXT sing N N 282 TYR N CA sing N N 283 TYR N H sing N N 284 TYR N H2 sing N N 285 TYR CA C sing N N 286 TYR CA CB sing N N 287 TYR CA HA sing N N 288 TYR C O doub N N 289 TYR C OXT sing N N 290 TYR CB CG sing N N 291 TYR CB HB2 sing N N 292 TYR CB HB3 sing N N 293 TYR CG CD1 doub Y N 294 TYR CG CD2 sing Y N 295 TYR CD1 CE1 sing Y N 296 TYR CD1 HD1 sing N N 297 TYR CD2 CE2 doub Y N 298 TYR CD2 HD2 sing N N 299 TYR CE1 CZ doub Y N 300 TYR CE1 HE1 sing N N 301 TYR CE2 CZ sing Y N 302 TYR CE2 HE2 sing N N 303 TYR CZ OH sing N N 304 TYR OH HH sing N N 305 TYR OXT HXT sing N N 306 VAL N CA sing N N 307 VAL N H sing N N 308 VAL N H2 sing N N 309 VAL CA C sing N N 310 VAL CA CB sing N N 311 VAL CA HA sing N N 312 VAL C O doub N N 313 VAL C OXT sing N N 314 VAL CB CG1 sing N N 315 VAL CB CG2 sing N N 316 VAL CB HB sing N N 317 VAL CG1 HG11 sing N N 318 VAL CG1 HG12 sing N N 319 VAL CG1 HG13 sing N N 320 VAL CG2 HG21 sing N N 321 VAL CG2 HG22 sing N N 322 VAL CG2 HG23 sing N N 323 VAL OXT HXT sing N N 324 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'R21 AI148814' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'ideal alpha helix' # _pdbx_related_exp_data_set.data_reference 10.15785/SBGRID/866 _pdbx_related_exp_data_set.data_set_type 'diffraction image data' _pdbx_related_exp_data_set.details ? _pdbx_related_exp_data_set.metadata_reference 10.15785/SBGRID/866 _pdbx_related_exp_data_set.ordinal 1 # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 7T5U _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.030889 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025179 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021173 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.53795 0.34799 0.11320 ? 10.08003 29.74760 2.57510 ? 0.0 ;3-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_